Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00073821 (transcript) - C. hemisphaerica

Overview
NameTCONS_00073821
Unique NameTCONS_00073821
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length13300

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00073821 ID=TCONS_00073821|Name=TCONS_00073821|organism=Clytia hemisphaerica|type=transcript|length=13300bp
TAGCAAATTgacaagttgataaagcaatagatagacgaatgaataaagta
gcgaagtggcaagtttataaagcaatagataaacaaatgtgTGTAGAAAA
ATAGgcattttcttataattttttaacttcgcatttttgagttgggaaat
ctttttgggtcgctaaatctaaaattcacttcgcattttgcgaagtgcga
agctataattcgaaccctgataTTGAttctctttttagaaaaaaacctaA
AACTATTTGTATTTTGTCATTTGGCATGAATGGCAATTTCAAAGATAAAT
ATGAAATATAAGAAATTGCATTGTTTACTATAAACAATGAGTCAAAACTA
CATGAATTACTTCAACTCGGGCGCTTCCACTGGCATGTCTGGTGTGTCTG
GTAATAATGCCAATAATAACACAAATGCTAGCAGTGGAATGGGCGGTGAT
TTTGGTGGGAACAACCAAGCAAATTTTCTTGGTGGCAACATGTCTCTGTC
AGGAGGAAGCTTCATGGATATGATTAATTCTGCCCCACCGCCCATGATGA
ACACACCAGCACAACAACCACAACAAGCTCAACCCCAACAGCAACAAATG
CCTCGTTATAATCATCCCACCGCGTACAATAACATGTATGGCCAATCAAA
CTTTGGTGGGGGAGGAGGAATGGAAAACTCAGCCATGAGACTTCAACAGT
TTGCTAATCGACAGATGACTCCACGACACGGCTTTGATATGGGTAATCAA
ATGAACCAAGAACAAATGAATCAGTATTATATGCAAATGAGAAAAATGAG
AATGATGCAAGAATATGGATCACAAGCAAGGTTCAACAATCCTAACATGC
AGCAGCATAGTTGGCCTCGAAATATGATGTCTAATATGCCTCCACATCTT
CAACAAATGTCTTCAGGACAAAGTAGAATGATGCAAAATCCTAACTTTCC
TAGTGAGATGAACAATCCTCAAACAAGAATGCAAAACCTATCCAACCAAC
AATATCAACAAGCTGGTGCCTTTCGTAAGATGCCTGTCTTGGATGAAGCT
CCTCCTTCTCTAAGAGGTCCTTCACCTTTCTCTCCACAACAAGCTCAACA
GCAACAGCCTCAACAACAGCCTTCCCAAGCCAATGCCAGTTTTAATCCAC
AATTCAAAGCTCAAAATCTCAATCAACAGCAGCAACAACAACCAGGCAAT
ACTATGAATCAACTGAATGCAAATGAAATGAGCAATCCTTTATcaacaaa
tgaaaatttgaatgtaCAAAAGATGATGCAGCAACAACCTGGACAACTTC
GATCTCCTCTCCCTCAACAAAATACACAGCAAAAACCCCAGCAACAACAT
CCCTCAACCCAACCTCAAATCCAACAACCGCTCACACCTCAAATTCAGCA
ACCAGTAACCCCTCTTCAACAGCCTGCAACTCCAATTCAGCAACCACCAA
CACCTCAACTACAACAACCACCAACTCCACAACCACAAACTCCACAACCA
CTTACCCCACAACCACTAACTCCCCAACCGCAACAGCAGGCACAACCTCA
ACAAACACAGATACCAATATCTCAACAACAAGGAGCGAATCCAATTTCTA
CATTTCTGAACAATTTTAACACTGATCCAAACTCATCTCTCAATGTCCCG
CAATCACCTAAACTAACACATTTTGGTGCTCCATCGTCAGTTAGTTCAGC
TAGTTCATTTGATCAGCCACCAGAGGCAGCTGCAACCTCCCCTTCTTCAA
ATTTAACACAAGTGACACAGACCCTAGCATATGCTTCACCTCCTTCTATC
TCATCTCAAAATGCACAACCCTCTCCAACAGTAAAGCCCATCCCCTCGCC
AATTGTATCGTCTGCTCAAAATATACCACCATTGCAAACTCAACCTATGG
GTAACCCATCCTCCAATGCAGCAATCTACTTCAAGAGCTTGGCTCAAATA
CAACAGCAAATTAACATTCTAAAACAGAGTCCTCAAACTCCTGAGGTAGG
ACACCAAATACAAATGCTTAACCATCGATATGCAATGATATTTAAACAAT
ATGAAGCTTCTAAACAACAAATGCCACCATTTCTAGAACAAATGCCAAAC
AGACCAAACCGAAATGCACCTCCAATGGTTAATCAACCTCAAAACCTTTC
TTCACCAAGATTTCGTCAACAACATCCTCAGCAATTGCAGCAAATGCGAC
AACAAGGTCCGCTTTCCCCTCGACTGCCACAAAATCAAAGGTTACAATCT
CCCCTGCCACAACTCTCACAAACTCAAATGGCCctacgacaacaacaaca
acagttcATGCAACAAAGACAGCAGCAATTCATGCAGCAGTCACAACAGC
AAACTTTTAGCTCACCACTTTCTGTTCAACAGACTCGAATGCAAGGAGCC
TTGCAGCAACAACCTCAACCACAGCAGCAACCTCCACCACATCAGCAACC
TCCTCAATCTAATCAGCTTCAACAAATGAGATCTCCTCAACCAAACTTCA
ATCAAACTCCTATGCAAAACCAGCAGATCCCTCCAAACTCACAACCTCAA
CACACAAGTTCGCAACCTCAAATTCAAACACCACAACAACCTAAACCGCA
AGACCAAGCAAAACCAAGTGAAATTTCAAATGCTGGACTATTAGAGGACT
CACTTGATGGAATAAACATTCCtgaatttgaaagttttgagaaagCTTTA
ACAGAGGACAGTAAAACTGATAGTCTTTTTTCTTCAGCATTCCTAGCAGG
CACTGATTTGTTTCCCTCAACCTCTCTTTTTGATGGAGATCCACTTGAGT
CGTTTACAAATAAACAAGATGATTTAAAGAAGGTAAATGAGAACACTATC
ACTCCAGTTAAACAAGttgaaaatgattcaaaatcTTATCAGGAGTTGTC
ATCCAGCACTACAGTTTTATCAAGTGGTAATCAAGGACAGCAACCTGCAC
CAAACCAAAATATGCAAAGTATGTTTGGCAATAACTCCTTCAATCTTCCT
ATAACAAATCAATTGAACAATAAACCTGTACAGCAGCAAGCTCCAGCAAA
ACAAGAGAACTTTTTACCATTTCCATTCaaccaaaatcaatttcatgCGG
GACCACAAATTCCTCCCAACATTATGATGTCAATGACAAATTTCATGTCT
CAGACCATTTCCTCAATGCCATCTTCCTCCATGAACAATATCAATCAAAT
GCCTGGCAAACCATTATCTCTTCCTGGCATGGCACCACCTGCGGTTGATA
ACACAAAACAAGAAACAATGCCAAAAACCAAAGGGAAAGGCAAAGGCTCC
AAAGCAAAAGCTGGCGGtacaaagaagaagaaagatcCAACTGCACCAAA
AGGCAAAGCAGGAAGACCACCAGGAAGTCTCAACAAGAAGAAGAGAGaag
aaaagcaaaagaaaattgTAGAAATGGagtttgatgattttgatgcacTT
CCTCCAGATGAGCTGCTTGGAAAGGAGTTTGATGACCCTAACATGAGGCG
GTCTCTGAGGGAACGTCAGAAAACAACAAATTACAAGGACGATTTTGATT
ACAACATTTCTGATGATGAAGGAAAAAAGAAAGCAGAGCAAGTAGAACAG
GAAAAAGAACCGAAAGAGCAGCCAGAAGTAAAAGAAGATGAATCCTTAGC
ACCTCCCGTCGCTTCAAATCCTGTTGAGCCGGTCATTGATGGTGGAGTAA
ATCAACTTGTGGCTTATCAACCTAATCTTGAAGTTGAAGGGGAAATTGCT
ATCATCGAAAAGATTCTTGCCATGCGAACAGTTCAACAAGAACCTGGTGA
GGAGAAAACCGGAAAAACTGAAAAGACAGAAGATCCAGAAAACGCTAACA
AAACAGAGGAGAAGAGCGAAGATATATCagaagaaaaagttgaagagAGT
GAGACAAAGTCAAAAGAGCAAGAAGAAACAATGGTTGAAGAGTACTATGT
TAAATACAAAGGATACTCATATCTTCACTGTGAATGGGGAACTCTTGAAT
ATCTTGCAAAGAAAGACAAACGTGTTCCTGCTAAGATCAAAAGATATAAA
CAGAAAAGGGATTCTTCTTATGCCTACTTGAATGAGCTTGATGACGAACC
ATTTAATCCGGATTATGTTGAAATAGATCGTGTTTTGGATTATACAACAA
CTGTCGACCCAGTTACCAATGATACAATCGATCACTATTTAGTCAAATGG
AGAGGTTTGCCGTATGAGGATAGCACATGGGAGCTGAAGATGAATATTGA
TGAATCAGTAATCCAAAACTTTCATGAAATGAAGAAACCACCACCTGTTG
AACAGAGAAGGTTTAAACCAAGACCTCAAGAAGGGGATTGGGTGAAAGAG
CTTCAATCACCAATGTACAAAAATGGAAATCGTTTACATGATTATCAGCT
TGAAGGAATGAATTGGTTAACATTTTGCTGGTACAAAAGAATCAATTGTA
TCCTTGCTGATGAGATGGGTTTGGGGAAAACAATTCAGAGTATATCACTT
TTATGTGCCATGAAGaaatatGGTATTCGCGGACCATTTTTGGTTATTGC
ACCTTTGTCAACGATTGGTAATTGGCAACGTGAATTTGAAACCTGGACAG
ACATCAATGCAATCGTTTACCATGGTAGTGCAGTGAGCAGAAATAATATT
CAACAATATGAAATGTACTATAAAGATGAAAAGgGAAACAGTATAAATGA
TGTTTACAAATTTGAAGCCATTATTACAacttatgaaattgttttaaGTG
CAAATCAATTTCTGTGTACCATTCCATTCCGCTGTCTTATTATTGACGAA
GCTCATCGActgaaaaaccaaaaatgtAAGCTGATGGAGGGATTAAATAA
CTTGAAAATGGAACATCGAGTTCTGTTAACTGGAACTCCACTTCAAAATA
ATGTTGAAGAGCTGTTCAGTCTTCTAAATTTTTTGGAGCCAACACGATTC
CCTTCTCAAGGGGCGTTCATGTTTGAATTTGGTAATCTTAAAACTGAAGG
CCAAGTTGAAAAACTGAAACAGATTTTGAAGCCAATGATGTTACGTCGAG
TGAAGGCTGATGTACAAACCAATATTGCATCCAAAGAAGAAACAATTGTT
GAAGTTGAACTTACCAcaattcaaaagaaattctatagAGCAATTCTTGA
ACGAAATTTCAGTTTCTTAGCAAAAGGTTCAGGTTATTCAAATTTACCAA
ACTTAATGAATACCATGATGGAACTTCGTAAATGCTGCAACCATCCTTTT
TTAATCAAAGGAGCTCGTGAGAAGATCTCCTCTGACTACTCTGACCCAGA
ACAACCTGATAAACAATTAACTCATTTGAGTGGTTTGATTGAATCTTCCG
GTAAAATGGTTCTCATTGATAAACTCTTGCCCAAGCTGAAAAGTGGTGGA
CATAAAATACTCGTATTTTCACAGATGATCAAAGTTTTAGATTTGATACA
AGAGTACCTTATGGAGAAACAATACCAATTTGAACGCATTGACGGTGGTG
TACAAGGGAACATGAGACAAGCTGCCATTGATCGTTTTTGTAGACCTGAC
TCTGATCGCTTTGTTTTCCTATTATGTACACGTGCCGGTGGTCTAGGTAT
TAACCTGACAGCTGCTGATACTGTTATAATTTTTGATAGTGATTGGAACC
CTCAGAACGATTTACAAGCTCAAGCCAGGTGTCATAGAATCGGACAAGAA
AAACCTGTGAAAGTCTATCGGTTAATATGTAGAAATACATATGAACGAGA
AATGTTTGATAGAGCTAGTTTAAAACTTGGACTTGATAAAGCTGTCTTGG
GAAACATGAATCAGAAGGAAGCGTCTGGTCAAAAAGCCATGAGTAAGAAA
GAGGTGGAGGATTTGCTGAAGAAAGGTGCTTATGGAGCGGTCATGGAAAA
TGACGAGGATGCTAGTAACTTCTGCGAAGAAGATATTGATCAAATTTTAC
AAAGGAGAACACAAGTTATCCAAATTGAAGGCGAGGGAAAAGGTTCCACT
TTCTCAAAGGCAAGTTTTGTGTCTGATAAAGCAGGTCTTGATGTTGATAT
TGATGATccagatttttggaaaaagtggGCTCAAAAAGCTTCCATCAAAC
TCGAAGATCTTGAGCAGGACAAGCAGTTAATAATGGCGGAGCCCCGAAAA
CGTAAACAAACCAAAAGGTTTGGCAACATTGACGGAGATGCGTTGGAGAT
GTCCGACCTTGATTCTGATGATGAAGTATACGAACCAAATAAAAGCAAAT
CTAAATCCTCACAATACATTGAAAGAACCGCATGGACCAGAGTCGAATGc
ttcaaagttgaaaaactGCTACTCATTTATGGATGGGATCGTTGGCAAGA
CATTACATCACAAGTCCAATTCAAGCAAGAAGTCCGAAACAATGACGTCG
AAGGCATCTCAAGAACTATCCTTGCTTACTGCTTCAGATTCTATAAAACC
GATGAGAAGTCTAAAGACTTTTTCACCAACCTCATTGATGAATCCGTCAA
AAATGCTCccccaaaaaacgaaaagtTTGATATCACAGACCAGATCTTAG
GCTCCGCTCCACCACCCAAGAATGGGCGTGGTCGGAAGAGAAACGCTACC
ACAAACCCAGGTAGGAACGCTTTGAGACGACTGACACATCAATACAGTAA
ACCAGCCCTCATTGAATGCGGTTTAGATTGGTTGACAGTGGACCCGGACA
CGCTGATCATTGATAGCAGTTACCGGAAACACTTGCAACAACATTGCCAT
AAGATCATGTCACGGATACGATTGATACATTCTCTCAAACACGACATCAT
CAAGGAAGCCTCAGTGGATATCTTTGAAGGAAAACCACATGAAGAGATTG
AATTCACGGTTCCTCCAGCCGAGGGTGGTGAACTTCCCGCTGTCTGGTGG
GATGAGAAAGCTGACAAGTCCCTTCTCATAGGAACTTATAAACATGgttA
