Overview
Sequence
The following sequences are available for this feature:
transcript sequence >TCONS_00004077 ID=TCONS_00004077|Name=TCONS_00004077|organism=Clytia hemisphaerica|type=transcript|length=501bpRun BLAST on NCBI transcript from alignment at sc0000039:775326..775826+ Legend: exon Hold the cursor over a type above to highlight its positions in the sequence below.>TCONS_00004077 ID=TCONS_00004077|Name=TCONS_00004077|organism=Clytia hemisphaerica|type=transcript|length=501bp|location=Sequence derived from alignment at sc0000039:775326..775826+ (Clytia hemisphaerica) Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Position
The following features are aligned
Expression
Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Values :
GrOo_1 GrOo_2 FGOo_1 FGOo_2 EG_1 EG_2 P1_1 P1_2 P2_1 P2_2 P3_1 P3_2 PoPr_1 PoPr_2 St_1 St_2 GO_1 GO_2 PH_1 PH_2 BMF_1 BMF_2 MMF_1 MMF_2 M_1 M_2 GEC_1 GEC_2 GEN_1 GEN_2 Blast
BLAST of TCONS_00004077 vs. Swiss-Prot (Human)
Match: TM234 (Transmembrane protein 234 OS=Homo sapiens GN=TMEM234 PE=1 SV=1) HSP 1 Score: 92.4337 bits (228), Expect = 2.233e-23 Identity = 43/109 (39.45%), Postives = 69/109 (63.30%), Query Frame = 3 Query: 93 WGATNPFLRQGSKGLEKIKHERFLHQILAELTHLCKNWKFTLPFLLNQSGSVFYNILVARLDLSLAVPVVNSLTFLMTMLTGAFLKEDL-TRRKLFGSFLVLSGVTLCV 416 WG T P L++ S GL+++ + Q+L E+ L N ++ +PFLLNQ GS+ Y + +A DL+LAVP+ NSL + T++ G L ED+ +R + G L + G++LC+ Sbjct: 18 WGGTQPLLKRASAGLQRVHEPTWAQQLLQEMKTLFLNTEYLMPFLLNQCGSLLYYLTLASTDLTLAVPICNSLAIIFTLIVGKALGEDIGGKRAVAGMVLTVIGISLCI 126 The following BLAST results are available for this feature:
BLAST of TCONS_00004077 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens)) Total hits: 1
|