Sequence
The following sequences are available for this feature:
polypeptide sequence
>TCONS_00002172-protein ID=TCONS_00002172-protein|Name=TCONS_00002172-protein|organism=Clytia hemisphaerica|type=polypeptide|length=1223bp Run BLAST on NCBI
Gene-mRNA-Prot
This polypeptide comes from the following
gene feature:
This polypeptide derives from the following
transcript feature(s):
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
Term Definition
GO:0005515 protein binding
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category
Term Accession
Term Name
molecular_function
GO:0005515 protein binding
InterPro
Analysis Name:
InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
100 200 300 400 500 600 700 800 900 1000 1100 1200 Score = Score = Score = Score = Score = Score = Score = Score = Score = Score = Score = Expect = 6.00226E-33 / Score = 124.418 Expect = 6.55105E-12 / Score = 63.1714 Expect = 1.3 / Score = 18.0 Expect = 0.0013 / Score = 28.0 Expect = 110.0 / Score = 11.6 Expect = 92.0 / Score = 11.9 Expect = 3.6E-4 / Score = 29.9 Score = 9.965 Score = 9.618 Score = 13.33 Score = 12.102 Expect = 1.1E-18 / Score = 66.8 Expect = 3.1E-12 / Score = 46.8 Expect = 4.1E-10 / Score = 40.0 Expect = 9.3E-34 / Score = 116.3 Score = 45.519 Score = Sequence Coil Coil mobidb-lite mobidb-lite mobidb-lite mobidb-lite mobidb-lite mobidb-lite mobidb-lite mobidb-lite mobidb-lite cd00204 cd00204 SM00248 PS50088 PS50088 PS50088 PS50088 G3DSA:1.25.40.20 PF12796 G3DSA:1.25.40.20 PS50297 SSF48403
IPR Term IPR Description Source Source Term Source Description Alignment
None No IPR available COILS Coil Coil coord: 1030..1078 None No IPR available COILS Coil Coil coord: 862..889 None No IPR available MOBIDB_LITE mobidb-lite disorder_prediction coord: 1..101 None No IPR available MOBIDB_LITE mobidb-lite disorder_prediction coord: 845..866 None No IPR available MOBIDB_LITE mobidb-lite disorder_prediction coord: 503..553 None No IPR available MOBIDB_LITE mobidb-lite disorder_prediction coord: 723..809 None No IPR available MOBIDB_LITE mobidb-lite disorder_prediction coord: 1108..1223 None No IPR available MOBIDB_LITE mobidb-lite disorder_prediction coord: 369..400 None No IPR available MOBIDB_LITE mobidb-lite disorder_prediction coord: 889..1000 None No IPR available MOBIDB_LITE mobidb-lite disorder_prediction coord: 595..615 None No IPR available MOBIDB_LITE mobidb-lite disorder_prediction coord: 449..480 None No IPR available CDD cd00204 ANK coord: 178..303 None No IPR available CDD cd00204 ANK coord: 117..204 IPR002110 Ankyrin repeat SMART SM00248 ANK_2a coord: 282..311 IPR002110 Ankyrin repeat PROSITE PS50088 ANK_REPEAT coord: 249..281 IPR002110 Ankyrin repeat PROSITE PS50088 ANK_REPEAT coord: 216..248 IPR002110 Ankyrin repeat PROSITE PS50088 ANK_REPEAT coord: 282..314 IPR002110 Ankyrin repeat PROSITE PS50088 ANK_REPEAT coord: 183..215 IPR020683 Ankyrin repeat-containing domain GENE3D 1.25.40.20 coord: 253..323 IPR020683 Ankyrin repeat-containing domain PFAM PF12796 Ank_2 coord: 221..313 IPR020683 Ankyrin repeat-containing domain GENE3D 1.25.40.20 coord: 13..252 IPR020683 Ankyrin repeat-containing domain PROSITE PS50297 ANK_REP_REGION coord: 147..319 IPR020683 Ankyrin repeat-containing domain SUPERFAMILY 48403 Ankyrin repeat coord: 116..321
Blast
BLAST of TCONS_00002172-protein vs. Swiss-Prot (Human)
Match:
POTB2 (POTE ankyrin domain family member B2 OS=Homo sapiens GN=POTEB2 PE=3 SV=1)
HSP 1 Score: 105.916 bits (263), Expect = 2.163e-23
Identity = 62/208 (29.81%), Postives = 106/208 (50.96%), Query Frame = 0
Query: 145 DRRNRNCLHYAAYLGYTEILETLLNRTDAHKIINAKDDSGKTPLFKAAETSSLACVEILLNHGSDVTIQDNDGISVMHVATLADNAMVMKTLWKHKADLNTKDKLGFTPLHLAAGLGLRGPTHFLLRHGAVVDPIDGKGRTPLLAAAADKNVEIIEILLQHGANATIQDDRGRTAKNIFSTLTLDRRFSDIQPTRTTSSHHFPFEMIT 352
D++ R LH A+ G +E+++ LL+R +N D+ +T L KA + CV +LL HG+D IQD G + +H A ++ ++ K L + AD+ +K+K G TPL L + FL++ A ++ +D GRT L+ A + I+ +LL+ + + QD G+TA R ++ +S HH E+++
Sbjct: 133 DKQKRTALHLASANGNSEVVQLLLDRRCQ---LNVLDNKKRTALIKAVQCQEDECVLMLLEHGADGNIQDEYGNTALHYAIYNEDKLMAKALLLYGADIESKNKCGLTPLLLGVHEQKQEVVKFLIKKKANLNALDRYGRTALILAVCCGSASIVNLLLEQNVDVSSQDLSGQTA----------REYA------VSSHHHVICELLS 321
The following BLAST results are available for this feature:
