Overview
Sequence
The following sequences are available for this feature:
transcript sequence >TCONS_00045294 ID=TCONS_00045294|Name=TCONS_00045294|organism=Clytia hemisphaerica|type=transcript|length=501bpRun BLAST on NCBI transcript from alignment at sc0007437:4..918- Legend: exon Hold the cursor over a type above to highlight its positions in the sequence below.>TCONS_00045294 ID=TCONS_00045294|Name=TCONS_00045294|organism=Clytia hemisphaerica|type=transcript|length=915bp|location=Sequence derived from alignment at sc0007437:4..918- (Clytia hemisphaerica) Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Position
The following features are aligned
Expression
Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Values :
GrOo_1 GrOo_2 FGOo_1 FGOo_2 EG_1 EG_2 P1_1 P1_2 P2_1 P2_2 P3_1 P3_2 PoPr_1 PoPr_2 St_1 St_2 GO_1 GO_2 PH_1 PH_2 BMF_1 BMF_2 MMF_1 MMF_2 M_1 M_2 GEC_1 GEC_2 GEN_1 GEN_2 Blast
BLAST of TCONS_00045294 vs. Swiss-Prot (Human)
Match: S39A9 (Zinc transporter ZIP9 OS=Homo sapiens GN=SLC39A9 PE=1 SV=2) HSP 1 Score: 74.3294 bits (181), Expect = 2.664e-16 Identity = 32/65 (49.23%), Postives = 49/65 (75.38%), Query Frame = 2 Query: 305 MEPATRLFWLSFSMLIGCYIFGSIPLTLSFTERNMRSVSIGGAGLIVGTALSVIIPEGVHAMYDS 499 M+ + LS +ML+GCY+ G IPL ++F+E ++ V++ GAGL+ GTAL+VI+PEGVHA+Y+ Sbjct: 1 MDDFISISLLSLAMLVGCYVAGIIPLAVNFSEERLKLVTVLGAGLLCGTALAVIVPEGVHALYED 65 The following BLAST results are available for this feature:
BLAST of TCONS_00045294 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens)) Total hits: 1
|