CGAGAAATACCAGCAGATCCGGAACGATCCTTGCTTGTACTTCTATCACA
AAATTGGACCTTATCAGATGGACGAGAAAGCACCGGAAACGCCCGAGAGT
ATCGTTAACCCAGCTTCTGTCGAAAGATGCGAAGATGGGGCAAGTGATAC
AGAATCCGTCACCTCTAAGAAGAAAAGCAAACCGTCTTCCTCTGCGACAA
AAGCAGGGGAGAATGAGAACGACTCTATGAACGAATCAGAAGACGAGAAT
GATCTTTTCTCTTCACACAATGCATCACCGGCTTCCGTTGCTTCCAATAA
AGAGACCCCTCCTTCAACGGTTCCCGATGCAAAACAAGTACAAAGCAACA
ATCCGGACACGAGGTGGCCACAACCTAACGACTTGAACATGAGGTTGAGA
AGGATGTTTACTTCGTTCTTGCGCTTCACTGATAAAGAACAACTCGACAT
TTTGAAAGctgaaaaggaCAAGCAGAAGCAAGTCCGGTTAGCGAACATGG
TGCAGGAACGGCAACGAAAACGTGCGGAGATGCAGCAACGATGGACGAGA
AGGGAAGAGAGCGATTTCTACAAAGTTCTCACTAACTTCGGTGTTATTCA
AAACCCTGAAACGAAAGAATACGANCGATTTCTACAAAGTTCTCAGTAAC
TTCGGTGTTATTCAAAACCCTGAAACGAAAGAATACGACTGGCAGAAGTT
CAGaCAACTTGCAAAATTGGACAAGAAATTGGACGAAACGTTGACACATT
ATTACGAAGATTTCATAGCTATGTGCAGGAGGATATGTGGACGGGCCACC
GAGAACGACGAGAAAAGGCTAAAAGGATGTCAAATTGAAGAGATATCAGA
AGACAAAGCAAGTCGGTGTCTTCAGCGTGTGAAACTATTGAACAAGATTC
GCACTCAGGTCTTACCACACGAAAAGTTGGGAGAACGTTTGGCTCTGTGC
ATCAAGTCATATGATCTCCCTCACTGGTGGAAGTCTGTCAAACACGACAA
AGCTCTCCTCCAGGGTGTTGCCAAacATGGTCTCGGGAGAACGGAATATC
AAGTCCTCCTCGACCCAGACTCCATCTTCAAAGAGATGGTCGACAAGATT
GGAACACTGAAGAAAGAATCAGCAGACGACAACAAACCGACACTTCATGC
TCAAATGAACGGTGAACATCCTGAAAAGAAACCGAAAGACGAAGCACAAC
TCAATAATGACATCAAAACGGAGAACAAAATCCCCATGCATACCAACGAA
TATGCTCAACTTCTTTCTTCCTGGCCCAAGGACAAAGGAATCGTGTCCCA
CCTTGAGAAAGTTTGCACTTGTGTTTTGAAAGGAGAATGGCCTAAAATGC
CCAAGATCGAAATCCAACCGATGGCTGCGAAACTTCCGAGTTACTCTCGA
CCACTTATTAGTACAGTTGGCCACACCACCAGTGCCGAACTGACTGATGA
AAAACATTCACGTGGCAACTGTACACCTAATCgtgatttcaaaatcaaaa
gcaTCGACGGGTTGAAATTGACCGTGAAGACAGACCCTAAAGGAGACATT
TTGAAGAGGAAAAAACGTGGCGATCCGATCGATTTCTTTCCTGATGATGA
TCGAAAAGTTCGCATCGATTCCATCAAGTTCATTAAGAAGCCGCGCGTCG
AGCGAGGAGTAGAGATGGAAGATTCTCGTAATGTTCAGATTCACATTCCG
AGTTCACCGTCCACCACGAAACCGTCTTCGCCTTCATCGAGACTCGACAA
AAAGCCCATCATTCATTTTCCTTCCAACGTCAAAGTTCCCAAAGTCTCTT
CCATCGTTACTACTGGCTCCACCAGGTCGCGGTCATTGACCAACACCGAC
CACAAACCTACCATTGTCAAAGTGCTTAGTGGGAAACCCACACGAACGAG
ACGACATGACTCTGATGCTTACTCCCCTGTCAACAAATCAGCTCCACTTC
CGTCCACCGCGAGCTCAGATCCAACAGTCGGTATACATATTGATAGTCCG
AACTCCAATGTACGTATACAAGGTTCGAAGATTGAAGTGAAAGAGAAATC
GAGTACGAAGCGCGATCTATCTGAAGTGATTCTCAAAGTACCTGATCCTT
CACGCTTCATGAAGTCACCACAAAACTCTGATTCCAGGAAATCTCGATCA
ACGAAAGTCGTGAAAACTTCCAAGCCTCCTCCGTTGACGCCTGACAAACA
TTCACCGACCACTCAATCAAAGGTATGCGAACATAAGAAAGATGCTTCCA
AAGACAAACCAGTTGAAGAAGCCCCTACATTGCGTCGTCGCCCTGAACGG
TCTGCCAAGAAGCGGGCCAAAGATTCAATCTCAGAGATGAGTGAAGCTGA
ACGGCCGCTTGGTAAAGATGATTTGCACGAGCGGTTGATGGCGCCCCTCT
CACCTTCTCCACGCCACAGTTGGCGCGATATGAGGTCACCACCGCCTCAT
GTGTTACACCGCAGAGGGGGAGATATGTACATGGACTACTACCCTGATCG
AAGCCCACCACGTGGTCGCTCTCCAGAACATCTCCGACGCGGACACCACT
CTCCTGGACCCTTCCCCCGTCCTGGAAGTCCAGATCGTCGTTCGCCTCCG
CCCATTCATCACCACCATCGACCGGTGTCTCCTCCCACCAGACACAGACA
CACCCACTCACCACCGCCACCACCAGTAGGCAGACACCCACACAACCACA
GTCCTCACTACCGCGACCACGAAGATCATCACAAACATTTCCACTACAAC
GAACCGCTTTCGCCACGTTTTCGAGGTGGCGCTCCACATGAACCATACTT
CTATCCTGAACGATCGCGCTCTCCTTACTTCTACGATTACCGTCACGAAA
AAGAACGTTTGTACGACGAATTGGAGAGACGATCCCCGCCTATTAAACAC
CGCCGTCTTTCACCTACCAGAGATCTTTACTCGCCTGCGCATAAACATGA
CTATATACACATCCCAACAGATTCGCATTCTCCACGTCATCTTGATCGAC
ACTCTCCACACGAAGGTCGATTCCCATATGGTCGAGTTGATTGGGACAGT
CCGCGGTTCCGTCACGAGGGTCTCCATTCACCTCCGATACGTTCTTCTCC
CGTCGACGCCCCTGTTCAATACCAGCCATTATCACGAAGTATGCCGCCCA
GAGATGAAGCCAAGAAACCGATCATCAAGTCTCCCAGAGTTCACGAAGAG
CACAGATTGAGGCGGTCGCGCTCTCCTGTTTCTTTCCcagataggcaaga
aaaaagaCGTGTGCAAGACGAACCAACTCTCAAACGTAGCGCGGAAACGA
TCCCTGTTGCGAATGAATTATCATCACCCTCCAAAGCCAAGAAATCGAAA
CCAGCAGAAGTTGAACGACCAGTCATCGAAATCTCAACCGAAGCAGTACG
ACAAAACTCTCAGCAGCAACAACAACGCAAACAGCCAGCTCGCAAGAAGG
GATTGGGGTTACTGGAGATGAAAATCCAAGGGCTGAAAGAGAAAATGGAA
CAGTCCGGTGTGTCCGACAAAATCAAAGAGAAAATGAATTCCCAACCAGA
ATCAACGGAAAAGAAGGAACCTTCGAAAGCCATGGAGACATCCCCCGCTC
CCCCCATTACCAAACCAACAAAGAGGCTTTCAGACGTCATCTCTAACTTA
ACACAGGAGAAAGGAATGAAGGAACCGGTTTCTAAGCCACCTGGTAAACG
TTCCAAGTCTCTTGCAGACATCACTAAAGATCTTGCTAAATCTGTCGAGA
AAAGTAGCGTTCTCGATTCGTCACTTGCTGTATCTTTCTCAAAGAACAAG
CCCACCGTAAATTCAGTGTCATTCAACAAACCATCTAAACCTGTGACCAG
TTCCAGCAAGCTCTCTGACGTCATTTCcactttaaaagaaaaatcgaaGG
CTGCCTCTGCTCAATTACCGACATCCAAATTCAAAGGTGTTCCCTTAACT
GTGAAACCATCAAACGATTCCAAACtgctaaatattttaaaaagtggAAA
TGCCGATAAAAGTCCAAGGGCATTGCAAAAGAAAGACTCACCTGAAGAAA
CGCCCACTAGTCCACCGCCTCGGAGAGCGTCAGTTATCTCTTCAGTTATT
TGCTCAACCATCAAATCGCCTGTTGAAAAGAATGCTGAAGGTCATCCACC
AGAACTCCAATCAGTATTAAAGTCTCCGCCGTTGGAAAGAATGAAATCGC
CTTTGGAAAGACCGAACTCGCGTTCAGAGAGGATTCGATCTCCGCCCTCA
GACAGATTGACTTCATCACGTCAAACACGAAGATCATCCACTGCCGACAG
ACCTTTCTCGCCATCTGATAGGCTACTTTCGCCAACTTCAGGAATACTTC
ACTCTCAATACGATCAGCTACCAGAGTCACGTCCAAAAGACCGTTATCCA
CCAAGAGATGCATCTCCATCTGCAAGAGATTTCCTACCTTATGACACTTA
TCGCTCATTTAAAAGCTCGTCATCTGAAAGAATCGTTTCGCCGCGCGACC
ACCCAATCGAGAGAATAGTTTCGCCGCGCGACCACTCAACTGAACGGCTC
TTCTCGCCACGATCATCGAGAAATTCTGAACGAATTACGTCACCTCGCGG
ACCTTCACCGTTAGACTTGACCCCTTCACCACGATCGTCAAGGAAACCTT
CACTCGATGTCCCTGCAAGAGATCCGTCACCTCGATCATCCGGTCGGCAA
TCGTCTTCCATTTCTCCACGGGAACCTGTCATCCACTCACCAGACAACAG
ACCACCTCACTCATTGAGACTTCTCTCACCTTCACAATCAGAGAGACTGA
CCTCACCACCACCCTTGACCAGGGTCACTCCTCCATTGGAGAAACTTTCA
TCTCCAAGATCGAAACACTCATCACCGTTGATTGATCGAAGACCGTCTCC
GTTGGAGAGTGTTATTTCACAAAACATAAGTAGAATGAAATCACCAACCG
ACCGAACGTCTTCCCCTTCTTCGAGAGCTAAATCGCCTATTCCGAGGGAA
GCACCGCCACTCGACCGCATAAAATCCCCAAAGAATCATCCAACTCCACC
TTCGAGAATCGTATCTCCACCCGCGAGAGAGTTTGCTTCTCCTGGAATCA
CTTCACCAGTCCTCCGCATGAAATCACCACGACCAATGNCGCGAGAGAGT
TTGCTTCTCCTGGACATGGAATCACTTCGCCAGTCCTCCGCATGAAATCA
CCACGACCAATGGAAGGCCCCCCTCCTCTTGACCGAGTTGTCTCGCCAAA
CTCCGAAAGACTCGGATCAACACCTTATGAACACGCGAATCTTTCTAAGG
ATCGAATCAAATCACCTGTGGACAGGCTTTCGCTAAGTGAACCACGCTCT
TCACCGATAGCGGACCGTGTAATGTCACCACGAATCAAGTCTGCCAGCGT
CATTTCTTCAACAGGGAGCAAGACTTCGGAACGCCTTCTTTCGCCCACTA
ACAACAGACGAACGCCCAACATCACCTCACCGCCACCCTTCTCGCGCGCT
GAGAACGATATTCAATCAAAGCATTCTCCCAGTAACCGTGGAACACCTGG
AGATGAGAGACTGATGGGTGAACGATTCCAATCGCCGATCAGTAGTCCGG
TATATTCACCGGCCGTTGTGAGCAACCCTTTAACAATCGACTTGGAAAAG
AAGAAGATCTCTTCAGGGCGTGAAAGCGCCACCCTGCAAGTTATAACGCC
TACACGAACACCCACTCCAATTAAGTCGCCTCTCACACAAACATTACAGG
TTGTCACTTCGCCACGTCATGAGAATTCAATGTCGCCCTCTTTTCCCGCC
TCACCGCCCCAATTAGTCGATAAGGCGGTTTTGTCCTCGCAATTGACAAG
GCCTACGGCGATTGTTGCCACGACAACAGCGAATAATGAATCGGTCGATC
ACGTGACTAAAACAGACGGAAAAGCATCATCTTAATTGGTTTTTGGAGAT
GAAAATTTTGgggtttttttgaaaagtggcaTTGTGTCACGCACgatatt
tttatgctattttttctacatttttagtTCTGtatattttgattgatttt
attattagataattttgcttttttctatAGTATCACGTAGTATCATATGC
CTTTTCCTCTGCCGTGCTTTTCCTTGCAATGAACTTGATCATTTCGTCGT
GTTGAATTGCTGATGTCAAGTCCGTATTAAATTACCAAATTATAGGAACT
CTTTCTCTCAGTTTCTCTTTGAGTAATCTACCCTACAtcatttttagcaa
aattattattaaagaaatttttggcataaatgtaatttttttatttttgt
cttttaaatatcatatttaaaaaattgacaatgaaaCATTTATACGATAT

transcript from alignment at scaffold_98:26989..56726-

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00073821 ID=TCONS_00073821|Name=TCONS_00073821|organism=Clytia hemisphaerica|type=transcript|length=29738bp|location=Sequence derived from alignment at scaffold_98:26989..56726- (Clytia hemisphaerica)
TAGCAAATTGACAAGTTGATAAAGCAATAGATAGACGAATGAATAAAGTA GCGAAGTGGCAAGTTTATAAAGCAATAGATAAACAAATGTGTGTAGAAAA ATAGGCATTTTCTTATAATTTTTTAACTTCGCATTTTTGAGTTGGGAAAT CTTTTTGGGTCGCTAAATCTAAAATTCACTTCGCATTTTGCGAAGTGCGA AGCTATAATTCGAACCCTGATATTGATTCTCTTTTTAGAAAAAAACCTAA AACTATTTGTATTTTGTCATTTGGCATGAATGGCAATTTCAAAGATAAAT ATGAAATATAAGAAATTGCATTGTTTACTATAAACAATGAGTCAAAACTA CATGAATTACTTCAACTCGGGCGCTTCCACTGGCATGTCTGGTGTGTCTG GTAATAATGCCAATAATAACACAAATGCTAGCAGTGGAATGGGCGGTGAT TTTGGTGGGAACAACCAAGCAAATTTTCTTGGTGGCAACATGTCTCTGTC AGGAGGAAGCTTCATGGATATGATTAATTCTGCCCCACCGCCCATGATGA ACACACCAGCACAACAACCACAACAAGCTCAACCCCAACAGCAACAAATG CCTCGTTATAATCATCCCACCGCGTACAATAACATGTATGGCCAATCAAA CTTTGGTGGGGGAGGAGGAATGGAAAACTCAGCCATGAGACTTCAACAGT TTGCTAATCGACAGATGACTCCACGACACGGCTTTGATATGGGTAATCAA ATGAACCAAGAACAAATGAATCAGTATTATATGCAAATGAGAAAAATGAG AATGATGCAAGAATATGGATCACAAGCAAGGTTCAACAATCCTAACATGC AGCAGCATAGTTGGCCTCGAAATATGATGTCTAATATGCCTCCACATCTT CAACAAATGTCTTCAGGACAAAGTAGAATGATGCAAAATCCTAACTTTCC TAGTGAGATGAACAATCCTCAAACAAGAATGCAAAACCTATCCAACCAAC AATATCAACAAGCTGGTGCCTTTCGTAAGATGCCTGTCTTGGATGAAGCT CCTCCTTCTCTAAGAGGTCCTTCACCTTTCTCTCCACAACAAGCTCAACA GCAACAGCCTCAACAACAGCCTTCCCAAGCCAATGCCAGTTTTAATCCAC AATTCAAAGCTCAAAATCTCAATCAACAGCAGCAACAACAACCAGGCAAT ACTATGAATCAACTGAATGCAAATGAAATGAGCAATCCTTTATCAACAAA TGAAAATTTGAATGTACAAAAGATGATGCAGCAACAACCTGGACAACTTC GATCTCCTCTCCCTCAACAAAATACACAGCAAAAACCCCAGCAACAACAT CCCTCAACCCAACCTCAAATCCAACAACCGCTCACACCTCAAATTCAGCA ACCAGTAACCCCTCTTCAACAGCCTGCAACTCCAATTCAGCAACCACCAA CACCTCAACTACAACAACCACCAACTCCACAACCACAAACTCCACAACCA CTTACCCCACAACCACTAACTCCCCAACCGCAACAGCAGGCACAACCTCA ACAAACACAGATACCAATATCTCAACAACAAGGAGCGAATCCAATTTCTA CATTTCTGAACAATTTTAACACTGATCCAAACTCATCTCTCAATGTCCCG CAATCACCTAAACTAACACATTTTGGTGCTCCATCGTCAGTTAGTTCAGC TAGTTCATTTGATCAGCCACCAGAGGCAGCTGCAACCTCCCCTTCTTCAA ATTTAACACAAGTGACACAGACCCTAGCATATGCTTCACCTCCTTCTATC TCATCTCAAAATGCACAACCCTCTCCAACAGTAAAGCCCATCCCCTCGCC AATTGTATCGTCTGCTCAAAATATACCACCATTGCAAACTCAACCTATGG GTAACCCATCCTCCAATGCAGCAATCTACTTCAAGAGCTTGGCTCAAATA CAACAGCAAATTAACATTCTAAAACAGAGTCCTCAAACTCCTGAGGTAGG ACACCAAATACAAATGCTTAACCATCGATATGCAATGATATTTAAACAAT ATGAAGCTTCTAAACAACAAATGCCACCATTTCTAGAACAAATGCCAAAC AGACCAAACCGAAATGCACCTCCAATGGTTAATCAACCTCAAAACCTTTC TTCACCAAGATTTCGTCAACAACATCCTCAGCAATTGCAGCAAATGCGAC AACAAGGTCCGCTTTCCCCTCGACTGCCACAAAATCAAAGGTTACAATCT CCCCTGCCACAACTCTCACAAACTCAAATGGCCCTACGACAACAACAACA ACAGTTCATGCAACAAAGACAGCAGCAATTCATGCAGCAGTCACAACAGC AAACTTTTAGCTCACCACTTTCTGTTCAACAGACTCGAATGCAAGGAGCC TTGCAGCAACAACCTCAACCACAGCAGCAACCTCCACCACATCAGCAACC TCCTCAATCTAATCAGCTTCAACAAATGAGATCTCCTCAACCAAACTTCA ATCAAACTCCTATGCAAAACCAGCAGATCCCTCCAAACTCACAACCTCAA CACACAAGTTCGCAACCTCAAATTCAAACACCACAACAACCTAAACCGCA AGACCAAGCAAAACCAAGTGAAATTTCAAATGCTGGACTATTAGAGGACT CACTTGATGGAATAAACATTCCTGAATTTGAAAGTTTTGAGAAAGCTTTA ACAGAGGACAGTAAAACTGATAGTCTTTTTTCTTCAGCATTCCTAGCAGG CACTGATTTGTTTCCCTCAACCTCTCTTTTTGATGGAGATCCACTTGAGT CGTTTACAAATAAACAAGATGATTTAAAGAAGGTAAATGAGAACACTATC ACTCCAGTTAAACAAGTTGAAAATGATTCAAAATCTTATCAGGAGTTGTC ATCCAGCACTACAGTTTTATCAAGTGGTAATCAAGGACAGCAACCTGCAC CAAACCAAAATATGCAAAGTATGTTTGGCAATAACTCCTTCAATCTTCCT ATAACAAATCAATTGAACAATAAACCTGTACAGCAGCAAGCTCCAGCAAA ACAAGAGAACTTTTTACCATTTCCATTCAACCAAAATCAATTTCATGCGG GACCACAAATTCCTCCCAACATTATGATGTCAATGACAAATTTCATGTCT CAGACCATTTCCTCAATGCCATCTTCCTCCATGAACAATATCAATCAAAT GCCTGGCAAACCATTATCTCTTCCTGGCATGGCACCACCTGCGGTTGATA ACACAAAACAAGAAACAATGCCAAAAACCAAAGGGAAAGGCAAAGGCTCC AAAGCAAAAGCTGGCGGTACAAAGAAGAAGAAAGATCCAACTGCACCAAA AGGCAAAGCAGGAAGGTATGAAAATTTCCATTCATTATTGTACCATACTT TAAACTTCTGCAATAATCCATCAATTGTATGATTATAATTTAGTTCATTG TCTTTTGACTTTATTATCATTATTCTTATTAAACAGAAATTAAAAGTTGT AGATGCACAGTGAGCCTCTAAACTTTGCAAAGCATTACATCCATGTTAAA AAGTTGAGCAAGTTTTNTTATTAAACAGAAATTAAAAGTTGTAGATGCAC AGTGAGCCTCTAAACTTTGCAAAGCATTACATCCATGTTAAAAAGTTGAG CAAGTTTTTAATACCTTAAACATAAAAGTAATATTTTCACCTCAGACCAC CAGGAAGTCTCAACAAGAAGAAGAGAGAAGAAAAGCAAAAGAAAATTGTA GAAATGGAGTTTGATGATTTTGATGCACTTCCTCCAGATGAGCTGCTTGG AAAGGAGTTTGATGACCCTAACATGGTATGTTATGATTGATTGTTAACTC AATAGTCATATTATGTATAAAAAGGAGATGAACTTTATAAAAATATGCGT TACCCATAATTTTCATTTTCATTTTTTTGTCAAAATCAATTTTAATAATA ATTTCTTTTTTGCAGAGGCGGTCTCTGAGGGAACGTCAGAAAACAACAAA TTACAAGGACGATTTTGATTACAACATTTCTGATGATGAAGGAAAAAAGA AAGCAGAGCAAGTAGAACAGGAAAAAGAACCGAAAGAGCAGCCAGAAGTA AAAGAAGATGAATCCTTAGCACCTCCCGTCGCTTCAAATCCTGTTGAGCC GGTCATTGATGGTGGAGTAAATCAACTTGTGGCTTATCAACCTAATCTTG AAGTTGAAGGGGAAATTGCTATCATCGAAAAGATTCTTGCCATGCGAACA GTTCAACAAGAACCTGGTGAGGAGAAAACCGGAAAAACTGAAAAGACAGA AGATCCAGAAAACGCTAACAAAACAGAGGAGAAGAGCGAAGATATATCAG AAGAAAAAGTTGAAGAGAGTGAGGTAATATTACTCTTCTATAACTTTCTC TGTAAGTGAAAGATATTTTCTTTTCTTATTAAAAGAAAACAAATTATCAA ATTTATTGTAAGTTTTTTTTGAGAGACAAATAGTGTCACACTCTAAATTT GAAAAAGAGGGGATTTAAGAGGGTTCTATAATCACATCTGACATTTGAGT TGGTCAATCAAAAGCCAAAAATTTACACTGTTCCTCTTTCAGANAAGTAG AACAGGAAAAAGAACCGAAAGAGCAGCCAGAAGTAAAAGAAGATGAATCC TTAGCACCTCCCGTTGCTTCAAATCCTGTTGAGCCGGTCATTGATGGTGG AGTAAATCAACTTGTGGCTTATCAACCTAATCTTGAAGTTGAAGGGGAAA TTGCTATCATCGAAAAGATTCTTGCCATGCGAACAGTTCAACAAGAACCT GGTGAGGAGAAAACCGGAAAAACTGAAAAGACAGAAGATCCAGAAAACGC TAACAAAACAGAGGAGAAGAGCGAAGATATATCAGAAGAAAAAGTTGAAG AGAGTGAGGTAATATTACTCTTCTATATCTATAACTTTCTCCGTAAGTGA AAGATATTTTCTTTTCTTATTAAAAGAAAACAAATTATCAAATTTATTGT AAGTTTTTTTTTGAGAGACAAATAGTGTCACACTCTAAATTTGAAAAAGA GGGGATTTAAGAGGGTTCTATAATCACATCTGACATTTGAGTTGGTCAAT CAAAAGCCAATAATTTACACTGTTCCTCTTTCAGACAAAGTCAAAAGAGC AAGAAGAAACAATGGTTGAAGAGTACTATGTTAAATACAAAGGATAGTAA GTAACCTTTTCTGTACAATTTACTTTCACTACATGTCCCTTTCACAAAAA TCAAAATCGAAATTCTAAAGATATTCAGATAAGATACAAAAGGCTTTAAT GGTAGCACTAAAAGCATATGACAGTTAGTTATTTAGTCTAGTAGCTTGCT GCAAACCAAAGGTTATAATAATCACCAACGAAAATTCCTTTTTCTAGCTC ATATCTTCACTGTGAATGGGGAACTCTTGAATATCTTGCAAAGAAAGACA AACGTGTTCCTGCTAAGATCAAAAGATATAAACAGAAAAGGGATTCTTCT TATGCCTACTTGAATGAGGTGAGTAAAAGGCTAATAGCTTTGTGCTGTAT AATAATCTAAAGATTGTCTGGGACATCCAAGACTGTCTGNGCTAATAGCT TTGTGCTGTATGATAATCTAAAGATTGTCTGGGACATCCAAGACTGTCTG GGACAGTCAGACAAGTATTTTTGGATTCAGGGTCTGCTCTACCTTTGTGC CTTGAATTTTGGTACTTTTTAAAGTACCTCATTGTAGTTTGCAATGCTTT GACTTTAAACTGGCTCTAACTCTTTTGTAATTAATTCATTGATTCATAGC TTGATGACGAACCATTTAATCCGGATTATGTTGAAATAGATCGTGTTTTG GATTATACAACAACTGTCGACCCAGTTACCAATGATGTAAGAAATGTTTT TTCTCATTCACTTAAAAAAAATTGAATTTTGTGCAGATTACTTTCATCTT GGAGTTTTCATCCAATGCTCATCATTATAATCATATGAAAATTTAAAATT CTGAAATTTTTGTTTTCCAATTTCAGACAATCGATCACTATTTAGTCAAA TGGAGAGGTTTGCCGTATGAGGATAGCACATGGGAGCTGAAGGTATTTTG AAATTGTCTTTCTTTACATCTTTTCAACGAGCTTTATATACTTCATTGAA GTGAAGCCATATAAGTTGGTTTTTGCTTATTCGGACTTTTTGATGAAATA GGTTTCTTTTTCTCTAATTTTCTGTTGTTTTCAATCAGGGGGGGTTTTTC AGTATAGCACCACATCACTAAATGCCATGATGTATGGAATTTCAATACTG ACTACCCCTGTTTCAAGGACATTATTTGACATAATATCTCTTACCATTTG CTTACACAGCATTTCTGCATGAAAAAAGAACTTTCTCTTTTTCTCATGCC ACACAGCACAAATTTAAAGAAATTTCTTTCTTAAAAATAATCTGCTTTGT CAGCGTACAAGGCACACCTCTATTTTATTTCATATAAATAAAAATCTTTA TTAAACCTCAGTCAAAACAATTATAAAATCTAGCTTTATGTGATGGAGAG AATTTAAGTTGGCTCCAGTTGGCTCCTCATATAACTTGTTTAATTCTTTT AATAAGATTGCATGCTTCTATTTTAGATGAATATTGATGAATCAGTAATC CAAAACTTTCATGAAATGAAGAAACCACCACCTGTTGAACAGAGAAGGGT AAGTGATATTTTGTTGTAAGATTTGCTATAGGTATGTGGAATAGGGAAAT AGCTGATATATATTGACATGATGATAATGATAATTATGATATATTTTATG AACATGGGATGAAGAAGGGGGACCATAGNGTGGAATAGGAAAATAGTTGA TATATATTGACATGATGATAATGATAATTATGATAAATTTTATGAACATG GGATGAAGAAGGGGGACCATAGCTCTAAGAGATTTTGGCTGGGAGGTTCA CTACTCTTGTCTAAAATGTATATACCTGTGTACATTTACGCAACTTTTAA AACCAAACCGAGAAGAGGGGAAAACGAATTAAAGTGGAAATTTTAGGGAG GCATCATATTCCAATTTTTTAATTACAAGATCTAATCTTCTTTATTTCTT TCATTGCAGTTTAAACCAAGACCTCAAGAAGGGGATTGGGTGAAAGAGCT TCAATCACCAATGTACAAAAATGGAAATCGTTTACATGATTATCAGCTTG AAGGAATGAATTGGTTAACATTTTGCTGGTACAAAAGGTATAGTTAAGGC TTAAAAAGAAGTAGTTTTGTTTCCTGAAATGTGTGACGAAAAGAAATCTC ACCCTGGTGGTCGGGAATCTTTTTTTGCAATTTTCTTTGATATTCTCATT GAAGTAATACATCTTCACCCAAAAAAACAGTAAATTACTTTCATACACAA GAACATGGTATAATAATAATACAAAGAAGAGAAATTTTGAGACAGATTTT TTTTTAAACACAAGGTGATCTTTAATTTTTTCCCACCTGTGAGGAGCACA CAACATTGCAAACGCCACAATTGTAAGAATATCCCTGAAAATTGAAATAG TTTAGCTTTAAGAGATATCTTTCATCACAACAAAAAGTAAAAAGTACACT ACTCAGAGCTTCGTGCTACTGCACTTGTCAAAAAAAATAATTAAAATAAA GATTTCAAGGTTGCCGGACAAAATAACCGACCGATCAGGGTTGCTTTGGC TTGAACAGCTTTTTTGGGTCGGACAATGAGCCATTTGGATCGAACAATGA CTGAACCTTATTTCAAGCCCTGATAATAAATCTGTTCTAATGTGGAACTG TTTTCTCTTATTATATCTCTGTATTGGCTTATTTCTTGTAGAATCAATTG TATCCTTGCTGATGAGATGGGTTTGGGGAAAACAATTCAGAGTATATCAC TTTTATGTGCCATGAAGGTGAGAATAATAGTTTTCCTGAGATTTTTTCAA CATTTTAAATTGAGTATTCCCCAGTTTGTTGCGATAGATATAATTCCTTA AGATCTACGACTGCTTTCGGGGGAAGAATGAAAAATTTCAAGATTTTTGT CACATGTAGTACATTTCTTATTTAGTAGTGGGCTAGTTCAAAACACTGCT CATAGGTCATAGATGACAGACCAAATTATTATAACAAGTTTGTAGCAAAA AAACAATTCAAAACATTCCTCTGAAAGTGCCATTTGTAATTATATGAATA TTATATGCAAAGTGGCAATCACATATTATTGACAAAATGACATCTGACTA TAGAATATTTATATTATAACAAAATAAGAGGTGTATATAACAATAAATGC CGAAATCTTTTGAGAATGCTGACAGTATCAGCAGACATTGTTTGAAAATT TTGAGTGCTTCAAGAAAGCCGATTTAGAGATATGGCATGGATAGATTTTG ACCCTTAGAATTGTTATACATGGATGAAATACCCTCAGAATGATACTTTT GAGAACAGTGACCGTTTTAGAACATTTTCCTTGTTTACAGTAATCAAAGT TGACCTGTCAAAACTGACCCGTGACCTTTGTTTGCTAGTTCAAAACATTT GGTGATGCTCTCTGTGGGAGAATCCATTATGTTAAATGAAACAGACTTTT ACTCGCCAGGAAAAGGGTTTTTACATTTATTATTTCATTTAACCCAGTTG CCATGGTTGCAACAATGCTTGACAACTTATGCAACTTTGTTATCAAGCCT ACTTCAGTTTTTCATAAACATATAATTTTAGAAATATGGTATTCGCGGAC CATTTTTGGTTATTGCACCTTTGTCAACGATTGGTAATTGGCAACGTGAA TTTGAAACCTGGACAGACATCAATGCAATCGTTTACCATGGTAGTGCAGT GAGCAGAAATAATATTCAACAATATGAAATGTACTATAAAGATGAAAAGG TACCAACTATTGTTACAGTGATTGTACTCAGAACAAACTTTGGTCCTAGA AAGGTTTTAACTGTCACCTGGGTTGGGGGGCACTTTGCCCCCAATAATTT TTTCAAAGATGGTTTCTTAAAGAAACAAAGGGCCTGAGCTGGGGAAATTC GAAAAACTAAGGCCTCTATATTGCTGGAAGATGCACCGAAAATAACTTGA ATTCGAGGGAAAAAAATTATACTTTTGTTTTTGATAATTGTGTTTTTTCT GTTTTTAGGGAAACAGTATAAATGATGTCTACAAATTTGAAGCCATTATT ACAACTTATGAAATCGTTTTAAGTAAGTTATGGCTTTTCTTTATAAAACT CACTTTCAGTTAATAATACTTGAATTATTTTGCAGACAATTCAATGCTGA AAAATTTGATCTTGCACATATCTTTACATGATAGAATTTGAAAATCAAAA TCCATCCATTCTTTAATTGTTAGGTGCAAATCAATTTCTGTGTACCATTC CATTCCGCTGTCTTATTATTGACGAAGCTCATCGACTGAAAAACCAAAAA TGTAAGCTGATGGAGGGATTAAATAACTTGAAAATGGAACATCGAGTTCT GTTAACTGGAACTCCACTTCAAAATAATGTTGAAGAGCTGTTCAGTCTTC TAAATTTTTTGGAGCCAACACGATTCCCTTCTCAAGGGGCGTTCATGTTT GAATTTGGTAATCTTAAAACTGAAGGCCAAGTTGAAAAACTGAAACAGGT AATTAATCTCTTTTTTGATTTCTTTCTATTCCAATTTGGTTGCTGAAATG ATGTTTTCACGCGTTAGACTACTGATCTTATTGATGTTTAATTTTTAAAA ACTGATCAGCACCACATGCTGACTGTAGTGCACCTGGCTACGGTCCGCAA GGTTGTTGACCCCAGTTGGGTCATACCAAAGATTCCTAAAATGGTACTAG ATGCCTCTCTGCTTGATGCTCAGCAATTAAGAGAAGGATTAAGGGTTAAA GTAGAGCAATTGAGGGAGAAAGAGTGGCACCCTCACCTACCTTCTGGTAG ATAGCTATTGAAAGAGGAGCATTCGGGTCGCCTCCGACTGAAGTCACAAA CTTACTTACTATCACATGCCTTAGGCTTCTATTGACATAATAGCTTTCCT TGAATATTTTTTGCCTCTGCTATCTTATTGCTGCACTGAAATGATGTTTC AACGCGTTAGACTACTGAATTCTGATGAAGATTTATCTTAACTGATCAGT GCCTGCTTTCCNGAAAGGTTTTAACTGTCACCTGGGTTGGGGGGCACTTT GCCCCCTATAATTTTTTCAAAGATGGTTTCTTAAAGAAACAAAGGGCCTG AGCTGGGGAAATTCGAAAAACTAAGGCCTCTATATTGCTGGAAGATGCAC CGAAAATAACTTGAATTCGAGGGAAAAAAATTATACTTTTGTTTTTGATA ATTGTGTTTTTTCTGTTTTTAGGGAAACAGTATAAATGATGTTTACAAAT TTGAAGCCATTATTACAACTTATGAAATTGTTTTAAGTAAGTTATGGCTT TTCTTTATAAAACTCACTTTCAGTTAATAATACTTGAATTATTTTGCAGA CAATTCAATGCTGAAAAATTTGATCTTGCACATATCTTTACATGATAGAA TTTGAAAATCAAAATCCATCCATTCTTTAATTGTTAGGTGCAAATCAATT TCTGTGTACCATTCCATTCCGCTGTCTTATTATTGACGAAGCTCATCGAC TGAAAAACCAAAAATGTAAGCTGATGGAGGGATTAAATAACTTGAAAATG GAACATCGAGTTCTGTTAACTGGAACTCCACTTCAAAATAATGTTGAAGA GCTGTTCAGTCTTCTAAATTTTTTGGAGCCAACACGATTCCCTTCTCAAG GGGCGTTCATGTTTGAATTTGGTAATCTTAAAACTGAAGGCCAAGTTGAA AAACTGAAACAGGTAATTAATCTCTTTTTTGATTTCTTTCTATTCCAATT TGGTTGCTGAAATGATGTTTTCACGCGTTAGACTACTGATCTTATTGATG TTTAATTTTTAAAAACTGATCAGCACCACTGCTTGATGCTCAGCAATTAA AAGAAGGATTAAGGGTTAAAGTAGAGCAATTGAGGGAGAAAGAGTGGCAC TGGTAGATAGCTATTGAAAGAGGAGCATTCGGGTCGCCTCCGACTGAAGT CACAAACTTACTTACTATCACATGCTTTAGGCTTCTATTGACATAATGAC TTTCCTTGAATATTTTTTGCCTCTACTATCTTATTGCTGCACTGAAATGA TGTTTCAACGCGTTAGACTACTGAATTCTGATGAAGATTTATCTTAACTG ATCAGTGCCTGCTTTCCTCGTGAAACTTTAAAATTACAAGAGTGCCCTTA ACCACAATTTTGCTTCAAAACCATTACCCGCCATTACACTGATTTAGTTA TAAAACTATTATTGTATTGGGAAAGATTAAAAAATAAAAGCCACATTCAA TTGACAATTGAAAATCTCTTTCCCCAGATTTTGAAGCCAATGATGTTACG TCGAGTGAAGGCTGATGTACAAACCAATATTGCATCCAAAGAAGAAACAA TTGTTGAAGTTGAACTTACCACAATTCAAAAGAAATTCTATAGAGCAATT CTTGAACGAAATTTCAGTTTCTTAGCAAAAGGTTCAGGTTATTCAAATTT ACCAAACTTAATGAATACCATGATGGAACTTCGTAAATGCTGCAACCATC CTTTTTTAATCAAAGGAGCTCGTGAGAAGATCTCCTCTGACTACTCTGAC CCAGAACAACCTGATAAACAATTAACTCATTTGAGTGGTTTGATTGAATC TTCCGGTAAAATGGTTCTCATTGATAAACTCTTGCCCAAGCTGAAAAGTG GTGGACATAAAATACTCGTATTTTCACAGATGATCAAAGTTTTAGATTTG ATACAAGAGTACCTTATGGAGAAACAATACCAATTTGAACGCATTGACGG TGGTGTACAAGGGAACATGAGACAAGCTGCCATTGATCGTTTTTGTAGAC CTGACTCTGATCGCTTTGTTTTCCTATTATGTACACGTGCCGGTGGTCTA GGTATTAACCTGACAGCTGCTGATACTGTTATAATTTTTGATAGTGATTG GAACCCTCAGAACGATTTACAAGCTCAAGCCAGGTGTCATAGAATCGGAC AAGAAAAACCTGTGAAAGTCTATCGGTTAATATGTAGAAATACATATGAA CGAGAAATGTTTGATAGAGCTAGTTTAAAACTTGGACTTGATAAAGCTGT CTTGGGAAACATGAATCAGAAGGAAGCGTCTGGTCAAAAAGCCATGAGTA AGAAAGAGGTGGAGGATTTGCTGAAGAAAGGTGCTTATGGAGCGGTCATG GAAAATGACGAGGATGCTAGTAACTTCTGCGAAGAAGATATTGATCAAAT TTTACAAAGGAGAACACAAGTTATCCAAATTGAAGGCGAGGGAAAAGGTT CCACTTTCTCAAAGGTATTTGTCTGGTCTTCTTCAAAGTTAACTTGAATT TGCTCAGCATTTAGTTTGTCTTTTATTGTATGCAATTGCAATTTGCTTTT CTTCTTCTTAACTAATAATTCACCGTTGTCCCGTCTCAGACAGATTTCTG TGTTTGCGAAGTTTAAAAAGAGGCCTTACCGGCTAATTTGTGGCGTTGAA TCCATTTCTCGTCTCAGAGGAAAAACTTTGCTTAGAACATTGTATGACCT ACTACCAGTCACAACCGAAGTACCAAAATAAATATTTGAAATAGTTTTTT ATTTTGTGCATTCTTTTACTTTCAGGCAAGTTTTGTGTCTGATAAAGCAG GTCTTGATGTTGATATTGATGATCCAGATTTTTGGAAAAAGTGGGCTCAA AAAGCTTCCATCAAACTCGAAGATCTTGAGCAGGTTTGATATTCTTTCTT CTCTTTCATCTGAACAAGCTTGACCTCTTCTTTTCTAAAGTGTTTACTGG CTTGCACTGATGTGAGTGGACTGTATGGGAATGTTTTTCCTTACCTAGTG AATGTATAGTCTGTTTAAAAACCAAGATAAAATTCAAGTTTTCTATTGTT GTATCACGCAATGAAATCTTTCAGAGAATAAGGACTAAGGGCCCAATCCT TTCTAATCACTTATAATCTTCTACAATAATTCAGGACAAGCAGTTAATAA TGGCGGAGCCCCGAAAACGTAAACAAACCAAAAGGTTTGGCAACATTGAC GGAGATGCGTTGGAGATGTCCGACCTTGATTCTGATGATGAAGTATACGA ACCAAATAAAAGCAAATCTAAATCCTCACAATACATTGAAAGAACCGCAT GGACCAGAGTCGAATGCTTCAAAGTTGAAAAACTGCTACTCATTTATGGG TAAGAGACTCTTTTGTTTTTATAAACAATTCATCTACTCTCCCCCGTAGG GTAGTGATTATCTGACCTTACCAGAAGGGGGCTGGAAATTTTGAAAGCTG CGACAGTAAGCCTTCTTTTTCTAATAAGGATTGTATTTNCTCTTTTTATA AACAATTCATCTACTCTTCCCCGTAGGGTAGTGATTATCTGACCTTACCA GAAGGGGGCTGGAAATTTTGAAAGCTGCGACAGTAAGCCTTCTTTTTCTA ATAAGGATTGTATTTTTGTGGACTTCTTGACTGCTTAAACCTTGCTGATG AGAAGTTTTTTTCGAGGAAGGGGGGACCGGTCTGATTTAAGCACAATAGT CTATCNGATGAGAAGTTTTTTTCGAGGAAGGGGGGACCGGTCTGATTTAA GCACAATAGTCTATCACTACTTTTTTCCAATATTAATTTATTAAGAGAGT TTTGATCAAACAAGGATTTACATTTTACATGGTGTGGTGTTTCAAGATAA ATGAGAAACCCCGGTTTTGAAAAACTTTAATGCTAACTTACTGTTTAGAT GGGATCGTTGGCAAGACATTACATCACAAGTCCAATTCAAGCAAGAAGTC CGAAACAATGACGTCGAAGGCATCTCAAGAACTATCCTTGCTTACTGCTT CAGATTCTATAAAACCGATGAGAAGTCTAAAGACTTTTTCACCAACCTCA TTGATGAATCCGTCAAAAATGCTCCCCCAAAAAACGAAAAGTTTGATATC ACAGACCAGATCTTAGGCTCCGCTCCACCACCCAAGAATGGGCGTGGTCG GAAGAGAAACGCTACCACAAACCCAGGTAGGAACGCTTTGAGACGACTGA CACATCAATACAGTAAACCAGCCCTCATTGAATGCGGTTTAGATTGGTTG ACAGTGGACCCGGACACGCTGATCATTGATAGCAGTTACCGGAAACACTT GCAACAACATTGCCATAAGATCATGTCACGGATACGATTGATACATTCTC TCAAACACGACATCATCAAGGAAGCCTCAGTGGATATCTTTGAAGGAAAA CCACATGAAGAGATTGAATTCACGGTTCCTCCAGCCGAGGGTGGTGAACT TCCCGCTGTCTGGTGGGATGAGAAAGCTGACAAGTCCCTTCTCATAGGAA CTTATAAACATGGTTCGTATAGTAATGCTTTATTTACAAAAGCTTCAAAG TTTTTGAAAATGGGCAAAAGTACTGCGTTTTCGTTACAGAAACTTTCGTT TCATGTCCTAAGTGATAGATCATAAGATCGATAACAACAATACACGCCAT GAAAATAGTACCTCTTTCTGCTAAAACTGATTGAAATGACTTATTTCAAT TTTTCAGGTTACGAGAAATACCAGCAGATCCGGAACGATCCTTGCTTGTA CTTCTATCACAAAATTGGACCTTATCAGATGGACGAGAAAGCACCGGAAA CGCCCGAGAGTATCGTTAACCCAGCTTCTGTCGAAAGGTATAACATAACA CAAACCTATATTCTTCACACATTCAATGGGCAATTCCATTTTATGACCAT GCAGGTGGGTGGACGAACATTTCCAAGAGGTAATCTGAGAAGAATTTCCA GAGTGTCTAAAAAGAAGTGTTTTGTCATTTTCCAGGGGATATCTACACTT TTCCAAGAAATTAGTTTTCACTTAAAAAGGTTCGTTCACCCCCCATTATG GAAATTTTGAGGAACAGTCCAATGTGATACTCTCTACATTTGAGATATCT CCTGACCGTCTTGAAGGTTATGTTTTATAATTTACGTAAAATGAATTGAA ATGATGTTTTAACGCGTTAGACTACTGACTTTTGATGACAACTTTTTCAT GACTGATCAATTCATTGTTGAAAGTATTATCTTATCTGGAATCCTTGAGT TTCCATGATATATATTGAGTATGTTCACGAATAAAAACATTTTGTCATTC GCCCTCTTTAGATGCGAAGATGGGGCAAGTGATACAGAATCCGTCACCTC TAAGAAGAAAAGCAAACCGTCTTCCTCTGCGACAAAAGCAGGGGAGAATG AGAACGACTCTATGAACGAATCAGAAGACGAGAATGATCTTTTCTCTTCA CACAATGCATCACCGGCTTCCGTTGCTTCCAATAAAGAGACCCCTCCTTC AACGGTTCCCGATGGTATGTAAATCCTCTTTTCTAGTTTGTATCTCTCAA CTTCAAACGACCGTTTCGAACAAAGATAATGTTCGGGGTATTCCAAACAC TTTTGTTTTAAACAGTGTTTAAAGTTCTTTGGTCTTATGAAGAGGTTTTA CAGCATCAAAACTCTGCATAACTCGCAAAAGAGAATTATTTGCTAATTTG ATGTGTAAAGACCATTCTTCGTCTTAGTGTTAAAACATCAAATGCGTTTT ATAATTGTAATCGAAAAAAAAAATGAATTGAAATGATGTTTTAACGCGTT AGACTACTGACTTTTGATGACAACTTTTTCATGACTGATCAATTCATTCC ATTCAATTCAAATCTTGTATTGACTTTTTCTTTGGGACTGGAGTTGAATT TAACTCAAATCTGAGGGGGGGGCCTTGTTTTTATTGCCTCTGGGAATTAC TTCTTTCGAACTGGAGTTGAACTGAGCTGAAATGATGTTTTAACGCGTTA GACTACTGAAAATTGACGACAATTTATCCTAACTGATCAGTTCACGGCAT TTAGCTTTTCTTAAATTCTGACAGCTTTGTGTGAGCTCTTTACAAATAGT TGTTGGAGTACAGAAACATGTTTACTTATGACCTGACTGAATGTGCGTTC GTTTCCTCTATTTCACTTTCCCATCTGAAAAGATCAAAGTGATGTTCAAA TGCGTCAGGTTTAGATGGACATTTTTTGCAACAAGTTGAATTGAAATGAT GCTTTAACGCGTTAGACTACTGACTTTTGATGATAATTTATCCTAACTGA TTAATTCATTCTTGTAAAATTAATTGGGGCTTATTAACTGGGACTGATTT TTTTCAGGAATTTACTTCTTTCCGCTTTGATTAACTTGAACTGAAATGAT GTTTCAACGCGTTAGACTACTGAATATTGGCGACAATTTATCCTAACTGA TCAGTTCATGCATTTAGCTTTTCTTAGATTCTTACAGTTTTGTGTGAGCT CTTTACAAATAGTTTTTAGAGTATAGAGATATGTTTCTAATTTGATGTTC GCTTCCTCTATTCACTTTCCCATGTAACAAAGATCAAAATTATGTTAAAT GCGGCAGGTTTGGGTGGACATTTATTGCGCTTGACAAGCTGAATTGAAAT GATGCTTTAACGCGTTAGACTACTGACTTTTGATGACAATTTTTTCATGA CTGATTAATTCATTCTTGTAAAATTAATTTGGGCTCATTAACTGGGACTG ATTTTTTTCAGGAATTTACTTCTTTCTGCTTTGTTGATTAACTTAGCTGA AATGATGTTTCAACGCGTTAGACTACTGAAAATTGACGACAATTTATCCT AACTGATCAGTTCACGGCATTTAGCTTTTCTTAAATTTTGACAGGATTGT GTGAGCTCTTTACAAATAATTTCTAGAGTATAGAGATATGTCCTAATTTG ATGTATCTGCGTTCGGTTCTTCTATTCACTTTCCATGTAACAAAGATCAA AATTAATTCAAATGCGGCAGGTTTGGGTGGACATTTTTTGTGGCAAGCTG AATTAAAATGATGTTTTAACGCGTTAGACTACTGACTTTTGATGATAATT TATCCTAACTGATCAATTCATTCTTGTAAAATTAATTGGGGCTTATTAAC TGGGACTGATTTTTTCAGGAATTTACTACTTTCCGATTTGATTAACTTGA ACTGAAATGATGTTTTAACGCGTTAGACTACTGAATATTGACGACAATTT ATCCTAACTGATCAGTTCATGCATTAAGCTTCTCGTAAATTTTGACAGCT TTGTGTGAGCTCTTTAAAAATAGTTGTTGAAGTACGGGAATATGTTTTCT AACTAGTAGTACCTGCGTTCGTTTACTTTATTTCACTTCCCTATGTAAGA AAGATCAAAGCGATGTTCAAATGTGTTAGGTTTCGATGGACATTCTTTGC AAGCTGAATTGAAGTAATGCTTTAACGTTAACGCGTTAGACTTACCAAGT TCTGATGAAAACCTTTTATGATGCTTTAACGCGTTATACTATTGACTGAT GAAAACCTTTTATGATGCTTTAACGCGTTAGACTATTGACTGATCAAAAC GTTTTATATTGTACTGATCAATTCATTGTTGTAAAATTAAAACTTTAGCT TAATAGCTCATTATTAAGCATTAGGCTACACTCTTAAAAATGCTTTTGAA TAAAAGGGCTGCCTAGAAGCGCACTGCTTATTTCGGGACCTAATATATGC TTAAAGCTAAAACATCATCACTGGGAATGTAGGGGGTTGTATATTTCTGT TTTATTGTTTGTATCAATTTTCTAATATTTTTTAAAGCTTGGAAAAAATT CAAATCTTGGAAGGGGCTGCGGCTCTTTTTTGCCTGGGACTTGGCTTGGC TTTTCTTTCGCACCGGAGTAGAACTGAGCTTAAATGATGCTTTAACGCGT TAGACTACTGAATGTTGATGACAACTTTTTCATGACTGATCAGTTCACGA CATTTAGCTTTTCTTTAAACAATGTGCATGCGGTTTTTACACTTTTCATT TTCTCCTTTTTCTTTCCTTCAGCAAAACAAGTACAAAGCAACAATCCGGA CACGAGGTGGCCACAACCTAACGACTTGAACATGAGGTTGAGAAGGATGT TTACTTCGTTCTTGCGCTTCACTGATAAAGAACAACTCGACATTTTGAAA GCTGAAAAGGTTGGTTTCTCATTATTTTGGGTAATGTTGGGAAATGAGAC ACTTTTGCTAGGGGGTCTGTGTAGATCAATACTCTGCCATATGCCTCTAG TGCTAATGTTAACTCGGTTCACTTCAGTCCCATGAAAATGCTTTCATAAA TATCAAACCTGTTTTGATATTTCAAAATTTTCGTGGAAAACTATATGCTT TGGGAATAAGCCATTTTGTTCAAATTCTATGAACAGAGCGGAAGAGACAT TGCTACATAGAAAATTAAATAAAATTTTACACTTTTGAGATCTTGCCATG AGAATTATTGATAAAAATTCAAGCCTTAAATGTTTTGATATTTCAACATT TCCGTGGAAAACTATATGCTTTGGGAATAAGCCATTTTGTTCAAATTCTA TGAACAGAGCGGAAGAGACATTGCTACATGGAAAATTAAATAAAATTTTA CACTTTTGAGATCTCGCCATGAGAATTCTTGATAGAAATTCAAGTCTTAA ATGTTTTGATATTTCAACATTTCCGTGGAAAACTATATGCTTTGGGAATA AGCCATTTTGTTCAAATTCTATGAACAGAGCGGAAGAGACATTGCTACAT GGAAAATTTAATAAAATTTTACACTTTCGAGATCTCGCCACGAGAATTCT TGATAGAAATTCAAGTCTTAAATGTTTTGATATTTCAAAATTGTCGCGGA AAACTATATGCTTTGGGAATAAGCCATTTTGTTCAAATTCTATGAACAGA GCGGAAGAGACATTGCTACATGGAAAATTTAATAAAATTTTACACTTTCG AGATCTCGCCACGAGAATTCTTGATAGAAATTCAAGTCTTAAATGTTTTG ATATTTCAAAATTGTCGCGGAAAACTATATGCTTTGGGAATAAGCCATTT TGTTCAAATTCTATGAACAGAGCGGAAGAGACATTGCTACATGGAAAATT TAATAAAATTTTACACTTTTGAGATCTTGCCACGAGAATTCTAGATAAAA ACTCAAGCCTTAAATGTTTTGATATTTCAAAATTCTCGTGGAAAACTATA TGCTTTGGGAATAAGCCATTTTGTTCAAATTCTATGAACAGAGCGGAAGA GACATTGCTACATTGAAAATTTAATAAAACTTTACACTTTTGAGATCTTG CCACGAGAATTCTAGATAAAAACTCAAGCCTTAAATGTTTTGATATTTCA AAATTCCCGTGGAAAACTATATGCTTTGGGAATAAGCCATTTTGTTCAAA TTCTATGAACAGAGCGGAAGAGACATTGCTACATGGAAAATTTAATAAAA TTTTACACTTTTGAGATCTTGCCACGAGAATTCTAGATAAAAACTCAAGC CTTAAATGTTTTGATATTTCAAAATTCCCGTGGAAAACTATATGCTTTGG GAATAAGCCATTTTGTTCAAATTCTATGAACAGAGCGGAAGAGACATTGC TACATTGAAAATAAATTGTCGCGGAAAACTATATGCTTTGGGAATAAGCC ATTTTGTTCAAATTCTATGAACAGAGCGGAACAGACATTGCTACATGGAA AATTTAATAAAATTTTACACTTTTGAGATCTTGCCATGAGAATTCTTGAT AATAATTCAAGCCTTAAATGTTTTGGTATTTCAAAATTCTCGTGGAAAAC TATATGCTTTGGGAATAAGCCATTTTGTTCAAATTCTATGAACAGAGCGG AAGAGACATTGCTACATGGAAAATTTAATTAAATTTTACACTTTTGAGAT CCTGCCATGAGAATTCTTGATAGAAATTCAAGTCTTAAATGTTTTGATAT TTCAAAATTGTCGTGGAAAACTCTATGCTTTGGAAATAAGCCATTTTGTT CAAATTCTATGAACAGAGCGGAAGAGACATTGCTACATGGAAAATTTAAT AAAATTTTACACTTTTGAGATCTTGCCATGAGAATTCTTGATAGAAATTC AAGCCTTAAATGTTTTGATATTTCAACATTTCCGTGGAAAACTATATGCT TTGGGAATAAGCCATTTTGTTCAAATTCTATGAACAGAGCGGAAGAGACA TTGCTACATGGAAAATTTAATAAAATTTTACACNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAAAAATTCAAG CCTTAAATGTTTTGATATTTCAACATTTCCGTGGAAAACTATATGCTTTG GGAATAAGCCATTTTGTTCAAATTCTATGAACAGAGCGGAAAAGACAATG CTACATGGATAAACTCTTTACAATTTTTCTTTATATTTTTTTCATGGTTA TTAGAAATTTTTGTTAAGAAATGTCCTCATGAAATATAGGCCAAGGGTGA TATTATTAGGCGCTTCTCCTGTGTAACGAAGGAACGGATGGAAAATGTAC AGGAGAACATGAAGAGTTTTTTTGTTTTCATAGGACAAGCAGAAGCAAGT CCGGTTAGCGAACATGGTGCAGGAACGGCAACGAAAACGTGCGGAGATGC AGCAACGATGGACGAGAAGGGAAGAGAGCGATTTCTACAAAGTTCTCACT AACTTCGGTGTTATTCAAAACCCTGAAACGAAAGAATACGANCGATTTCT ACAAAGTTCTCAGTAACTTCGGTGTTATTCAAAACCCTGAAACGAAAGAA TACGACTGGCAGAAGTTCAGGTGAGAACATAATGATTCTGATTTTCCGAA CCTTCTGTTATCAATACACTCATTATTATCTACACTTAGTCTTGATTAAC GTCCTCTAAGTCGGTTGTGCGGCGCTTACACACAATATTTTTGGACCTAC CTCCGGGTACCCCGGTGGAGGTTCTATAAATTAACCCATGTCCGTCCGTT CGTTCGTCCGTCCGTCCGTCTGTTACCAGCTTTTCTNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNTGCCCATGACCATTTTACAATATTC AACACACAAGCTTTATTTTTCCATTCTGAATTTTTGTACAATTATTGTCA CTTTTTTCTTATTTTCATCTGATGCTAATCATTAGGTAAGTCCATTCAGC ATGTTGCTTGTTTTAAATAAACTTACTGATTTTGAGCTTTTCCCCATATT GAGTATAATTAACTTTTTTTTCAGACAACTTGCAAAATTGGACAAGAAAT TGGACGAAACGTTGACACATTATTACGAAGATTTCATAGCTATGTGCAGG AGGATATGTGGACGGGCCACCGAGAACGACGAGAAAAGGCTAAAAGGTTG GTCACGAAAAATTTTCTCCTTTCCTGATCAATCACATACAGTTGACTATC TCTAATTCGATCTTCAAGTGACCAAGGATTTCTTCGAATTAGAGAAAGAT TCGAATGGCAGAAAGCATTCTATACTAATTTCTAGCTGACGGGACCAATA TTTTAGTTCGTATTAGAGAAAGATTCGAATAGTAGAGACTCGAATTTGAG AAAGTTGCATGTACCTCTTTAGAAAATTTTTGGTTCAACTACAATAGCAC GAAGATTTCTGTTCACTAGTCAGGCAGATTACACAATTTTTGACACGCGT TGTAAGTTTTGACAAACCTTAAATTTTCTAACCTTTCAGGATGTCAAATT GAAGAGATATCAGAAGACAAAGCAAGTCGGTGTCTTCAGCGTGTGAAACT ATTGAACAAGATTCGCACTCAGGTCTTACCACACGAAAAGTTGGGAGAAC GTTTGGCTCTGTGCATCAAGTCATATGATCTCCCTCACTGGTGGAAGTCT GTCAAACACGACAAAGCTCTCCTCCAGGGTGTTGCCAAGTAAGTTTTATT ATCTATAGTTTCATTATCCCCTTCGAAGAAAAAAAAGATATTTTCTAGAG AATCCATACAAACCAAAAAAAATGATATTTGCCGCTCATCTATCCCGGAA TAAAACAGCTGCGATGAGGGCTGCGAACTCCGGTAATTGTCATTCTTGAA TAGCGAACTATTATGCAAACATCTTTATCGTGGTCAGCCTTTCTTAATAT ATCTAACATAAAATTTAAAAGAGTATATCCTATTAAGTGCGAGCGCAAAC GCAAACCAAATCGGGAAATCAAACCGGAAAGATCGGGAAATCGAACCCGA CTATCGCAATTTATCGGATTTACGCACAATTACAAATGAAAAACACTGAT TTTAAGAAACTCCTTAACAGGACTTTAATTAGCCTGCCATTTTTTAGTGC GTCAGAGTGTGAATTGAAAAACGGTCAATTTTTTTTAGACATGGTCTCGG GAGAACGGAATATCAAGTCCTCCTCGACCCAGACTCCATCTTCAAAGAGA TGGTCGACAAGATTGGAACACTGAAGAAAGGTATTTTCCATTTTGTTTTT GTGATTCCTTGGTCAGACTTAATCGTTCCACCCGCTTATGTTCGAGTTAA AATTTCTCTCGGCTAAGGTTCCTTCGATATTCCAAAAGAAAAGAGAAATT GATTAGCTAATGAAACTTCCTTATGTCTTGTTCTAATGCTATTCACCTTC AATCACCTTCACATTGCAGAATCAGCAGACGACAACAAACCGACACTTCA TGCTCAAATGAACGGTGAACATCCTGAAAAGAAACCGAAAGACGAAGCAC AACTCAATAATGACATCAAAACGGAGAACAAAATCCCCATGCATACCAAC GAATATGCTCAACTTCTTTCTTCCTGGCCCAAGGTAAGCGACGTCTATTT AGTAAGCGATAGATTCCGAATTCAGGGTTTTTCTGTACTATCTTCTGTAT TATCTTTTCGGTAATATTTCTAATTACAATCTTTCCACTACTCAATGTTG AATAAAATGGCTTTCAATGGATTATTCTCATGTTTTAGGACAAAGGAATC GTGTCCCACCTTGAGAAAGTTTGCACTTGTGTTTTGAAAGGAGAATGGCC TAAAATGCCCAAGATCGAAATCCAACCGATGGCTGCGAAACTTCCGAGTT ACTCTCGACCACTTATTAGTACAGTTGGCCACACCACCAGTGCCGAACTG ACTGATGAAAAACATTCACGTGGCAACTGTACACCTAATCGTGATTTCAA AATCAAAAGCATCGACGGGTTGAAATTGACCGTGAAGACAGACCCTAAAG GAGACATTTTGAAGAGGAAAAAACGTGGCGATCCGATCGATTTCTTTCCT GATGATGATCGAAAAGTTCGCATCGATTCCATCAAGTTCATTAAGAAGCC GCGCGTCGAGCGAGGAGTAGAGATGGAAGATTCTCGTAATGTTCAGGTGA GCTTTCATCGTAATTATCTCTTTTGTTGTATCAAACACCGATTTGGATGG ATATTTCTTACTGAATGTTAACCCATGCATTTATTCGTTGCTCTCAATTT TTCTTCCAAAGATAAAATCAAGCAATGATTTATTTTTGCAGATAATTTTA ACCTCACCCTAACCNTTCCTGGCCCAAGGTAAGCGACGTCTATTTAGTAA GCGATAGATTCCGAATTCAGGGTTTTTCTGTACTATCTTCTGTATTATCT TTTCGGTAATATTTCTAATTACAATCTTTCCACTACTCAATGTTGAATAA AATGGCTTTCAATGGATTATTCTCATGTTTTAGGACAAAGGAATCGTGTC CCACCTTGAGAAGGTTTGCACTTGTGTTTTGAAAGGAGAATGGCCTAAAA TGCCCAAGATCGAAATCCAACCGATGGCTGCGAAACTTCCGAGTTACTCT CGATCACTTATTAGTACGGTTGGCCACACCACCAGTGCCGAACTGACTGA TGAAAAACATTCACGTGGCAACTGTACACCTAATCGTGACTTCAAAATCA AAAGCATCGACGGGTTGAAATTGACCGTGAAGACAGACCCTAAAGGAGAC ATTTTGAAGAGGAAAAAACGTGGCGATCCGATCGATTTCTTTCCTGATGA TGATCGAAAAGTTCGCATCGATTCCATCAAGTTCATTAAGAAGCCGCGCG TCGAGCGAGGAGTAGAGATGGAAGATTCTCGTAATGTTCAGGTGAGCTTT CATCGTAATTATCTCTTTTGTTGTATCAAACACCGATTTGGATGGATATT TCTTACTGAATGTTAACCCATGCATTTATTCGTTGCTCTCAATTTTTCTT CCAAAGATAAAATCAAGCAATGATTTATTTTTGCAGATAATTTTAACCTC ACCCTAACCCGATCTTTTTTTTCCAGATTCACATTCCGAGTTCACCGTCC ACCACGAAACCGTCTTCGCCTTCATCGAGACTCGACAAAAAGCCCATCAT TCATTTTCCTTCCAACGTCAAAGTTCCCAAAGTCTCTTCCATCGTTACTA CTGGCTCCACCAGGTCGCGGTCATTGACCAACACCGACCACAAACCTACC ATTGTCAAAGTGCTTAGTGGGAAACCCACACGAACGAGACGACATGACTC TGATGCTTACTCCCCTGTCAACAAATCAGCTCCACTTCCGTCCACCGCGA GCTCAGATCCAACAGTCGGTATACATATTGATAGTCCGAACTCCAATGTA CGTATACAAGGTTCGAAGATTGAAGTGAAAGAGAAATCGAGTACGAAGCG CGATCTATCTGAAGTGATTCTCAAAGTACCTGATCCTTCACGCTTCATGA AGTCACCACAAAACTCTGATTCCAGGAAATCTCGATCAACGAAAGTCGTG AAAACTTCCAAGCCTCCTCCGTTGACGCCTGACAAACATTCACCGACCAC TCAATCAAAGGTATGCGAACATAAGAAAGATGCTTCCAAAGACAAACCAG TTGAAGAAGCCCCTACATTGCGTCGTCGCCCTGAACGGTCTGCCAAGAAG CGGGCCAAAGATTCAATCTCAGAGATGAGTGAAGCTGAACGGCCGCTTGG TAAAGATGATTTGCACGAGCGGTTGATGGCGCCCCTCTCACCTTCTCCAC GCCACAGTTGGCGCGATATGAGGTCACCACCGCCTCATGTGTTACACCGC AGAGGGGGAGATATGTACATGGACTACTACCCTGATCGAAGCCCACCACG TGGTCGCTCTCCAGAACATCTCCGACGCGGACACCACTCTCCTGGACCCT TCCCCCGTCCTGGAAGTCCAGATCGTCGTTCGCCTCCGCCCATTCATCAC CACCATCGACCGGTGTCTCCTCCCACCAGACACAGACACACCCACTCACC ACCGCCACCACCAGTAGGCAGACACCCACACAACCACAGTCCTCACTACC GCGACCACGAAGATCATCACAAACATTTCCACTACAACGAACCGCTTTCG CCACGTTTTCGAGGTGGCGCTCCACATGAACCATACTTCTATCCTGAACG ATCGCGCTCTCCTTACTTCTACGATTACCGTCACGAAAAAGAACGTTTGT ACGACGAATTGGAGAGACGATCCCCGCCTATTAAACACCGCCGTCTTTCA CCTACCAGAGATCTTTACTCGCCTGCGCATAAACATGACTATATACACAT CCCAACAGATTCGCATTCTCCACGTCATCTTGATCGACACTCTCCACACG AAGGTCGATTCCCATATGGTCGAGTTGATTGGGACAGTCCGCGGTTCCGT CACGAGGGTCTCCATTCACCTCCGATACGTTCTTCTCCCGTCGACGCCCC TGTTCAATACCAGCCATTATCACGAAGTATGCCGCCCAGAGATGAAGCCA AGAAACCGATCATCAAGTCTCCCAGAGTTCACGAAGAGCACAGATTGAGG CGGTCGCGCTCTCCTGTTTCTTTCCCAGATAGGCAAGAAAAAAGACGTGT GCAAGACGAACCAACTCTCAAACGTAGCGCGGAAACGATCCCTGTTGCGA ATGAATTATCATCACCCTCCAAAGCCAAGAAATCGAAACCAGCAGAAGTT GAACGACCAGTCATCGAAATCTCAACCGAAGCAGTACGACAAAACTCTCA GCAGCAACAACAACGCAAACAGCCAGCTCGCAAGAAGGGATTGGGGTTAC TGGAGATGAAAATCCAAGGGCTGAAAGAGAAAATGGAACAGTCCGGTGTG TCCGACAAAATCAAAGAGAAAATGAATTCCCAACCAGAATCAACGGAAAA GAAGGAACCTTCGAAAGCCATGGAGACATCCCCCGCTCCCCCCATTACCA AACCAACAAAGAGGCTTTCAGACGTCATCTCTAACTTAACACAGGAGAAA GGAATGAAGGAACCGGTTTCTAAGCCACCTGGTAAACGTTCCAAGTCTCT TGCAGACATCACTAAAGATCTTGCTAAATCTGTCGAGAAAAGTAGCGTTC TCGATTCGTCACTTGCTGTATCTTTCTCAAAGAACAAGCCCACCGTAAAT TCAGTGTCATTCAACAAACCATCTAAACCTGTGACCAGTTCCAGCAAGCT CTCTGACGTCATTTCCACTTTAAAAGAAAAATCGAAGGCTGCCTCTGCTC AATTACCGACATCCAAATTCAAAGGTGTTCCCTTAACTGTGAAACCATCA AACGATTCCAAACTGCTAAATATTTTAAAAAGTGGAAATGCCGATAAAAG TCCAAGGGCATTGCAAAAGAAAGACTCACCTGAAGAAACGCCCACTAGTC CACCGCCTCGGAGAGCGTCAGTTATCTCTTCAGTTATTTGCTCAACCATC AAATCGCCTGTTGAAAAGAATGCTGAAGGTCATCCACCAGAACTCCAATC AGTATTAAAGTCTCCGCCGTTGGAAAGAATGAAATCGCCTTTGGAAAGAC CGAACTCGCGTTCAGAGAGGATTCGATCTCCGCCCTCAGACAGATTGACT TCATCACGTCAAACACGAAGATCATCCACTGCCGACAGACCTTTCTCGCC ATCTGATAGGCTACTTTCGCCAACTTCAGGAATACTTCACTCTCAATACG ATCAGCTACCAGAGTCACGTCCAAAAGACCGTTATCCACCAAGAGATGCA TCTCCATCTGCAAGAGATTTCCTACCTTATGACACTTATCGCTCATTTAA AAGCTCGTCATCTGAAAGAATCGTTTCGCCGCGCGACCACCCAATCGAGA GAATAGTTTCGCCGCGCGACCACTCAACTGAACGGCTCTTCTCGCCACGA TCATCGAGAAATTCTGAACGAATTACGTCACCTCGCGGACCTTCACCGTT AGACTTGACCCCTTCACCACGATCGTCAAGGAAACCTTCACTCGATGTCC CTGCAAGAGATCCGTCACCTCGATCATCCGGTCGGCAATCGTCTTCCATT TCTCCACGGGAACCTGTCATCCACTCACCAGACAACAGACCACCTCACTC ATTGAGACTTCTCTCACCTTCACAATCAGAGAGACTGACCTCACCACCAC CCTTGACCAGGGTCACTCCTCCATTGGAGAAACTTTCATCTCCAAGATCG AAACACTCATCACCGTTGATTGATCGAAGACCGTCTCCGTTGGAGAGTGT TATTTCACAAAACATAAGTAGAATGAAATCACCAACCGACCGAACGTCTT CCCCTTCTTCGAGAGCTAAATCGCCTATTCCGAGGGAAGCACCGCCACTC GACCGCATAAAATCCCCAAAGAATCATCCAACTCCACCTTCGAGAATCGT ATCTCCACCCGCGAGAGAGTTTGCTTCTCCTGGAATCACTTCACCAGTCC TCCGCATGAAATCACCACGACCAATGNCGCGAGAGAGTTTGCTTCTCCTG GACATGGAATCACTTCGCCAGTCCTCCGCATGAAATCACCACGACCAATG GAAGGCCCCCCTCCTCTTGACCGAGTTGTCTCGCCAAACTCCGAAAGACT CGGATCAACACCTTATGAACACGCGAATCTTTCTAAGGATCGAATCAAAT CACCTGTGGACAGGCTTTCGCTAAGTGAACCACGCTCTTCACCGATAGCG GACCGTGTAATGTCACCACGAATCAAGTCTGCCAGCGTCATTTCTTCAAC AGGGAGCAAGACTTCGGAACGCCTTCTTTCGCCCACTAACAACAGACGAA CGCCCAACATCACCTCACCGCCACCCTTCTCGCGCGCTGAGAACGATATT CAATCAAAGCATTCTCCCAGTAACCGTGGAACACCTGGAGATGAGAGACT GATGGGTGAACGATTCCAATCGCCGATCAGTAGTCCGGTATATTCACCGG CCGTTGTGAGCAACCCTTTAACAATCGACTTGGAAAAGAAGAAGATCTCT TCAGGGCGTGAAAGCGCCACCCTGCAAGTTATAACGCCTACACGAACACC CACTCCAATTAAGTCGCCTCTCACACAAACATTACAGGTTGTCACTTCGC CACGTCATGAGAATTCAATGTCGCCCTCTTTTCCCGCCTCACCGCCCCAA TTAGTCGATAAGGCGGTTTTGTCCTCGCAATTGACAAGGCCTACGGCGAT TGTTGCCACGACAACAGCGAATAATGAATCGGTCGATCACGTGACTAAAA CAGACGGAAAAGCATCATCTTAATTGGTTTTTGGAGATGAAAATTTTGGG GTTTTTTTGAAAAGTGGCATTGTGTCACGCACGATATTTTTATGCTATTT TTTCTACATTTTTAGTTCTGTATATTTTGATTGATTTTATTATTAGATAA TTTTGCTTTTTTCTATAGTATCACGTAGTATCATATGCCTTTTCCTCTGC CGTGCTTTTCCTTGCAATGAACTTGATCATTTCGTCGTGTTGAATTGCTG ATGTCAAGTCCGTATTAAATTACCAAATTATAGGAACTCTTTCTCTCAGT TTCTCTTTGAGTAATCTACCCTACATCATTTTTAGCAAAATTATTATTAA AGAAATTTTTGGCATAAATGTAATTTTTTTATTTTTGTCTTTTAAATATC ATATTTAAAAAATTGACAATGAAACATTTATACGATAT
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_045843XLOC_045843Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073821-exon-scaffold_98-1575043694:53362..56726TCONS_00073821-exon-scaffold_98-1575043694:53362..56726Clytia hemisphaericaexon
TCONS_00073821-exon-scaffold_98-1575043694:52902..53031TCONS_00073821-exon-scaffold_98-1575043694:52902..53031Clytia hemisphaericaexon
TCONS_00073821-exon-scaffold_98-1575043694:52354..52761TCONS_00073821-exon-scaffold_98-1575043694:52354..52761Clytia hemisphaericaexon
TCONS_00073821-exon-scaffold_98-1575043694:51531..51592TCONS_00073821-exon-scaffold_98-1575043694:51531..51592Clytia hemisphaericaexon
TCONS_00073821-exon-scaffold_98-1575043694:51209..51329TCONS_00073821-exon-scaffold_98-1575043694:51209..51329Clytia hemisphaericaexon
TCONS_00073821-exon-scaffold_98-1575043694:50841..50927TCONS_00073821-exon-scaffold_98-1575043694:50841..50927Clytia hemisphaericaexon
TCONS_00073821-exon-scaffold_98-1575043694:50635..50700TCONS_00073821-exon-scaffold_98-1575043694:50635..50700Clytia hemisphaericaexon
TCONS_00073821-exon-scaffold_98-1575043694:50029..50100TCONS_00073821-exon-scaffold_98-1575043694:50029..50100Clytia hemisphaericaexon
TCONS_00073821-exon-scaffold_98-1575043694:49490..49617TCONS_00073821-exon-scaffold_98-1575043694:49490..49617Clytia hemisphaericaexon
TCONS_00073821-exon-scaffold_98-1575043694:48810..48885TCONS_00073821-exon-scaffold_98-1575043694:48810..48885Clytia hemisphaericaexon
TCONS_00073821-exon-scaffold_98-1575043694:47828..47995TCONS_00073821-exon-scaffold_98-1575043694:47828..47995Clytia hemisphaericaexon
TCONS_00073821-exon-scaffold_98-1575043694:46291..46354TCONS_00073821-exon-scaffold_98-1575043694:46291..46354Clytia hemisphaericaexon
TCONS_00073821-exon-scaffold_98-1575043694:45865..46139TCONS_00073821-exon-scaffold_98-1575043694:45865..46139Clytia hemisphaericaexon
TCONS_00073821-exon-scaffold_98-1575043694:44313..45299TCONS_00073821-exon-scaffold_98-1575043694:44313..45299Clytia hemisphaericaexon
TCONS_00073821-exon-scaffold_98-1575043694:43894..44001TCONS_00073821-exon-scaffold_98-1575043694:43894..44001Clytia hemisphaericaexon
TCONS_00073821-exon-scaffold_98-1575043694:43428..43642TCONS_00073821-exon-scaffold_98-1575043694:43428..43642Clytia hemisphaericaexon
TCONS_00073821-exon-scaffold_98-1575043694:42265..42878TCONS_00073821-exon-scaffold_98-1575043694:42265..42878Clytia hemisphaericaexon
TCONS_00073821-exon-scaffold_98-1575043694:41940..42069TCONS_00073821-exon-scaffold_98-1575043694:41940..42069Clytia hemisphaericaexon
TCONS_00073821-exon-scaffold_98-1575043694:41263..41465TCONS_00073821-exon-scaffold_98-1575043694:41263..41465Clytia hemisphaericaexon
TCONS_00073821-exon-scaffold_98-1575043694:38568..38704TCONS_00073821-exon-scaffold_98-1575043694:38568..38704Clytia hemisphaericaexon
TCONS_00073821-exon-scaffold_98-1575043694:35807..36043TCONS_00073821-exon-scaffold_98-1575043694:35807..36043Clytia hemisphaericaexon
TCONS_00073821-exon-scaffold_98-1575043694:34581..34702TCONS_00073821-exon-scaffold_98-1575043694:34581..34702Clytia hemisphaericaexon
TCONS_00073821-exon-scaffold_98-1575043694:34039..34237TCONS_00073821-exon-scaffold_98-1575043694:34039..34237Clytia hemisphaericaexon
TCONS_00073821-exon-scaffold_98-1575043694:33497..33588TCONS_00073821-exon-scaffold_98-1575043694:33497..33588Clytia hemisphaericaexon
TCONS_00073821-exon-scaffold_98-1575043694:33144..33307TCONS_00073821-exon-scaffold_98-1575043694:33144..33307Clytia hemisphaericaexon
TCONS_00073821-exon-scaffold_98-1575043694:32581..32988TCONS_00073821-exon-scaffold_98-1575043694:32581..32988Clytia hemisphaericaexon
TCONS_00073821-exon-scaffold_98-1575043694:26989..31650TCONS_00073821-exon-scaffold_98-1575043694:26989..31650Clytia hemisphaericaexon
TCONS_00073821-exon-scaffold_98-1510915933:53362..56726TCONS_00073821-exon-scaffold_98-1510915933:53362..56726Clytia hemisphaericaexon
TCONS_00073821-exon-scaffold_98-1510915933:52902..53031TCONS_00073821-exon-scaffold_98-1510915933:52902..53031Clytia hemisphaericaexon
TCONS_00073821-exon-scaffold_98-1510915933:52354..52761TCONS_00073821-exon-scaffold_98-1510915933:52354..52761Clytia hemisphaericaexon
TCONS_00073821-exon-scaffold_98-1510915933:51531..51592TCONS_00073821-exon-scaffold_98-1510915933:51531..51592Clytia hemisphaericaexon
TCONS_00073821-exon-scaffold_98-1510915933:51209..51329TCONS_00073821-exon-scaffold_98-1510915933:51209..51329Clytia hemisphaericaexon
TCONS_00073821-exon-scaffold_98-1510915933:50841..50927TCONS_00073821-exon-scaffold_98-1510915933:50841..50927Clytia hemisphaericaexon
TCONS_00073821-exon-scaffold_98-1510915933:50635..50700TCONS_00073821-exon-scaffold_98-1510915933:50635..50700Clytia hemisphaericaexon
TCONS_00073821-exon-scaffold_98-1510915933:50029..50100TCONS_00073821-exon-scaffold_98-1510915933:50029..50100Clytia hemisphaericaexon
TCONS_00073821-exon-scaffold_98-1510915933:49490..49617TCONS_00073821-exon-scaffold_98-1510915933:49490..49617Clytia hemisphaericaexon
TCONS_00073821-exon-scaffold_98-1510915933:48810..48885TCONS_00073821-exon-scaffold_98-1510915933:48810..48885Clytia hemisphaericaexon
TCONS_00073821-exon-scaffold_98-1510915933:47828..47995TCONS_00073821-exon-scaffold_98-1510915933:47828..47995Clytia hemisphaericaexon
TCONS_00073821-exon-scaffold_98-1510915933:46291..46354TCONS_00073821-exon-scaffold_98-1510915933:46291..46354Clytia hemisphaericaexon
TCONS_00073821-exon-scaffold_98-1510915933:45865..46139TCONS_00073821-exon-scaffold_98-1510915933:45865..46139Clytia hemisphaericaexon
TCONS_00073821-exon-scaffold_98-1510915933:44313..45299TCONS_00073821-exon-scaffold_98-1510915933:44313..45299Clytia hemisphaericaexon
TCONS_00073821-exon-scaffold_98-1510915933:43894..44001TCONS_00073821-exon-scaffold_98-1510915933:43894..44001Clytia hemisphaericaexon
TCONS_00073821-exon-scaffold_98-1510915933:43428..43642TCONS_00073821-exon-scaffold_98-1510915933:43428..43642Clytia hemisphaericaexon
TCONS_00073821-exon-scaffold_98-1510915933:42265..42878TCONS_00073821-exon-scaffold_98-1510915933:42265..42878Clytia hemisphaericaexon
TCONS_00073821-exon-scaffold_98-1510915933:41940..42069TCONS_00073821-exon-scaffold_98-1510915933:41940..42069Clytia hemisphaericaexon
TCONS_00073821-exon-scaffold_98-1510915933:41263..41465TCONS_00073821-exon-scaffold_98-1510915933:41263..41465Clytia hemisphaericaexon
TCONS_00073821-exon-scaffold_98-1510915933:38568..38704TCONS_00073821-exon-scaffold_98-1510915933:38568..38704Clytia hemisphaericaexon
TCONS_00073821-exon-scaffold_98-1510915933:35807..36043TCONS_00073821-exon-scaffold_98-1510915933:35807..36043Clytia hemisphaericaexon
TCONS_00073821-exon-scaffold_98-1510915933:34581..34702TCONS_00073821-exon-scaffold_98-1510915933:34581..34702Clytia hemisphaericaexon
TCONS_00073821-exon-scaffold_98-1510915933:34039..34237TCONS_00073821-exon-scaffold_98-1510915933:34039..34237Clytia hemisphaericaexon
TCONS_00073821-exon-scaffold_98-1510915933:33497..33588TCONS_00073821-exon-scaffold_98-1510915933:33497..33588Clytia hemisphaericaexon
TCONS_00073821-exon-scaffold_98-1510915933:33144..33307TCONS_00073821-exon-scaffold_98-1510915933:33144..33307Clytia hemisphaericaexon
TCONS_00073821-exon-scaffold_98-1510915933:32581..32988TCONS_00073821-exon-scaffold_98-1510915933:32581..32988Clytia hemisphaericaexon
TCONS_00073821-exon-scaffold_98-1510915933:26989..31650TCONS_00073821-exon-scaffold_98-1510915933:26989..31650Clytia hemisphaericaexon
TCONS_00073821-exon-scaffold_98-1491911889:53362..56726TCONS_00073821-exon-scaffold_98-1491911889:53362..56726Clytia hemisphaericaexon
TCONS_00073821-exon-scaffold_98-1491911889:52902..53031TCONS_00073821-exon-scaffold_98-1491911889:52902..53031Clytia hemisphaericaexon
TCONS_00073821-exon-scaffold_98-1491911889:52354..52761TCONS_00073821-exon-scaffold_98-1491911889:52354..52761Clytia hemisphaericaexon
TCONS_00073821-exon-scaffold_98-1491911889:51531..51592TCONS_00073821-exon-scaffold_98-1491911889:51531..51592Clytia hemisphaericaexon
TCONS_00073821-exon-scaffold_98-1491911889:51209..51329TCONS_00073821-exon-scaffold_98-1491911889:51209..51329Clytia hemisphaericaexon
TCONS_00073821-exon-scaffold_98-1491911889:50841..50927TCONS_00073821-exon-scaffold_98-1491911889:50841..50927Clytia hemisphaericaexon
TCONS_00073821-exon-scaffold_98-1491911889:50635..50700TCONS_00073821-exon-scaffold_98-1491911889:50635..50700Clytia hemisphaericaexon
