Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00058764-protein ID=TCONS_00058764-protein|Name=TCONS_00058764-protein|organism=Clytia hemisphaerica|type=polypeptide|length=149bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00058764-protein vs. Swiss-Prot (Human)
Match: EFC10 (EF-hand calcium-binding domain-containing protein 10 OS=Homo sapiens GN=EFCAB10 PE=2 SV=2) HSP 1 Score: 80.8777 bits (198), Expect = 1.781e-20 Identity = 41/121 (33.88%), Postives = 73/121 (60.33%), Query Frame = 0 Query: 20 REEIAKYYLKKHRITDLFDNITAALVYQRPDDPKEFMIDYIKKLRDSKAAKLDYPSLFDETNVRSLFGIMDPAKKGYINHSQYKSGMENIGVSTYERNPPGSDEDQIGLDVFVIEAKEGLK 140 RE A YL+KH+I ++ +T+AL++ RP+ PKE++I +++LR +K + +P D +N+ ++F +MD + +G I+ QYK ++ +G+ T E D +I LD F E + +K Sbjct: 6 RELQAAEYLEKHQIKEVVSYLTSALLFFRPEKPKEYLISLLERLRIAKVTGVAFPFFMDNSNIVAMFEMMDSSGRGTISFVQYKEALKTLGLCT-EDEDLQDDGHKITLDKFKEEVNKRMK 125 The following BLAST results are available for this feature:
BLAST of TCONS_00058764-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|