SKE-T (transcript) - P. lividus

Overview
NameSKE-T
Unique NameAJ309216.1
Typetranscript
OrganismParacentrotus lividus (Sea urchin)
Sequence length4249
Sequence
The following sequences are available for this feature:

transcript sequence

>AJ309216.1 ID=AJ309216.1|Name=SKE-T|organism=Paracentrotus lividus|type=transcript|length=4249bp
GATTGACGCTTTCTTATTAAAGAAGAGTTCGCAGCTTGATATTTGACAGT
TCCTTGTGAATTTGATGGCAGTTCGTCTCACGCCCATATGGGAGGATCGC
ATACAATCACACCTGGGAATTCTTTTAAGAAAAGTGTTAAAATCGTCGTG
AGAACTTCATCAACATTCGCGCCTTCTCACTCCTTTGTTTATCCATGTAA
TTTGTGATCACAGTTTTTTCGCACTCCGAGATAGTCTGTAACCTAAAGAG
ATTAAATTCTAACGCCTTCGCGCCTTTTTCTCTTGGTGCGATTTTCTTTT
TTCAGTGGAAATGATGGGGGAAGAATTGCAAAACGTGACAGATCAGAATC
ATCAACACACTCCTGCAACTAACCTGACAAAATTCCAAAAGACAGAACAT
GATGAAAATGATGAAGTTTCAGAAGATGATCCTATTGATGGAGATGATGG
GAGCTGTGGATCGCAGGGAAACAACGATTGTGATGTCAATGGAGACGGGA
CAACTATCGAACAATATAACATCAATAAATCAACTCTAAACGCAGAACAA
AACATCGGAAGAGATCAAAGCGACTACCCTTGCAAGAAATTTGAGCTATG
TGAACTCAAGTCCAACTTGGAGAATTCCCAACCTGGGAAAGAAACTGGTT
TGTTTGAGCAGAATGGACCAGGAAAGGTTGAACAGAAATCGTATGAATAT
CATGATTTCAATACACACAATGAAACAAATGAGAATGTGCAGGGATATCA
TTCTTTCCCAAACCTGCAAAACCAGCAGCAACAATTGCCGCAATACTTGT
TAAATAGCTCCGTTTCAAACTTCACTGGAATTCCAACCCCGCCGCCGGTC
AGCACTCAACCTCAACAGGTGCGTTTTGACGCAGCTTCATATACAGACGG
ATACCCGCATCTTTCTCAGCCGGTACCAACCCACCAGCAATCCACCTTGT
CGGAGAACCCTTCTTTAATCAATGCATTGAATCACAATCTCCATGAAACT
GGCTTTTCAGCAATCCAAAGCAACTCGCAGGAAACTTCTCCAAGTTGTAA
CAACAGCGCAGACGAAAAACTCAGTATAAATCACGATCCCAACCACCATC
ACCTACAACAACAACATCAGCAGCAGCAACAACAGCAACCGATGCCTGAT
TTTGACATGAAGAAAGATTTTGCGCATAACGATATTCAGGCGCCGCCATT
CTTTGTCGAAAACAAGCCGCAACATCAGACGACAGCTACCTTATCACAGC
ACATCATCGGCGGTTCCGTGGCGCCTTCACCCTTCAGCTTCGGTCACCTT
CCGATCGGCAGCGACGCGCACGGACAAGAAGACGAAGACTTGAAAAGTTT
TCTCCCGAATCACCACCTCGTCAACCAGCAGCAATACCCGCCTCCAGCAG
GACACCAGCATGTCGAAGTTGCCAATGGACCGGAGAAAGCGGTGGTGTAT
CTCTGCAACCGTGACTTGTGGCGAAAGTTTCATCAGCATAAGACGGAGAT
GATTATCACCAAGCAGGGAAGACGAATGTTTCCTCAACTCGTGTATAAAC
TGAGTGGATTAAATCCTACCTCTCAGTATAATGTCTTTGTTGACATGGTG
CTATGTGATCCCAATCAATGGAAGTTCCAGTGTGGTAAATGGATACCGTG
TGGACAAGCTGAGAACATTCCAAAAGTAAGCAATACCTACCTCCATCCCG
ATTCGCCAAGCAACGGCCTTCATTGGATGCACCAGGACATTGTATTTAGC
AAGCTCAAACTGACAAACCATCGAGGCAAAGATAATGGATTTGTGGTCCT
GAACTCTATGCACAAGTATCAGCCTCGGATCCATGTTCTGGAGTTGGGTG
AGAGTCGATCTCTCCAGACACACAGCTTTCCGGAGACGCGGTTCTTTGGT
GTGACTGCTTACCAAAATACTGATGTAACCCAACTAAAGATTGACTATAA
