Sequence
The following sequences are available for this feature:
polypeptide sequence
>TCONS_00066643-protein ID=TCONS_00066643-protein|Name=TCONS_00066643-protein|organism=Clytia hemisphaerica|type=polypeptide|length=290bp Run BLAST on NCBI
Gene-mRNA-Prot
This polypeptide comes from the following
gene feature:
This polypeptide derives from the following
transcript feature(s):
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
Term Definition
GO:0008289 lipid binding
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category
Term Accession
Term Name
molecular_function
GO:0008289 lipid binding
InterPro
Analysis Name:
InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
50 100 150 200 250 Expect = 1.8E-12 / Score = 57.4 Expect = 8.0E-23 / Score = 80.8 Score = 28.622 Expect = 2.5E-46 / Score = 157.4 Expect = 4.98792E-110 / Score = 319.587 Score = Sequence SM00234 PF01852 PS50848 G3DSA:3.30.530.20 cd08871 SSF55961
IPR Term IPR Description Source Source Term Source Description Alignment
IPR002913 START domain SMART SM00234 START_1 coord: 27..229 IPR002913 START domain PFAM PF01852 START coord: 43..221 IPR002913 START domain PROSITE PS50848 START coord: 43..227 IPR023393 START-like domain GENE3D 3.30.530.20 coord: 23..238 None No IPR available CDD cd08871 START_STARD10-like coord: 23..243 None No IPR available SUPERFAMILY 55961 Bet v1-like coord: 30..220
Blast
BLAST of TCONS_00066643-protein vs. Swiss-Prot (Human)
Match:
STA10 (START domain-containing protein 10 OS=Homo sapiens GN=STARD10 PE=1 SV=2)
HSP 1 Score: 181.8 bits (460), Expect = 9.362e-56
Identity = 102/268 (38.06%), Postives = 147/268 (54.85%), Query Frame = 0
Query: 26 VRVSTDKDFEHFHSLVNNDDGWTNSYNKNNLIVKTRWTDESR-IKLIKVSYPMENVTLETLYDALHDPEYRKVWDKDMANSYDICKLNDNNVIGWYAAKMPPPLKFRDWCLLRTWKKTDKEFMIFNHSVEHNAVPVRKNYVRSISYLTGYYGKKLDKNTTQMIFLTQTDPKGKLPKWFVNFLSTSMAPRIMKKLYKTTLGYEKWHKKSGAAHKPWLEPEHNKLPLLDRKDIPACNSNDDDGFEMIDED-IDETNAE-MEEKISNGSDE 290
V+V D+DF F S + GW +Y++ + V + + R + IK +V ETLYD LHD EYRK WD ++ ++DI +L N +G+Y+ + P PLK RD LR+W +++I N+SV+H P RK+ VR++S TGY + + + +L Q DPKG LPKW VN S +AP+ MKK+YK L Y +W +K KPWL PE + LP L ++ + D E IDE + E+ E M GSD+
Sbjct: 22 VQVPDDQDFRSFRSECEAEVGWNLTYSRAGVSVWVQAVEMDRTLHKIKCRMECCDVPAETLYDVLHDIEYRKKWDSNVIETFDIARLTVNADVGYYSWRCPKPLKNRDVITLRSWLPMGADYIIMNYSVKHPKYPPRKDLVRAVSIQTGYLIQSTGPKSCVITYLAQVDPKGSLPKWVVNKSSQFLAPKAMKKMYKACLKYPEWKQKHLPHFKPWLHPEQSPLPSLALSEL---SVQHADSLENIDESAVAESREERMGGAGGEGSDD 286
The following BLAST results are available for this feature:
BLAST of TCONS_00066643-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (
Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens) )
Total hits: 1
F L K F L M S N D Q H L Q S D L Y K I K M D V N E V R V S T D K D F E H F H S L V N N D D G W T N S Y N K N N L I V K T R W T D E S R I K L I K V S Y P M E N V T L E T L Y D A L H D P E Y R K V W D K D M A N S Y D I C K L N D N N V I G W Y A A K M P P P L K F R D W C L L R T W K K T D K E F M I F N H S V E H N A V P V R K N Y V R S I S Y L T G Y Y G K K L D K N T T Q M I F L T Q T D P K G K L P K W F V N F L S T S M A P R I M K K L Y K T T L G Y E K W H K K S G A A H K P W L E P E H N K L P L L D R K D I P A C N S N D D D G F E M I D E D I D E T N A E M E E K I S N G S D E 50 100 150 200 250 Expect = 9.36e-56 / Id = 38.06 Sequence STA10
Match Name E-value Identity Description
STA10 9.362e-56 38.06 START domain-containing protein 10 OS=Homo sapiens... [more]
back to top
