Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00073812 (transcript) - C. hemisphaerica

Overview
NameTCONS_00073812
Unique NameTCONS_00073812
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length9703

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00073812 ID=TCONS_00073812|Name=TCONS_00073812|organism=Clytia hemisphaerica|type=transcript|length=9703bp
CAGGAAAAAGAACCGAAAGAGCAGCCAGAAGTAAAAGAAGATGAATCCTT
AGCACCTCCCGTTGCTTCAAATCCTGTTGAGCCGGTCATTGATGGTGGAG
TAAATCAACTTGTGGCTTATCAACCTAATCTTGAAGTTGAAGGGGAAATT
GCTATCATCGAAAAGATTCTTGCCATGCGAACAGTTCAACAAGAACCTGG
TGAGGAGAAAACCGGAAAAACTGAAAAGACAGAAGATCCAGAAAACGCTA
ACAAAACAGAGGAGAAGAGCGAAGATATATCagaagaaaaagttgaagag
AGTGAGACAAAGTCAAAAGAGCAAGAAGAAACAATGGTTGAAGAGTACTA
TGTTAAATACAAAGGATACTCATATCTTCACTGTGAATGGGGAACTCTTG
AATATCTTGCAAAGAAAGACAAACGTGTTCCTGCTAAGATCAAAAGATAT
AAACAGAAAAGGGATTCTTCTTATGCCTACTTGAATGAGCTTGATGACGA
ACCATTTAATCCGGATTATGTTGAAATAGATCGTGTTTTGGATTATACAA
CAACTGTCGACCCAGTTACCAATGATACAATCGATCACTATTTAGTCAAA
TGGAGAGGTTTGCCGTATGAGGATAGCACATGGGAGCTGAAGATGAATAT
TGATGAATCAGTAATCCAAAACTTTCATGAAATGAAGAAACCACCACCTG
TTGAACAGAGAAGGTTTAAACCAAGACCTCAAGAAGGGGATTGGGTGAAA
GAGCTTCAATCACCAATGTACAAAAATGGAAATCGTTTACATGATTATCA
GCTTGAAGGAATGAATTGGTTAACATTTTGCTGGTACAAAAGAATCAATT
GTATCCTTGCTGATGAGATGGGTTTGGGGAAAACAATTCAGAGTATATCA
CTTTTATGTGCCATGAAGaaatatGGTATTCGCGGACCATTTTTGGTTAT
TGCACCTTTGTCAACGATTGGTAATTGGCAACGTGAATTTGAAACCTGGA
CAGACATCAATGCAATCGTTTACCATGGTAGTGCAGTGAGCAGAAATAAT
ATTCAACAATATGAAATGTACTATAAAGATGAAAAGgGAAACAGTATAAA
TGATGTCTACAAATTTGAAGCCATTATTACAACTTATGAAATCGTTTTAA
GTGCAAATCAATTTCTGTGTACCATTCCATTCCGCTGTCTTATTATTGAC
GAAGCTCATCGActgaaaaaccaaaaatgtAAGCTGATGGAGGGATTAAA
TAACTTGAAAATGGAACATCGAGTTCTGTTAACTGGAACTCCACTTCAAA
ATAATGTTGAAGAGCTGTTCAGTCTTCTAAATTTTTTGGAGCCAACACGA
TTCCCTTCTCAAGGGGCGTTCATGTTTGAATTTGGTAATCTTAAAACTGA
AGGCCAAGTTGAAAAACTGAAACAGATTTTGAAGCCAATGATGTTACGTC
GAGTGAAGGCTGATGTACAAACCAATATTGCATCCAAAGAAGAAACAATT
GTTGAAGTTGAACTTACCAcaattcaaaagaaattctatagAGCAATTCT
TGAACGAAATTTCAGTTTCTTAGCAAAAGGTTCAGGTTATTCAAATTTAC
CAAACTTAATGAATACCATGATGGAACTTCGTAAATGCTGCAACCATCCT
TTTTTAATCAAAGGAGCTCGTGAGAAGATCTCCTCTGACTACTCTGACCC
AGAACAACCTGATAAACAATTAACTCATTTGAGTGGTTTGATTGAATCTT
CCGGTAAAATGGTTCTCATTGATAAACTCTTGCCCAAGCTGAAAAGTGGT
GGACATAAAATACTCGTATTTTCACAGATGATCAAAGTTTTAGATTTGAT
ACAAGAGTACCTTATGGAGAAACAATACCAATTTGAACGCATTGACGGTG
GTGTACAAGGGAACATGAGACAAGCTGCCATTGATCGTTTTTGTAGACCT
GACTCTGATCGCTTTGTTTTCCTATTATGTACACGTGCCGGTGGTCTAGG
TATTAACCTGACAGCTGCTGATACTGTTATAATTTTTGATAGTGATTGGA
ACCCTCAGAACGATTTACAAGCTCAAGCCAGGTGTCATAGAATCGGACAA
GAAAAACCTGTGAAAGTCTATCGGTTAATATGTAGAAATACATATGAACG
AGAAATGTTTGATAGAGCTAGTTTAAAACTTGGACTTGATAAAGCTGTCT
TGGGAAACATGAATCAGAAGGAAGCGTCTGGTCAAAAAGCCATGAGTAAG
AAAGAGGTGGAGGATTTGCTGAAGAAAGGTGCTTATGGAGCGGTCATGGA
AAATGACGAGGATGCTAGTAACTTCTGCGAAGAAGATATTGATCAAATTT
TACAAAGGAGAACACAAGTTATCCAAATTGAAGGCGAGGGAAAAGGTTCC
ACTTTCTCAAAGGCAAGTTTTGTGTCTGATAAAGCAGGTCTTGATGTTGA
TATTGATGATccagatttttggaaaaagtggGCTCAAAAAGCTTCCATCA
AACTCGAAGATCTTGAGCAGGACAAGCAGTTAATAATGGCGGAGCCCCGA
AAACGTAAACAAACCAAAAGGTTTGGCAACATTGACGGAGATGCGTTGGA
GATGTCCGACCTTGATTCTGATGATGAAGTATACGAACCAAATAAAAGCA
AATCTAAATCCTCACAATACATTGAAAGAACCGCATGGACCAGAGTCGAA
TGcttcaaagttgaaaaactGCTACTCATTTATGGATGGGATCGTTGGCA
AGACATTACATCACAAGTCCAATTCAAGCAAGAAGTCCGAAACAATGACG
TCGAAGGCATCTCAAGAACTATCCTTGCTTACTGCTTCAGATTCTATAAA
ACCGATGAGAAGTCTAAAGACTTTTTCACCAACCTCATTGATGAATCCGT
CAAAAATGCTCccccaaaaaacgaaaagtTTGATATCACAGACCAGATCT
TAGGCTCCGCTCCACCACCCAAGAATGGGCGTGGTCGGAAGAGAAACGCT
ACCACAAACCCAGGTAGGAACGCTTTGAGACGACTGACACATCAATACAG
TAAACCAGCCCTCATTGAATGCGGTTTAGATTGGTTGACAGTGGACCCGG
ACACGCTGATCATTGATAGCAGTTACCGGAAACACTTGCAACAACATTGC
CATAAGATCATGTCACGGATACGATTGATACATTCTCTCAAACACGACAT
CATCAAGGAAGCCTCAGTGGATATCTTTGAAGGAAAACCACATGAAGAGA
TTGAATTCACGGTTCCTCCAGCCGAGGGTGGTGAACTTCCCGCTGTCTGG
TGGGATGAGAAAGCTGACAAGTCCCTTCTCATAGGAACTTATAAACATGg
ttACGAGAAATACCAGCAGATCCGGAACGATCCTTGCTTGTACTTCTATC
ACAAAATTGGACCTTATCAGATGGACGAGAAAGCACCGGAAACGCCCGAG
AGTATCGTTAACCCAGCTTCTGTCGAAAGATGCGAAGATGGGGCAAGTGA
TACAGAATCCGTCACCTCTAAGAAGAAAAGCAAACCGTCTTCCTCTGCGA
CAAAAGCAGGGGAGAATGAGAACGACTCTATGAACGAATCAGAAGACGAG
AATGATCTTTTCTCTTCACACAATGCATCACCGGCTTCCGTTGCTTCCAA
TAAAGAGACCCCTCCTTCAACGGTTCCCGATGCAAAACAAGTACAAAGCA
ACAATCCGGACACGAGGTGGCCACAACCTAACGACTTGAACATGAGGTTG
AGAAGGATGTTTACTTCGTTCTTGCGCTTCACTGATAAAGAACAACTCGA
CATTTTGAAAGctgaaaaggaCAAGCAGAAGCAAGTCCGGTTAGCGAACA
TGGTGCAGGAACGGCAACGAAAACGTGCGGAGATGCAGCAACGATGGACG
AGAAGGGAAGAGAGCGATTTCTACAAAGTTCTCACTAACTTCGGTGTTAT
TCAAAACCCTGAAACGAAAGAATACGANCGATTTCTACAAAGTTCTCAGT
AACTTCGGTGTTATTCAAAACCCTGAAACGAAAGAATACGACTGGCAGAA
GTTCAGaCAACTTGCAAAATTGGACAAGAAATTGGACGAAACGTTGACAC
ATTATTACGAAGATTTCATAGCTATGTGCAGGAGGATATGTGGACGGGCC
ACCGAGAACGACGAGAAAAGGCTAAAAGGATGTCAAATTGAAGAGATATC
AGAAGACAAAGCAAGTCGGTGTCTTCAGCGTGTGAAACTATTGAACAAGA
TTCGCACTCAGGTCTTACCACACGAAAAGTTGGGAGAACGTTTGGCTCTG
TGCATCAAGTCATATGATCTCCCTCACTGGTGGAAGTCTGTCAAACACGA
CAAAGCTCTCCTCCAGGGTGTTGCCAAacATGGTCTCGGGAGAACGGAAT
ATCAAGTCCTCCTCGACCCAGACTCCATCTTCAAAGAGATGGTCGACAAG
ATTGGAACACTGAAGAAAGAATCAGCAGACGACAACAAACCGACACTTCA
TGCTCAAATGAACGGTGAACATCCTGAAAAGAAACCGAAAGACGAAGCAC
AACTCAATAATGACATCAAAACGGAGAACAAAATCCCCATGCATACCAAC
GAATATGCTCAACTTCTTTCTTCCTGGCCCAAGGACAAAGGAATCGTGTC
CCACCTTGAGAAAGTTTGCACTTGTGTTTTGAAAGGAGAATGGCCTAAAA
TGCCCAAGATCGAAATCCAACCGATGGCTGCGAAACTTCCGAGTTACTCT
CGATCACTTATTAGTACGGTTGGCCACACCACCAGTGCCGAACTGACTGA
TGAAAAACATTCACGTGGCAACTGTACACCTAATCGTGACTTCAAAATCA
AAAGCATCGACGGGTTGAAATTGACCGTGAAGACAGACCCTAAAGGAGAC
ATTTTGAAGAGGAAAAAACGTGGCGATCCGATCGATTTCTTTCCTGATGA
TGATCGAAAAGTTCGCATCGATTCCATCAAGTTCATTAAGAAGCCGCGCG
TCGAGCGAGGAGTAGAGATGGAAGATTCTCGTAATGTTCAGATTCACATT
