Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00073845 (transcript) - C. hemisphaerica

Overview
NameTCONS_00073845
Unique NameTCONS_00073845
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1736

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00073845 ID=TCONS_00073845|Name=TCONS_00073845|organism=Clytia hemisphaerica|type=transcript|length=1736bp
ACTTTCAGGTCGACCGGTGAATGTACTATCCCTGTCAATCATTGCAACAC
GATTTACCTCAAAGTGAACACACAGCCTATCGAGCCTCCTCTTGTTCTTG
ATCATCACGTTCCTATATTCAACTGGAGTAAATCTGCTGTCGATTCACAA
CATTGGAATCTAACTGCTAAAAGAGTTCTCCCTTACATCGATGGTTTCAA
TCATGTGCAGAAGATCGCAACCCTTGCAAATGTTGATCTTGCTTTGGTCA
GATCAGCCCTTCAAACGCTTGTCTTTCACGGCGTTCTtgagttgactccc
atttttcTATATTCCAACATGTATGCAGTGAAGCCAGAAATTTCTAGCTT
GTATCGCGATGAAGCTTTTCAGAAAGAATGCGTCTCTTTTGTTGCTAGAG
ATAAAACGAATCTGCCTGAATTCCGTGATGTCTTTATGTTGTACTGCGCT
CTCGGTCCCGGCATTTCAGTGAGTGCTTTGTGCGGGAGACATGATCTACA
AGAACTTGGTATTGATGAAAAGAAATTGATATTGTTTGGCATTGTGAAAA
AGATTATccataaattatgtaaattccCAGTATTGACTTCACCGGATTCC
CTCTCGTTAGTGATCAGAGAGAAATCGCGTTGGATGACTGGCTATTATGA
TTATGATGAGATTTGTTGCATGTCTGCAATGAACGGAACTCCCATCACAC
ATGATGAGTTGAACGGCATCACGGAGAATGAACAGCAGGTTGTCCATATT
TGGAAATGACACTTTCAACTTGGTTTAGTTTAGGCCATTTGACTAAAGAT
ATGTAGGTGGATTTTTGGATCATTGTTTTGTAGTCTCTTTCCTCTGCATG
TAAActacttttgttgtttttaccgTATCTTCCCCCATTTTAACGCACAC
TTCAATAGGACGATGCCTCGAATGTTTGTCAGAAACTGTTAATGAATATT
CCCTTAAGTAATTATGAGATACTAGAATTTTGAAGGTAAATTACTCTTTG
AGAAAATATCTCCTTTTTTATCGCGTACCGTTGACAATATTTTTTCGGCT
CAAAATGGGGGAAATACAGGGTATAGTATGTTATGATACTAAATTGAAGA
AGGTATGATCCAAGTCCGTTCCACGACTCGATTTTTCTAGTATGAGCGGG
ctaatttttatgatttttaagatattttgtttttaaataaaagtgatgAT
AACAAAAAGTACGCTGCGTATTTCTCGTGAACGTCAAAGCATAGTCCGTA
AACAATTATCTTATTAAACTGATTTTTCTGTTAGAATTAGGATATGTTTT
CTCGCTGCCTCAGCGGTAGATTACTATAATTCAACGGGGAGCCTATAGAT
AAATGAAAATAGGAAGAAAATGTTTTAGATGGGATTTCATAAGGaagaaa
accaaaaagaaaatgatagaatataaatatttttatacaaagtatagagg
ttttcattttttattaagttacgtaatttccgctatcaaggaagcaaacg
ttcgaatctgtagaggcgatcccttacgcaaatcgaacgttagctaccat
aatggcggaaattatgcaacttgaaggttttatttttacataaatgtttc
cattttatatgagacacatatttcatatcaggacagtggttacctattgt
tatattgtgctgatataagcaaaaaatgtttttcttttcctctttctgac
aaatcttgctccacatccgtgtcaattcaatatcaa
Run BLAST on NCBI

protein sequence of TCONS_00073845-protein

>TCONS_00073845-protein ID=TCONS_00073845-protein|Name=TCONS_00073845-protein|organism=Clytia hemisphaerica|type=polypeptide|length=252bp
TFRSTGECTIPVNHCNTIYLKVNTQPIEPPLVLDHHVPIFNWSKSAVDSQ
HWNLTAKRVLPYIDGFNHVQKIATLANVDLALVRSALQTLVFHGVLELTP
IFLYSNMYAVKPEISSLYRDEAFQKECVSFVARDKTNLPEFRDVFMLYCA
LGPGISVSALCGRHDLQELGIDEKKLILFGIVKKIIHKLCKFPVLTSPDS
LSLVIREKSRWMTGYYDYDEICCMSAMNGTPITHDELNGITENEQQVVHI
WK
Run BLAST on NCBI