TCONS_00073821-exon-scaffold_98-1491911889:50029..50100TCONS_00073821-exon-scaffold_98-1491911889:50029..50100Clytia hemisphaericaexon
TCONS_00073821-exon-scaffold_98-1491911889:49490..49617TCONS_00073821-exon-scaffold_98-1491911889:49490..49617Clytia hemisphaericaexon
TCONS_00073821-exon-scaffold_98-1491911889:48810..48885TCONS_00073821-exon-scaffold_98-1491911889:48810..48885Clytia hemisphaericaexon
TCONS_00073821-exon-scaffold_98-1491911889:47828..47995TCONS_00073821-exon-scaffold_98-1491911889:47828..47995Clytia hemisphaericaexon
TCONS_00073821-exon-scaffold_98-1491911889:46291..46354TCONS_00073821-exon-scaffold_98-1491911889:46291..46354Clytia hemisphaericaexon
TCONS_00073821-exon-scaffold_98-1491911889:45865..46139TCONS_00073821-exon-scaffold_98-1491911889:45865..46139Clytia hemisphaericaexon
TCONS_00073821-exon-scaffold_98-1491911889:44313..45299TCONS_00073821-exon-scaffold_98-1491911889:44313..45299Clytia hemisphaericaexon
TCONS_00073821-exon-scaffold_98-1491911889:43894..44001TCONS_00073821-exon-scaffold_98-1491911889:43894..44001Clytia hemisphaericaexon
TCONS_00073821-exon-scaffold_98-1491911889:43428..43642TCONS_00073821-exon-scaffold_98-1491911889:43428..43642Clytia hemisphaericaexon
TCONS_00073821-exon-scaffold_98-1491911889:42265..42878TCONS_00073821-exon-scaffold_98-1491911889:42265..42878Clytia hemisphaericaexon
TCONS_00073821-exon-scaffold_98-1491911889:41940..42069TCONS_00073821-exon-scaffold_98-1491911889:41940..42069Clytia hemisphaericaexon
TCONS_00073821-exon-scaffold_98-1491911889:41263..41465TCONS_00073821-exon-scaffold_98-1491911889:41263..41465Clytia hemisphaericaexon
TCONS_00073821-exon-scaffold_98-1491911889:38568..38704TCONS_00073821-exon-scaffold_98-1491911889:38568..38704Clytia hemisphaericaexon
TCONS_00073821-exon-scaffold_98-1491911889:35807..36043TCONS_00073821-exon-scaffold_98-1491911889:35807..36043Clytia hemisphaericaexon
TCONS_00073821-exon-scaffold_98-1491911889:34581..34702TCONS_00073821-exon-scaffold_98-1491911889:34581..34702Clytia hemisphaericaexon
TCONS_00073821-exon-scaffold_98-1491911889:34039..34237TCONS_00073821-exon-scaffold_98-1491911889:34039..34237Clytia hemisphaericaexon
TCONS_00073821-exon-scaffold_98-1491911889:33497..33588TCONS_00073821-exon-scaffold_98-1491911889:33497..33588Clytia hemisphaericaexon
TCONS_00073821-exon-scaffold_98-1491911889:33144..33307TCONS_00073821-exon-scaffold_98-1491911889:33144..33307Clytia hemisphaericaexon
TCONS_00073821-exon-scaffold_98-1491911889:32581..32988TCONS_00073821-exon-scaffold_98-1491911889:32581..32988Clytia hemisphaericaexon
TCONS_00073821-exon-scaffold_98-1491911889:26989..31650TCONS_00073821-exon-scaffold_98-1491911889:26989..31650Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_98supercontigscaffold_98:26989..56726 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
1.14746 1.84921 3.30791 1.21008 12.2649 9.61289 3.23543 6.27544 1.68452 0.453822 2.15529 1.81282 2.90151 7.61706 3.04167 2.79377 4.09397 2.78164 2.33011 2.9775 6.55421 4.38262 2.67578 0.000247536 0.0172512 0.012064 3.14271 1.93719 4.15646 4.20482
Blast
BLAST of TCONS_00073821 vs. Swiss-Prot (Human)
Match: CHD9 (Chromodomain-helicase-DNA-binding protein 9 OS=Homo sapiens GN=CHD9 PE=1 SV=2)

HSP 1 Score: 1165.21 bits (3013), Expect = 0.000e+0
Identity = 579/1037 (55.83%), Postives = 756/1037 (72.90%), Query Frame = 1
Query: 3934 VEEYYVKYKGYSYLHCEWGTLEYLAKKDKRVPAKIKRYKQKRDSSYAYLNELDDEPFNPDYVEIDRVLDYTTTVDPVTNDTIDHYLVKWRGLPYEDSTWELKMNIDESVIQNFHEMKKPPPVEQRRFKPRPQEGDWVKELQSPMYKNGNRLHDYQLEGMNWLTFCWYKRINCILADEMGLGKTIQSISLLCAMKKYGIRGPFLVIAPLSTIGNWQREFETWTDINAIVYHGSAVSRNNIQQYEMYYKDEKGNSINDVYKFEAIITTYEIVLSANQFLCTIPFRCLIIDEAHRLKNQKCKLMEGLNNLKMEHRVLLTGTPLQNNVEELFSLLNFLEPTRFPSQGAFMFEFGNLKTEGQVEKLKQILKPMMLRRVKADVQTNIASKXXXXXXXXXXXXQKKFYRAILERNFSFLAKGSGYSNLPNLMNTMMELRKCCNHPFLIKGAREKISSDYSDPEQPDKQLTHLSGLIESSGKMVLIDKLLPKLKSGGHKILVFSQMIKVLDLIQEYLMEKQYQFERIDGGVQGNMRQAAIDRFCRPDSDRFVFLLCTRAGGLGINLTAADTVIIFDSDWNPQNDLQAQARCHRIGQEKPVKVYRLICRNTYEREMFDRASLKLGLDKAVLGNMNQKEAS--GQKAMSKKEVEDLLKKGAYGAVMENDEDASNFCEEDIDQILQRRTQVIQIEGEGKGSTFSKASFVSDKAGLDVDIDDPDFWKKWAQKASIKLEDLEQDKQLIMAEPRKRKQTKRFGNIDGDALEMSDLDSDDEVYEPNKSKSKSSQYIERT-AWTRVECFKVEKLLLIYGWDRWQDITSQVQFKQEVRNNDVEGISRTILAYCFRFYKTDEKSKDFFTNLIDESVKNAPPKNEKFDITDQILGSAPPPKNGRGRKRNATTNPGRNALRRLTHQYSKPALIECGLDWL-TVDPDTLIIDSSYRKHLQQHCHKIMSRIRLIHSLKHDIIKEASVDIFEGKPHEEIEFTVPPAEGGELPAVWWDEKADKSLLIGTYKHGYEKYQQIRNDPCLYFYHKIGPYQMDEKA 7032
             EE++VKYK YSYLHCEW T E L K DKR+  KIKR+K ++     +  ++++EPFNPDYVE+DRVL+ +   D  T + + +YLVKW  LPYEDSTWELK ++D + I+ F +++   P + RR   RP    W K  QS  YKNGN+L +YQLEG+NWL F WY R NCILADEMGLGKTIQSI+ L  +   GIRGPFL+IAPLSTI NW+REF TWTDIN +VYHGS +SR  IQQYEMY++D +G  I   Y+F+AIITT+E++L     L  I +RC+IIDEAHRLKN+ CKL+EGL  + +EH+VLLTGTPLQN VEELFSLL+FLEP RFPS+  FM EFG+LKTE QV+KL+ ILKPMMLRR+K DV+  +A KEETI+EVELT IQKK+YRAILE+NFSFL+KG+G +N+PNL+NTMMELRKCCNHP+LIKGA EKI  ++ D   P     HL  +I+S+GK+VLIDKLLPK+K+GGHK+L+FSQM++ LD++++YL+ K+Y +ERIDG V+GN+RQAAIDRF +PDSDRFVFLLCTRAGGLGINLTAADT IIFDSDWNPQNDLQAQARCHRIGQ K VKVYRL+ RN+YEREMFDRASLKLGLDKAVL +M+ +E++  G + +SKKE+EDLL++GAYGA+ME +++ S FCEEDIDQIL RRT+ I IE EG+GSTF+KASFV+     D+ +DDP+FW+KWA+KA I +E +     L++  PR RKQT+ F     +  E+S+ +S+ +       K K  +  +R+  + R ECF+VEK LL+YGW RW++I S  +FK+++  +DVE I R +LAYC   Y+ DEK K F  +LI  +        +  ++ + +  SAP P+  +G+K    T+                +      +WL   +P+ L+ D  Y+KH++ HC+K++ R+R+++ LK ++I      +F+G    +I+  VP  +  E+PA WWD  ADKSLLIG +KHGYEKY  IR DP L F  ++G  + DEKA
Sbjct:  713 TEEFFVKYKNYSYLHCEWATEEQLLK-DKRIQQKIKRFKLRQAQRAHFFADMEEEPFNPDYVEVDRVLEVSFCEDKDTGEPVIYYLVKWCSLPYEDSTWELKEDVDLAKIEEFEQLQASRP-DTRRLD-RPPSNIWKKIDQSRDYKNGNQLREYQLEGLNWLLFNWYNRRNCILADEMGLGKTIQSITFLYEILLTGIRGPFLIIAPLSTIANWEREFRTWTDINVVVYHGSLISRQMIQQYEMYFRDSQGRIIRGAYRFQAIITTFEMILGGCGELNAIEWRCVIIDEAHRLKNKNCKLLEGLKLMNLEHKVLLTGTPLQNTVEELFSLLHFLEPLRFPSESTFMQEFGDLKTEEQVQKLQAILKPMMLRRLKEDVEKKLAPKEETIIEVELTNIQKKYYRAILEKNFSFLSKGAGQTNVPNLVNTMMELRKCCNHPYLIKGAEEKILGEFRDTYNPAASDFHLQAMIQSAGKLVLIDKLLPKMKAGGHKVLIFSQMVRCLDILEDYLIHKRYLYERIDGRVRGNLRQAAIDRFSKPDSDRFVFLLCTRAGGLGINLTAADTCIIFDSDWNPQNDLQAQARCHRIGQNKAVKVYRLVTRNSYEREMFDRASLKLGLDKAVLQSMSGRESNVGGIQQLSKKEIEDLLRRGAYGAIMEEEDEGSKFCEEDIDQILLRRTKTITIESEGRGSTFAKASFVASGNRTDISLDDPNFWQKWAKKAEIDIEAISGRNSLVIDTPRIRKQTRPFSATKDELAELSEAESEGD------EKPKLRRPCDRSNGYGRTECFRVEKNLLVYGWGRWREILSHGRFKRQLNEHDVEIICRALLAYCLVHYRGDEKIKGFIWDLITPT-----EDGQTRELQNHLGLSAPVPRGRKGKKVKTQTS----------------SFDIQKAEWLRKYNPEQLLQDEGYKKHIKHHCNKVLLRVRMLYYLKQEVIGNECQKVFDGVDASDIDVWVPEPDHSEVPAEWWDFDADKSLLIGVFKHGYEKYNTIRADPALCFLERVG--KPDEKA 1717          

HSP 2 Score: 152.525 bits (384), Expect = 4.197e-36
Identity = 72/156 (46.15%), Postives = 103/156 (66.03%), Query Frame = 2
Query: 7562 RKNTXDFYKVLSNFGVIQNPETKEYDWQKFRQLAKLDKKLDETLTHYYEDFIAMCRRICGRATENDEKRLKGCQIEEISEDKASRCLQRVKLLNKIRTQVLPHEKLGERLALCIKSYDLPHWWKSVKHDKALLQGVAKHGLGRTEYQVLLDPDSIF 8029
            R+   DFY+V+S FGV+ +P+  ++DW KFR +A+L KK D++L  Y   F++MCRR+C R    +E       I+ I+E++ASR L R++LL K+R Q L H +L ERL LC  + DLP WW+   HD+ LL G AKHG+ RT+Y +L DP+  F
Sbjct: 1840 RREEADFYRVVSTFGVVFDPDRGQFDWTKFRAMARLHKKTDDSLEKYLYAFMSMCRRVC-RLPSKEELVDPNIFIQPITEERASRTLYRIELLRKVREQALRHPQLFERLKLCHPNPDLPVWWECGPHDRDLLIGAAKHGVSRTDYHILRDPELSF 1994          
The following BLAST results are available for this feature:
BLAST of TCONS_00073821 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
CHD94.197e-3655.83Chromodomain-helicase-DNA-binding protein 9 OS=Hom... [more]
back to top