CCGAGTTCACCGTCCACCACGAAACCGTCTTCGCCTTCATCGAGACTCGA
CAAAAAGCCCATCATTCATTTTCCTTCCAACGTCAAAGTTCCCAAAGTCT
CTTCCATCGTTACTACTGGCTCCACCAGGTCGCGGTCATTGACCAACACC
GACCACAAACCTACCATTGTCAAAGTGCTTAGTGGGAAACCCACACGAAC
GAGACGACATGACTCTGATGCTTACTCCCCTGTCAACAAATCAGCTCCAC
TTCCGTCCACCGCGAGCTCAGATCCAACAGTCGGTATACATATTGATAGT
CCGAACTCCAATGTACGTATACAAGGTTCGAAGATTGAAGTGAAAGAGAA
ATCGAGTACGAAGCGCGATCTATCTGAAGTGATTCTCAAAGTACCTGATC
CTTCACGCTTCATGAAGTCACCACAAAACTCTGATTCCAGGAAATCTCGA
TCAACGAAAGTCGTGAAAACTTCCAAGCCTCCTCCGTTGACGCCTGACAA
ACATTCACCGACCACTCAATCAAAGGTATGCGAACATAAGAAAGATGCTT
CCAAAGACAAACCAGTTGAAGAAGCCCCTACATTGCGTCGTCGCCCTGAA
CGGTCTGCCAAGAAGCGGGCCAAAGATTCAATCTCAGAGATGAGTGAAGC
TGAACGGCCGCTTGGTAAAGATGATTTGCACGAGCGGTTGATGGCGCCCC
TCTCACCTTCTCCACGCCACAGTTGGCGCGATATGAGGTCACCACCGCCT
CATGTGTTACACCGCAGAGGGGGAGATATGTACATGGACTACTACCCTGA
TCGAAGCCCACCACGTGGTCGCTCTCCAGAACATCTCCGACGCGGACACC
ACTCTCCTGGACCCTTCCCCCGTCCTGGAAGTCCAGATCGTCGTTCGCCT
CCGCCCATTCATCACCACCATCGACCGGTGTCTCCTCCCACCAGACACAG
ACACACCCACTCACCACCGCCACCACCAGTAGGCAGACACCCACACAACC
ACAGTCCTCACTACCGCGACCACGAAGATCATCACAAACATTTCCACTAC
AACGAACCGCTTTCGCCACGTTTTCGAGGTGGCGCTCCACATGAACCATA
CTTCTATCCTGAACGATCGCGCTCTCCTTACTTCTACGATTACCGTCACG
AAAAAGAACGTTTGTACGACGAATTGGAGAGACGATCCCCGCCTATTAAA
CACCGCCGTCTTTCACCTACCAGAGATCTTTACTCGCCTGCGCATAAACA
TGACTATATACACATCCCAACAGATTCGCATTCTCCACGTCATCTTGATC
GACACTCTCCACACGAAGGTCGATTCCCATATGGTCGAGTTGATTGGGAC
AGTCCGCGGTTCCGTCACGAGGGTCTCCATTCACCTCCGATACGTTCTTC
TCCCGTCGACGCCCCTGTTCAATACCAGCCATTATCACGAAGTATGCCGC
CCAGAGATGAAGCCAAGAAACCGATCATCAAGTCTCCCAGAGTTCACGAA
GAGCACAGATTGAGGCGGTCGCGCTCTCCTGTTTCTTTCCcagataggca
agaaaaaagaCGTGTGCAAGACGAACCAACTCTCAAACGTAGCGCGGAAA
CGATCCCTGTTGCGAATGAATTATCATCACCCTCCAAAGCCAAGAAATCG
AAACCAGCAGAAGTTGAACGACCAGTCATCGAAATCTCAACCGAAGCAGT
ACGACAAAACTCTCAGCAGCAACAACAACGCAAACAGCCAGCTCGCAAGA
AGGGATTGGGGTTACTGGAGATGAAAATCCAAGGGCTGAAAGAGAAAATG
GAACAGTCCGGTGTGTCCGACAAAATCAAAGAGAAAATGAATTCCCAACC
AGAATCAACGGAAAAGAAGGAACCTTCGAAAGCCATGGAGACATCCCCCG
CTCCCCCCATTACCAAACCAACAAAGAGGCTTTCAGACGTCATCTCTAAC
TTAACACAGGAGAAAGGAATGAAGGAACCGGTTTCTAAGCCACCTGGTAA
ACGTTCCAAGTCTCTTGCAGACATCACTAAAGATCTTGCTAAATCTGTCG
AGAAAAGTAGCGTTCTCGATTCGTCACTTGCTGTATCTTTCTCAAAGAAC
AAGCCCACCGTAAATTCAGTGTCATTCAACAAACCATCTAAACCTGTGAC
CAGTTCCAGCAAGCTCTCTGACGTCATTTCcactttaaaagaaaaatcga
aGGCTGCCTCTGCTCAATTACCGACATCCAAATTCAAAGGTGTTCCCTTA
ACTGTGAAACCATCAAACGATTCCAAACtgctaaatattttaaaaagtgg
AAATGCCGATAAAAGTCCAAGGGCATTGCAAAAGAAAGACTCACCTGAAG
AAACGCCCACTAGTCCACCGCCTCGGAGAGCGTCAGTTATCTCTTCAGTT
ATTTGCTCAACCATCAAATCGCCTGTTGAAAAGAATGCTGAAGGTCATCC
ACCAGAACTCCAATCAGTATTAAAGTCTCCGCCGTTGGAAAGAATGAAAT
CGCCTTTGGAAAGACCGAACTCGCGTTCAGAGAGGATTCGATCTCCGCCC
TCAGACAGATTGACTTCATCACGTCAAACACGAAGATCATCCACTGCCGA
CAGACCTTTCTCGCCATCTGATAGGCTACTTTCGCCAACTTCAGGAATAC
TTCACTCTCAATACGATCAGCTACCAGAGTCACGTCCAAAAGACCGTTAT
CCACCAAGAGATGCATCTCCATCTGCAAGAGATTTCCTACCTTATGACAC
TTATCGCTCATTTAAAAGCTCGTCATCTGAAAGAATCGTTTCGCCGCGCG
ACCACCCAATCGAGAGAATAGTTTCGCCGCGCGACCACTCAACTGAACGG
CTCTTCTCGCCACGATCATCGAGAAATTCTGAACGAATTACGTCACCTCG
CGGACCTTCACCGTTAGACTTGACCCCTTCACCACGATCGTCAAGGAAAC
CTTCACTCGATGTCCCTGCAAGAGATCCGTCACCTCGATCATCCGGTCGG
CAATCGTCTTCCATTTCTCCACGGGAACCTGTCATCCACTCACCAGACAA
CAGACCACCTCACTCATTGAGACTTCTCTCACCTTCACAATCAGAGAGAC
TGACCTCACCACCACCCTTGACCAGGGTCACTCCTCCATTGGAGAAACTT
TCATCTCCAAGATCGAAACACTCATCACCGTTGATTGATCGAAGACCGTC
TCCGTTGGAGAGTGTTATTTCACAAAACATAAGTAGAATGAAATCACCAA
CCGACCGAACGTCTTCCCCTTCTTCGAGAGCTAAATCGCCTATTCCGAGG
GAAGCACCGCCACTCGACCGCATAAAATCCCCAAAGAATCATCCAACTCC
ACCTTCGAGAATCGTATCTCCACCCGCGAGAGAGTTTGCTTCTCCTGGAA
TCACTTCACCAGTCCTCCGCATGAAATCACCACGACCAATGNCGCGAGAG
AGTTTGCTTCTCCTGGACATGGAATCACTTCGCCAGTCCTCCGCATGAAA
TCACCACGACCAATGGAAGGCCCCCCTCCTCTTGACCGAGTTGTCTCGCC
AAACTCCGAAAGACTCGGATCAACACCTTATGAACACGCGAATCTTTCTA
AGGATCGAATCAAATCACCTGTGGACAGGCTTTCGCTAAGTGAACCACGC
TCTTCACCGATAGCGGACCGTGTAATGTCACCACGAATCAAGTCTGCCAG
CGTCATTTCTTCAACAGGGAGCAAGACTTCGGAACGCCTTCTTTCGCCCA
CTAACAACAGACGAACGCCCAACATCACCTCACCGCCACCCTTCTCGCGC
GCTGAGAACGATATTCAATCAAAGCATTCTCCCAGTAACCGTGGAACACC
TGGAGATGAGAGACTGATGGGTGAACGATTCCAATCGCCGATCAGTAGTC
CGGTATATTCACCGGCCGTTGTGAGCAACCCTTTAACAATCGACTTGGAA
AAGAAGAAGATCTCTTCAGGGCGTGAAAGCGCCACCCTGCAAGTTATAAC
GCCTACACGAACACCCACTCCAATTAAGTCGCCTCTCACACAAACATTAC
AGGTTGTCACTTCGCCACGTCATGAGAATTCAATGTCGCCCTCTTTTCCC
GCCTCACCGCCCCAATTAGTCGATAAGGCGGTTTTGTCCTCGCAATTGAC
AAGGCCTACGGCGATTGTTGCCACGACAACAGCGAATAATGAATCGGTCG
ATCACGTGACTAAAACAGACGGAAAAGCATCATCTTAATTGGTTTTTGGA
GATGAAAATTTTGgggtttttttgaaaagtggcaTTGTGTCACGCACgat
atttttatgctattttttctacatttttagtTCTGtatattttgattgat
tttattattagataattttgcttttttctatAGTATCACGTAGTATCATA
TGCCTTTTCCTCTGCCGTGCTTTTCCTTGCAATGAACTTGATCATTTCGT
CGTGTTGAATTGCTGATGTCAAGTCCGTATTAAATTACCAAATTATAGGA
ACTCTTTCTCTCAGTTTCTCTTTGAGTAATCTACCCTACAtcatttttag
caaaattattattaaagaaatttttggcataaatgtaatttttttatttt
tgtcttttaaatatcatatttaaaaaattgacaatgaaaCATTTATACGA
TAT

transcript from alignment at scaffold_98:26989..52124-

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00073812 ID=TCONS_00073812|Name=TCONS_00073812|organism=Clytia hemisphaerica|type=transcript|length=25136bp|location=Sequence derived from alignment at scaffold_98:26989..52124- (Clytia hemisphaerica)
CAGGAAAAAGAACCGAAAGAGCAGCCAGAAGTAAAAGAAGATGAATCCTT AGCACCTCCCGTTGCTTCAAATCCTGTTGAGCCGGTCATTGATGGTGGAG TAAATCAACTTGTGGCTTATCAACCTAATCTTGAAGTTGAAGGGGAAATT GCTATCATCGAAAAGATTCTTGCCATGCGAACAGTTCAACAAGAACCTGG TGAGGAGAAAACCGGAAAAACTGAAAAGACAGAAGATCCAGAAAACGCTA ACAAAACAGAGGAGAAGAGCGAAGATATATCAGAAGAAAAAGTTGAAGAG AGTGAGGTAATATTACTCTTCTATATCTATAACTTTCTCCGTAAGTGAAA GATATTTTCTTTTCTTATTAAAAGAAAACAAATTATCAAATTTATTGTAA GTTTTTTTTTGAGAGACAAATAGTGTCACACTCTAAATTTGAAAAAGAGG GGATTTAAGAGGGTTCTATAATCACATCTGACATTTGAGTTGGTCAATCA AAAGCCAATAATTTACACTGTTCCTCTTTCAGACAAAGTCAAAAGAGCAA GAAGAAACAATGGTTGAAGAGTACTATGTTAAATACAAAGGATAGTAAGT AACCTTTTCTGTACAATTTACTTTCACTACATGTCCCTTTCACAAAAATC AAAATCGAAATTCTAAAGATATTCAGATAAGATACAAAAGGCTTTAATGG TAGCACTAAAAGCATATGACAGTTAGTTATTTAGTCTAGTAGCTTGCTGC AAACCAAAGGTTATAATAATCACCAACGAAAATTCCTTTTTCTAGCTCAT ATCTTCACTGTGAATGGGGAACTCTTGAATATCTTGCAAAGAAAGACAAA CGTGTTCCTGCTAAGATCAAAAGATATAAACAGAAAAGGGATTCTTCTTA TGCCTACTTGAATGAGGTGAGTAAAAGGCTAATAGCTTTGTGCTGTATAA TAATCTAAAGATTGTCTGGGACATCCAAGACTGTCTGNGCTAATAGCTTT GTGCTGTATGATAATCTAAAGATTGTCTGGGACATCCAAGACTGTCTGGG ACAGTCAGACAAGTATTTTTGGATTCAGGGTCTGCTCTACCTTTGTGCCT TGAATTTTGGTACTTTTTAAAGTACCTCATTGTAGTTTGCAATGCTTTGA CTTTAAACTGGCTCTAACTCTTTTGTAATTAATTCATTGATTCATAGCTT GATGACGAACCATTTAATCCGGATTATGTTGAAATAGATCGTGTTTTGGA TTATACAACAACTGTCGACCCAGTTACCAATGATGTAAGAAATGTTTTTT CTCATTCACTTAAAAAAAATTGAATTTTGTGCAGATTACTTTCATCTTGG AGTTTTCATCCAATGCTCATCATTATAATCATATGAAAATTTAAAATTCT GAAATTTTTGTTTTCCAATTTCAGACAATCGATCACTATTTAGTCAAATG GAGAGGTTTGCCGTATGAGGATAGCACATGGGAGCTGAAGGTATTTTGAA ATTGTCTTTCTTTACATCTTTTCAACGAGCTTTATATACTTCATTGAAGT GAAGCCATATAAGTTGGTTTTTGCTTATTCGGACTTTTTGATGAAATAGG TTTCTTTTTCTCTAATTTTCTGTTGTTTTCAATCAGGGGGGGTTTTTCAG TATAGCACCACATCACTAAATGCCATGATGTATGGAATTTCAATACTGAC TACCCCTGTTTCAAGGACATTATTTGACATAATATCTCTTACCATTTGCT TACACAGCATTTCTGCATGAAAAAAGAACTTTCTCTTTTTCTCATGCCAC ACAGCACAAATTTAAAGAAATTTCTTTCTTAAAAATAATCTGCTTTGTCA GCGTACAAGGCACACCTCTATTTTATTTCATATAAATAAAAATCTTTATT AAACCTCAGTCAAAACAATTATAAAATCTAGCTTTATGTGATGGAGAGAA TTTAAGTTGGCTCCAGTTGGCTCCTCATATAACTTGTTTAATTCTTTTAA TAAGATTGCATGCTTCTATTTTAGATGAATATTGATGAATCAGTAATCCA AAACTTTCATGAAATGAAGAAACCACCACCTGTTGAACAGAGAAGGGTAA GTGATATTTTGTTGTAAGATTTGCTATAGGTATGTGGAATAGGGAAATAG CTGATATATATTGACATGATGATAATGATAATTATGATATATTTTATGAA CATGGGATGAAGAAGGGGGACCATAGNGTGGAATAGGAAAATAGTTGATA TATATTGACATGATGATAATGATAATTATGATAAATTTTATGAACATGGG ATGAAGAAGGGGGACCATAGCTCTAAGAGATTTTGGCTGGGAGGTTCACT ACTCTTGTCTAAAATGTATATACCTGTGTACATTTACGCAACTTTTAAAA CCAAACCGAGAAGAGGGGAAAACGAATTAAAGTGGAAATTTTAGGGAGGC ATCATATTCCAATTTTTTAATTACAAGATCTAATCTTCTTTATTTCTTTC ATTGCAGTTTAAACCAAGACCTCAAGAAGGGGATTGGGTGAAAGAGCTTC AATCACCAATGTACAAAAATGGAAATCGTTTACATGATTATCAGCTTGAA GGAATGAATTGGTTAACATTTTGCTGGTACAAAAGGTATAGTTAAGGCTT AAAAAGAAGTAGTTTTGTTTCCTGAAATGTGTGACGAAAAGAAATCTCAC CCTGGTGGTCGGGAATCTTTTTTTGCAATTTTCTTTGATATTCTCATTGA AGTAATACATCTTCACCCAAAAAAACAGTAAATTACTTTCATACACAAGA ACATGGTATAATAATAATACAAAGAAGAGAAATTTTGAGACAGATTTTTT TTTAAACACAAGGTGATCTTTAATTTTTTCCCACCTGTGAGGAGCACACA ACATTGCAAACGCCACAATTGTAAGAATATCCCTGAAAATTGAAATAGTT TAGCTTTAAGAGATATCTTTCATCACAACAAAAAGTAAAAAGTACACTAC TCAGAGCTTCGTGCTACTGCACTTGTCAAAAAAAATAATTAAAATAAAGA TTTCAAGGTTGCCGGACAAAATAACCGACCGATCAGGGTTGCTTTGGCTT GAACAGCTTTTTTGGGTCGGACAATGAGCCATTTGGATCGAACAATGACT GAACCTTATTTCAAGCCCTGATAATAAATCTGTTCTAATGTGGAACTGTT TTCTCTTATTATATCTCTGTATTGGCTTATTTCTTGTAGAATCAATTGTA TCCTTGCTGATGAGATGGGTTTGGGGAAAACAATTCAGAGTATATCACTT TTATGTGCCATGAAGGTGAGAATAATAGTTTTCCTGAGATTTTTTCAACA TTTTAAATTGAGTATTCCCCAGTTTGTTGCGATAGATATAATTCCTTAAG ATCTACGACTGCTTTCGGGGGAAGAATGAAAAATTTCAAGATTTTTGTCA CATGTAGTACATTTCTTATTTAGTAGTGGGCTAGTTCAAAACACTGCTCA TAGGTCATAGATGACAGACCAAATTATTATAACAAGTTTGTAGCAAAAAA ACAATTCAAAACATTCCTCTGAAAGTGCCATTTGTAATTATATGAATATT ATATGCAAAGTGGCAATCACATATTATTGACAAAATGACATCTGACTATA GAATATTTATATTATAACAAAATAAGAGGTGTATATAACAATAAATGCCG AAATCTTTTGAGAATGCTGACAGTATCAGCAGACATTGTTTGAAAATTTT GAGTGCTTCAAGAAAGCCGATTTAGAGATATGGCATGGATAGATTTTGAC CCTTAGAATTGTTATACATGGATGAAATACCCTCAGAATGATACTTTTGA GAACAGTGACCGTTTTAGAACATTTTCCTTGTTTACAGTAATCAAAGTTG ACCTGTCAAAACTGACCCGTGACCTTTGTTTGCTAGTTCAAAACATTTGG TGATGCTCTCTGTGGGAGAATCCATTATGTTAAATGAAACAGACTTTTAC TCGCCAGGAAAAGGGTTTTTACATTTATTATTTCATTTAACCCAGTTGCC ATGGTTGCAACAATGCTTGACAACTTATGCAACTTTGTTATCAAGCCTAC TTCAGTTTTTCATAAACATATAATTTTAGAAATATGGTATTCGCGGACCA TTTTTGGTTATTGCACCTTTGTCAACGATTGGTAATTGGCAACGTGAATT TGAAACCTGGACAGACATCAATGCAATCGTTTACCATGGTAGTGCAGTGA GCAGAAATAATATTCAACAATATGAAATGTACTATAAAGATGAAAAGGTA CCAACTATTGTTACAGTGATTGTACTCAGAACAAACTTTGGTCCTAGAAA GGTTTTAACTGTCACCTGGGTTGGGGGGCACTTTGCCCCCAATAATTTTT TCAAAGATGGTTTCTTAAAGAAACAAAGGGCCTGAGCTGGGGAAATTCGA AAAACTAAGGCCTCTATATTGCTGGAAGATGCACCGAAAATAACTTGAAT TCGAGGGAAAAAAATTATACTTTTGTTTTTGATAATTGTGTTTTTTCTGT TTTTAGGGAAACAGTATAAATGATGTCTACAAATTTGAAGCCATTATTAC AACTTATGAAATCGTTTTAAGTAAGTTATGGCTTTTCTTTATAAAACTCA CTTTCAGTTAATAATACTTGAATTATTTTGCAGACAATTCAATGCTGAAA AATTTGATCTTGCACATATCTTTACATGATAGAATTTGAAAATCAAAATC CATCCATTCTTTAATTGTTAGGTGCAAATCAATTTCTGTGTACCATTCCA TTCCGCTGTCTTATTATTGACGAAGCTCATCGACTGAAAAACCAAAAATG TAAGCTGATGGAGGGATTAAATAACTTGAAAATGGAACATCGAGTTCTGT TAACTGGAACTCCACTTCAAAATAATGTTGAAGAGCTGTTCAGTCTTCTA AATTTTTTGGAGCCAACACGATTCCCTTCTCAAGGGGCGTTCATGTTTGA ATTTGGTAATCTTAAAACTGAAGGCCAAGTTGAAAAACTGAAACAGGTAA TTAATCTCTTTTTTGATTTCTTTCTATTCCAATTTGGTTGCTGAAATGAT GTTTTCACGCGTTAGACTACTGATCTTATTGATGTTTAATTTTTAAAAAC TGATCAGCACCACATGCTGACTGTAGTGCACCTGGCTACGGTCCGCAAGG TTGTTGACCCCAGTTGGGTCATACCAAAGATTCCTAAAATGGTACTAGAT GCCTCTCTGCTTGATGCTCAGCAATTAAGAGAAGGATTAAGGGTTAAAGT AGAGCAATTGAGGGAGAAAGAGTGGCACCCTCACCTACCTTCTGGTAGAT AGCTATTGAAAGAGGAGCATTCGGGTCGCCTCCGACTGAAGTCACAAACT TACTTACTATCACATGCCTTAGGCTTCTATTGACATAATAGCTTTCCTTG AATATTTTTTGCCTCTGCTATCTTATTGCTGCACTGAAATGATGTTTCAA CGCGTTAGACTACTGAATTCTGATGAAGATTTATCTTAACTGATCAGTGC CTGCTTTCCNGAAAGGTTTTAACTGTCACCTGGGTTGGGGGGCACTTTGC CCCCTATAATTTTTTCAAAGATGGTTTCTTAAAGAAACAAAGGGCCTGAG CTGGGGAAATTCGAAAAACTAAGGCCTCTATATTGCTGGAAGATGCACCG AAAATAACTTGAATTCGAGGGAAAAAAATTATACTTTTGTTTTTGATAAT TGTGTTTTTTCTGTTTTTAGGGAAACAGTATAAATGATGTTTACAAATTT GAAGCCATTATTACAACTTATGAAATTGTTTTAAGTAAGTTATGGCTTTT CTTTATAAAACTCACTTTCAGTTAATAATACTTGAATTATTTTGCAGACA ATTCAATGCTGAAAAATTTGATCTTGCACATATCTTTACATGATAGAATT TGAAAATCAAAATCCATCCATTCTTTAATTGTTAGGTGCAAATCAATTTC TGTGTACCATTCCATTCCGCTGTCTTATTATTGACGAAGCTCATCGACTG AAAAACCAAAAATGTAAGCTGATGGAGGGATTAAATAACTTGAAAATGGA ACATCGAGTTCTGTTAACTGGAACTCCACTTCAAAATAATGTTGAAGAGC TGTTCAGTCTTCTAAATTTTTTGGAGCCAACACGATTCCCTTCTCAAGGG GCGTTCATGTTTGAATTTGGTAATCTTAAAACTGAAGGCCAAGTTGAAAA ACTGAAACAGGTAATTAATCTCTTTTTTGATTTCTTTCTATTCCAATTTG GTTGCTGAAATGATGTTTTCACGCGTTAGACTACTGATCTTATTGATGTT TAATTTTTAAAAACTGATCAGCACCACTGCTTGATGCTCAGCAATTAAAA GAAGGATTAAGGGTTAAAGTAGAGCAATTGAGGGAGAAAGAGTGGCACTG GTAGATAGCTATTGAAAGAGGAGCATTCGGGTCGCCTCCGACTGAAGTCA CAAACTTACTTACTATCACATGCTTTAGGCTTCTATTGACATAATGACTT TCCTTGAATATTTTTTGCCTCTACTATCTTATTGCTGCACTGAAATGATG TTTCAACGCGTTAGACTACTGAATTCTGATGAAGATTTATCTTAACTGAT CAGTGCCTGCTTTCCTCGTGAAACTTTAAAATTACAAGAGTGCCCTTAAC CACAATTTTGCTTCAAAACCATTACCCGCCATTACACTGATTTAGTTATA AAACTATTATTGTATTGGGAAAGATTAAAAAATAAAAGCCACATTCAATT GACAATTGAAAATCTCTTTCCCCAGATTTTGAAGCCAATGATGTTACGTC GAGTGAAGGCTGATGTACAAACCAATATTGCATCCAAAGAAGAAACAATT GTTGAAGTTGAACTTACCACAATTCAAAAGAAATTCTATAGAGCAATTCT TGAACGAAATTTCAGTTTCTTAGCAAAAGGTTCAGGTTATTCAAATTTAC CAAACTTAATGAATACCATGATGGAACTTCGTAAATGCTGCAACCATCCT TTTTTAATCAAAGGAGCTCGTGAGAAGATCTCCTCTGACTACTCTGACCC AGAACAACCTGATAAACAATTAACTCATTTGAGTGGTTTGATTGAATCTT CCGGTAAAATGGTTCTCATTGATAAACTCTTGCCCAAGCTGAAAAGTGGT GGACATAAAATACTCGTATTTTCACAGATGATCAAAGTTTTAGATTTGAT ACAAGAGTACCTTATGGAGAAACAATACCAATTTGAACGCATTGACGGTG GTGTACAAGGGAACATGAGACAAGCTGCCATTGATCGTTTTTGTAGACCT GACTCTGATCGCTTTGTTTTCCTATTATGTACACGTGCCGGTGGTCTAGG TATTAACCTGACAGCTGCTGATACTGTTATAATTTTTGATAGTGATTGGA ACCCTCAGAACGATTTACAAGCTCAAGCCAGGTGTCATAGAATCGGACAA GAAAAACCTGTGAAAGTCTATCGGTTAATATGTAGAAATACATATGAACG AGAAATGTTTGATAGAGCTAGTTTAAAACTTGGACTTGATAAAGCTGTCT TGGGAAACATGAATCAGAAGGAAGCGTCTGGTCAAAAAGCCATGAGTAAG AAAGAGGTGGAGGATTTGCTGAAGAAAGGTGCTTATGGAGCGGTCATGGA AAATGACGAGGATGCTAGTAACTTCTGCGAAGAAGATATTGATCAAATTT TACAAAGGAGAACACAAGTTATCCAAATTGAAGGCGAGGGAAAAGGTTCC ACTTTCTCAAAGGTATTTGTCTGGTCTTCTTCAAAGTTAACTTGAATTTG CTCAGCATTTAGTTTGTCTTTTATTGTATGCAATTGCAATTTGCTTTTCT TCTTCTTAACTAATAATTCACCGTTGTCCCGTCTCAGACAGATTTCTGTG TTTGCGAAGTTTAAAAAGAGGCCTTACCGGCTAATTTGTGGCGTTGAATC CATTTCTCGTCTCAGAGGAAAAACTTTGCTTAGAACATTGTATGACCTAC TACCAGTCACAACCGAAGTACCAAAATAAATATTTGAAATAGTTTTTTAT TTTGTGCATTCTTTTACTTTCAGGCAAGTTTTGTGTCTGATAAAGCAGGT CTTGATGTTGATATTGATGATCCAGATTTTTGGAAAAAGTGGGCTCAAAA AGCTTCCATCAAACTCGAAGATCTTGAGCAGGTTTGATATTCTTTCTTCT CTTTCATCTGAACAAGCTTGACCTCTTCTTTTCTAAAGTGTTTACTGGCT TGCACTGATGTGAGTGGACTGTATGGGAATGTTTTTCCTTACCTAGTGAA TGTATAGTCTGTTTAAAAACCAAGATAAAATTCAAGTTTTCTATTGTTGT ATCACGCAATGAAATCTTTCAGAGAATAAGGACTAAGGGCCCAATCCTTT CTAATCACTTATAATCTTCTACAATAATTCAGGACAAGCAGTTAATAATG GCGGAGCCCCGAAAACGTAAACAAACCAAAAGGTTTGGCAACATTGACGG