transcript from alignment at scaffold_98:237005..238740

Legend: exonthree_prime_UTRCDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00073845 ID=TCONS_00073845|Name=TCONS_00073845|organism=Clytia hemisphaerica|type=transcript|length=1736bp|location=Sequence derived from alignment at scaffold_98:237005..238740 (Clytia hemisphaerica)
ttgatattgaattgacacggatgtggagcaagatttgtcagaaagaggaa aagaaaaacattttttgcttatatcagcacaatataacaataggtaacca ctgtcctgatatgaaatatgtgtctcatataaaatggaaacatttatgta aaaataaaaccttcaagttgcataatttccgccattatggtagctaacgt tcgatttgcgtaagggatcgcctctacagattcgaacgtttgcttccttg atagcggaaattacgtaacttaataaaaaatgaaaacctctatactttgt ataaaaatatttatattctatcattttctttttggttttcttCCTTATGA AATCCCATCTAAAACATTTTCTTCCTATTTTCATTTATCTATAGGCTCCC CGTTGAATTATAGTAATCTACCGCTGAGGCAGCGAGAAAACATATCCTAA TTCTAACAGAAAAATCAGTTTAATAAGATAATTGTTTACGGACTATGCTT TGACGTTCACGAGAAATACGCAGCGTACTTTTTGTTATcatcacttttat ttaaaaacaaaatatcttaaaaatcataaaaattagCCCGCTCATACTAG AAAAATCGAGTCGTGGAACGGACTTGGATCATACCTTCTTCAATTTAGTA TCATAACATACTATACCCTGTATTTCCCCCATTTTGAGCCGAAAAAATAT TGTCAACGGTACGCGATAAAAAAGGAGATATTTTCTCAAAGAGTAATTTA CCTTCAAAATTCTAGTATCTCATAATTACTTAAGGGAATATTCATTAACA GTTTCTGACAAACATTCGAGGCATCGTCCTATTGAAGTGTGCGTTAAAAT GGGGGAAGATAcggtaaaaacaacaaaagtagTTTACATGCAGAGGAAAG AGACTACAAAACAATGATCCAAAAATCCACCTACATATCTTTAGTCAAAT GGCCTAAACTAAACCAAGTTGAAAGTGTCATTTCCAAATATGGACAACCT GCTGTTCATTCTCCGTGATGCCGTTCAACTCATCATGTGTGATGGGAGTT CCGTTCATTGCAGACATGCAACAAATCTCATCATAATCATAATAGCCAGT CATCCAACGCGATTTCTCTCTGATCACTAACGAGAGGGAATCCGGTGAAG TCAATACTGggaatttacataatttatggATAATCTTTTTCACAATGCCA AACAATATCAATTTCTTTTCATCAATACCAAGTTCTTGTAGATCATGTCT CCCGCACAAAGCACTCACTGAAATGCCGGGACCGAGAGCGCAGTACAACA TAAAGACATCACGGAATTCAGGCAGATTCGTTTTATCTCTAGCAACAAAA GAGACGCATTCTTTCTGAAAAGCTTCATCGCGATACAAGCTAGAAATTTC TGGCTTCACTGCATACATGTTGGAATATAgaaaaatgggagtcaactcaA GAACGCCGTGAAAGACAAGCGTTTGAAGGGCTGATCTGACCAAAGCAAGA TCAACATTTGCAAGGGTTGCGATCTTCTGCACATGATTGAAACCATCGAT GTAAGGGAGAACTCTTTTAGCAGTTAGATTCCAATGTTGTGAATCGACAG CAGATTTACTCCAGTTGAATATAGGAACGTGATGATCAAGAACAAGAGGA GGCTCGATAGGCTGTGTGTTCACTTTGAGGTAAATCGTGTTGCAATGATT GACAGGGATAGTACATTCACCGGTCGACCTGAAAGT

Coding sequence (CDS) from alignment at scaffold_98:237005..238740

>TCONS_00073845 ID=TCONS_00073845|Name=TCONS_00073845|organism=Clytia hemisphaerica|type=CDS|length=759bp|location=Sequence derived from alignment at scaffold_98:237005..238740 (Clytia hemisphaerica)
TCATTTCCAAATATGGACAACCTGCTGTTCATTCTCCGTGATGCCGTTCA
ACTCATCATGTGTGATGGGAGTTCCGTTCATTGCAGACATGCAACAAATC
TCATCATAATCATAATAGCCAGTCATCCAACGCGATTTCTCTCTGATCAC
TAACGAGAGGGAATCCGGTGAAGTCAATACTGggaatttacataatttat
ggATAATCTTTTTCACAATGCCAAACAATATCAATTTCTTTTCATCAATA
CCAAGTTCTTGTAGATCATGTCTCCCGCACAAAGCACTCACTGAAATGCC
GGGACCGAGAGCGCAGTACAACATAAAGACATCACGGAATTCAGGCAGAT
TCGTTTTATCTCTAGCAACAAAAGAGACGCATTCTTTCTGAAAAGCTTCA
TCGCGATACAAGCTAGAAATTTCTGGCTTCACTGCATACATGTTGGAATA
TAgaaaaatgggagtcaactcaAGAACGCCGTGAAAGACAAGCGTTTGAA
GGGCTGATCTGACCAAAGCAAGATCAACATTTGCAAGGGTTGCGATCTTC
TGCACATGATTGAAACCATCGATGTAAGGGAGAACTCTTTTAGCAGTTAG
ATTCCAATGTTGTGAATCGACAGCAGATTTACTCCAGTTGAATATAGGAA
CGTGATGATCAAGAACAAGAGGAGGCTCGATAGGCTGTGTGTTCACTTTG
AGGTAAATCGTGTTGCAATGATTGACAGGGATAGTACATTCACCGGTCGA
CCTGAAAGT
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_045863XLOC_045863Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073845-exon-scaffold_98-1491911889:237005..238740TCONS_00073845-exon-scaffold_98-1491911889:237005..238740Clytia hemisphaericaexon
TCONS_00073845-exon-scaffold_98-1510915933:237005..238740TCONS_00073845-exon-scaffold_98-1510915933:237005..238740Clytia hemisphaericaexon
TCONS_00073845-exon-scaffold_98-1575043694:237005..238740TCONS_00073845-exon-scaffold_98-1575043694:237005..238740Clytia hemisphaericaexon
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073845-proteinTCONS_00073845-proteinClytia hemisphaericapolypeptide
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_98supercontigscaffold_98:237005..238740 .
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
33.5249 29.6223 72.8328 81.3049 46.1917 40.0668 27.1592 27.86 18.0018 15.1698 10.0552 11.549 7.11884 7.41957 10.0679 9.96401 17.4257 13.4993 3.48218 5.90855 11.5744 11.313 28.9155 24.3944 12.0213 13.6812 7.42336 5.53323 14.6245 17.2014
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR009348NPR2
Blast
BLAST of TCONS_00073845 vs. Swiss-Prot (Human)
Match: NPRL2 (GATOR complex protein NPRL2 OS=Homo sapiens GN=NPRL2 PE=1 SV=2)

HSP 1 Score: 209.149 bits (531), Expect = 6.773e-61
Identity = 101/251 (40.24%), Postives = 155/251 (61.75%), Query Frame = 1
Query:    4 FRSTGECTIPVNHCNTIYLKVNTQPIEPPLVLDHHVPIFNWSKSAVDSQHWNLTAKRVLPYIDGFNHVQKIATLANVDLALVRSALQTLVFHGVLELTPIFLYSNMYAVKPEISSLYRDEAFQKECVSFVARDKTNLPEFRDVFMLYCALGPGISVSALCGRHDLQELGIDEKKLILFGIVKKIIHKLCKFPVLTSPDSLSLVIREKSRWMTGYYDYDEICCMSAMNGTPITHDELNGITENEQQVVHIWK 756
              ++G CT+P++  NTI+LKV  Q  +PP+  ++ VP+F   K    +  W+LT +++LPYIDGF H+QKI+  A+V+L LVR A+Q L+++GV+ L  I  YSN+Y   P++  L  D++ Q+ C+S+V +        RDVF LYC+L PG +V  L GRH  Q   +DE+KLI FG++K +I +L K+PV  + +  S      +R  TG + YDEICC + M     ++ EL+   EN+  ++  WK
Sbjct:  139 LNASGRCTLPIDESNTIHLKVIEQRPDPPVAQEYDVPVFTKDKEDFFNSQWDLTTQQILPYIDGFRHIQKISAEADVELNLVRIAIQNLLYYGVVTLVSILQYSNVYCPTPKVQDLVDDKSLQEACLSYVTKQGHKRASLRDVFQLYCSLSPGTTVRDLIGRHPQQLQHVDERKLIQFGLMKNLIRRLQKYPVRVTREEQS----HPARLYTGCHSYDEICCKTGM-----SYHELDERLENDPNIIICWK 380          
The following BLAST results are available for this feature:
BLAST of TCONS_00073845 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
NPRL26.773e-6140.24GATOR complex protein NPRL2 OS=Homo sapiens GN=NPR... [more]
back to top