TCCTTTTGCAAAAGGCTTCAGAGATAACTATGACAACTTATCACCACGTG
ACATCAGTATTCTATCAAATGCTCCAAGATCAAAGAACGTTACAGTCAGC
AGGAACTCGTGCCCTGCACCTGTAGTCAACGCAGCCAATATCTCCATGGG
TCAGTTTCCACCTGTCAACTTACACAAGTCCGGTCACTTTCAGCACCCTT
ACCACCACCATCATCCGTACCACCACCACCCCATCCATTACCGCCCTCAC
CAGGACCATCATCAGCACCAAGCCCGCCCTCATCTACCACTCCCAACATT
CCAGCATCGTCAACCGCAGATGACTCCACTAGGAAATAGCGTAGGTCAAG
CCCCAGCGGGTTGCACGGGTCCGACTGGCGGAAATTTTCGGCTCCCGAAG
CCAGACGAGACAGCATTCAAACTCGTAGGGAACGCTTTGCATGTCAGTCG
CCCGACCTTCGTACCAATTAGCCCACCAAATTCGTCAACCACTTCTCCTA
AGCTATTCCCAATTCCCGTGCCTACCTCGCTAGCTCCAGTCTCCGTGCAG
AACTCGTCATGTAGCATGGTCCAGCATCATCAGATCCGGGATGGAGAAGA
ACTGCCTTCCCCATCGGAAGCCGCCACCAACTGTAACACAGATAGCAAGA
CCATCCATTACCATTCCTCCGCCGTGCTTCCCACCGATCTGCCACCAGCT
TGCGATCCGCCGCAACAGATAGACATTTCCCACTTTGGCATGCACACACC
TACTGCCTGCCCCGACACGCATAAACTACAAGATAGACCCGACATGACCT
GGCTCAACACGCCACCTTCCTCGGACTGCTCACCAGATTCCAAATCTAAT
TCGAGCGACAGTGGCGGGGCCCATCCTGCCAAACGCCAGAAGTTGTCCGA
TGAACAACTTTCACAAGGTGCTTCTCCCAAAATGGCGGATCATGGTGACC
AACCCAGCATGGGCGCCTCCTGTAATTATGTGTTCTCATCTACTGTAGAT
AACGGTTATCTCACACAAGAGGGCGCTAAACATAATTACCCTCAAAGCCT
GCAAGGGGAATCGAATGCAACTCCACATCAAGTGTTTCAGCCTTGTGGGA
ACATGTATTTCCCGCAGAGCTTCCCATCCTTCCCCTCGCAACCGTCTGCG
ATAAACGGATATAACCTACCCCATCAACAGTCATATCCATCCATGAACAA
TATGCTCTGTCATGGCCAGTCGTATCCTAATGCATGACTTTTGTCAACAA
AGTCTACTTAATTTCGAACTTTGAACTTGAATATTGCTGAGATAAGAACT
TTTAATTTATATTGTAGAATGGCGTTTGTGCCACCATAGTAGTGGATCCA
GCCTCAGCTTATACAATAAAATGTATCATTCAATACCCAAGCATAATAGA
GCCACTATTGTTCCCAAACAATTGGGCATGCACATCTTTTGTTAGAGCTG
ATAATGAATCCCAACCTTGGACGTATTGTGATATGTAGCAACAGAAAATT
TGAATATATTATAGCATCATGAAAGATAGGTAATGTTTGATATCCATGAA
ATATCTATTTTTCAACTCGCCTCTAGTGCAAACGATGTCTCAGTCATAAA
TCCTGAAATACAATACGAAACTTTGGGTATGATGAGGATAGGATTGAAAA
TGTATATTAAAGCTAGCGTAGAGACAAATTATAAAAACTATAATCTAAAG
TATACGTACATGTGTGTGAAAGCTCGGAGGTTTGAATACTATGTTGAAAA
AAGTTTGGTAAAAGTATCAAATTCTTTCATGCATATAGTGGGGGGGGGGG
TACACGATTAGGTCCTCACCGGGTCAACATGAATATTAAGGTCTGGTGCG
ATGGCCATATTTTATCCTTAGTTTCTTTCTTTTGCTGGGAGATTTTCAGT
TTGTTTGTTTGTTTGTTTTTGCTGCTAATACCCTTGCGATTCTTGTTAAC
GGTTATTGTATCAAATTTCATGTAAAGTTACTTTCCAACAAAGTTATTAA
AAATCCAACATATGTATATCAGCGTCTTTTCTTTTCTTAATTTCAATATT
GTTGCCGAAAATTGTAACCCCACCATGACCTAAATCATGTACTAGTATTA
AATTTTAGAGGAAAAGTATTTGATTAAACTATGTGAACTTGCCATTTGAA
CTATCCGGAAACAAAATATAATATATAAGTATGATCTTGAGTGCGTTGAG
TGTAAATTATTCGTTATGATTTTTCGTCAGTGTTTTTAAATAAATAAGTA
TTTCAATCCATATAAATTTATATAAAAATTAAAAAAAAAAAAAAAAAAA
Run BLAST on NCBI

protein sequence of SKE-T

>CAC51029.1 ID=CAC51029.1|Name=SKE-T|organism=Paracentrotus lividus|type=polypeptide|length=958bp
MMGEELQNVTDQNHQHTPATNLTKFQKTEHDENDEVSEDDPIDGDDGSCG
SQGNNDCDVNGDGTTIEQYNINKSTLNAEQNIGRDQSDYPCKKFELCELK
SNLENSQPGKETGLFEQNGPGKVEQKSYEYHDFNTHNETNENVQGYHSFP
NLQNQQQQLPQYLLNSSVSNFTGIPTPPPVSTQPQQVRFDAASYTDGYPH
LSQPVPTHQQSTLSENPSLINALNHNLHETGFSAIQSNSQETSPSCNNSA
DEKLSINHDPNHHHLQQQHQQQQQQQPMPDFDMKKDFAHNDIQAPPFFVE
NKPQHQTTATLSQHIIGGSVAPSPFSFGHLPIGSDAHGQEDEDLKSFLPN
HHLVNQQQYPPPAGHQHVEVANGPEKAVVYLCNRDLWRKFHQHKTEMIIT
KQGRRMFPQLVYKLSGLNPTSQYNVFVDMVLCDPNQWKFQCGKWIPCGQA
ENIPKVSNTYLHPDSPSNGLHWMHQDIVFSKLKLTNHRGKDNGFVVLNSM
HKYQPRIHVLELGESRSLQTHSFPETRFFGVTAYQNTDVTQLKIDYNPFA
KGFRDNYDNLSPRDISILSNAPRSKNVTVSRNSCPAPVVNAANISMGQFP
PVNLHKSGHFQHPYHHHHPYHHHPIHYRPHQDHHQHQARPHLPLPTFQHR
QPQMTPLGNSVGQAPAGCTGPTGGNFRLPKPDETAFKLVGNALHVSRPTF
VPISPPNSSTTSPKLFPIPVPTSLAPVSVQNSSCSMVQHHQIRDGEELPS
PSEAATNCNTDSKTIHYHSSAVLPTDLPPACDPPQQIDISHFGMHTPTAC
PDTHKLQDRPDMTWLNTPPSSDCSPDSKSNSSDSGGAHPAKRQKLSDEQL
SQGASPKMADHGDQPSMGASCNYVFSSTVDNGYLTQEGAKHNYPQSLQGE
SNATPHQVFQPCGNMYFPQSFPSFPSQPSAINGYNLPHQQSYPSMNNMLC
HGQSYPNA
Run BLAST on NCBI
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
Ske-Tasmbl_13656Paracentrotus lividusgene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
SKE-TCAC51029.1Paracentrotus lividuspolypeptide
Spatial Expression
in the tripal_feature_cv_term.tpl.php