AGATGCGTTGGAGATGTCCGACCTTGATTCTGATGATGAAGTATACGAAC CAAATAAAAGCAAATCTAAATCCTCACAATACATTGAAAGAACCGCATGG ACCAGAGTCGAATGCTTCAAAGTTGAAAAACTGCTACTCATTTATGGGTA AGAGACTCTTTTGTTTTTATAAACAATTCATCTACTCTCCCCCGTAGGGT AGTGATTATCTGACCTTACCAGAAGGGGGCTGGAAATTTTGAAAGCTGCG ACAGTAAGCCTTCTTTTTCTAATAAGGATTGTATTTNCTCTTTTTATAAA CAATTCATCTACTCTTCCCCGTAGGGTAGTGATTATCTGACCTTACCAGA AGGGGGCTGGAAATTTTGAAAGCTGCGACAGTAAGCCTTCTTTTTCTAAT AAGGATTGTATTTTTGTGGACTTCTTGACTGCTTAAACCTTGCTGATGAG AAGTTTTTTTCGAGGAAGGGGGGACCGGTCTGATTTAAGCACAATAGTCT ATCNGATGAGAAGTTTTTTTCGAGGAAGGGGGGACCGGTCTGATTTAAGC ACAATAGTCTATCACTACTTTTTTCCAATATTAATTTATTAAGAGAGTTT TGATCAAACAAGGATTTACATTTTACATGGTGTGGTGTTTCAAGATAAAT GAGAAACCCCGGTTTTGAAAAACTTTAATGCTAACTTACTGTTTAGATGG GATCGTTGGCAAGACATTACATCACAAGTCCAATTCAAGCAAGAAGTCCG AAACAATGACGTCGAAGGCATCTCAAGAACTATCCTTGCTTACTGCTTCA GATTCTATAAAACCGATGAGAAGTCTAAAGACTTTTTCACCAACCTCATT GATGAATCCGTCAAAAATGCTCCCCCAAAAAACGAAAAGTTTGATATCAC AGACCAGATCTTAGGCTCCGCTCCACCACCCAAGAATGGGCGTGGTCGGA AGAGAAACGCTACCACAAACCCAGGTAGGAACGCTTTGAGACGACTGACA CATCAATACAGTAAACCAGCCCTCATTGAATGCGGTTTAGATTGGTTGAC AGTGGACCCGGACACGCTGATCATTGATAGCAGTTACCGGAAACACTTGC AACAACATTGCCATAAGATCATGTCACGGATACGATTGATACATTCTCTC AAACACGACATCATCAAGGAAGCCTCAGTGGATATCTTTGAAGGAAAACC ACATGAAGAGATTGAATTCACGGTTCCTCCAGCCGAGGGTGGTGAACTTC CCGCTGTCTGGTGGGATGAGAAAGCTGACAAGTCCCTTCTCATAGGAACT TATAAACATGGTTCGTATAGTAATGCTTTATTTACAAAAGCTTCAAAGTT TTTGAAAATGGGCAAAAGTACTGCGTTTTCGTTACAGAAACTTTCGTTTC ATGTCCTAAGTGATAGATCATAAGATCGATAACAACAATACACGCCATGA AAATAGTACCTCTTTCTGCTAAAACTGATTGAAATGACTTATTTCAATTT TTCAGGTTACGAGAAATACCAGCAGATCCGGAACGATCCTTGCTTGTACT TCTATCACAAAATTGGACCTTATCAGATGGACGAGAAAGCACCGGAAACG CCCGAGAGTATCGTTAACCCAGCTTCTGTCGAAAGGTATAACATAACACA AACCTATATTCTTCACACATTCAATGGGCAATTCCATTTTATGACCATGC AGGTGGGTGGACGAACATTTCCAAGAGGTAATCTGAGAAGAATTTCCAGA GTGTCTAAAAAGAAGTGTTTTGTCATTTTCCAGGGGATATCTACACTTTT CCAAGAAATTAGTTTTCACTTAAAAAGGTTCGTTCACCCCCCATTATGGA AATTTTGAGGAACAGTCCAATGTGATACTCTCTACATTTGAGATATCTCC TGACCGTCTTGAAGGTTATGTTTTATAATTTACGTAAAATGAATTGAAAT GATGTTTTAACGCGTTAGACTACTGACTTTTGATGACAACTTTTTCATGA CTGATCAATTCATTGTTGAAAGTATTATCTTATCTGGAATCCTTGAGTTT CCATGATATATATTGAGTATGTTCACGAATAAAAACATTTTGTCATTCGC CCTCTTTAGATGCGAAGATGGGGCAAGTGATACAGAATCCGTCACCTCTA AGAAGAAAAGCAAACCGTCTTCCTCTGCGACAAAAGCAGGGGAGAATGAG AACGACTCTATGAACGAATCAGAAGACGAGAATGATCTTTTCTCTTCACA CAATGCATCACCGGCTTCCGTTGCTTCCAATAAAGAGACCCCTCCTTCAA CGGTTCCCGATGGTATGTAAATCCTCTTTTCTAGTTTGTATCTCTCAACT TCAAACGACCGTTTCGAACAAAGATAATGTTCGGGGTATTCCAAACACTT TTGTTTTAAACAGTGTTTAAAGTTCTTTGGTCTTATGAAGAGGTTTTACA GCATCAAAACTCTGCATAACTCGCAAAAGAGAATTATTTGCTAATTTGAT GTGTAAAGACCATTCTTCGTCTTAGTGTTAAAACATCAAATGCGTTTTAT AATTGTAATCGAAAAAAAAAATGAATTGAAATGATGTTTTAACGCGTTAG ACTACTGACTTTTGATGACAACTTTTTCATGACTGATCAATTCATTCCAT TCAATTCAAATCTTGTATTGACTTTTTCTTTGGGACTGGAGTTGAATTTA ACTCAAATCTGAGGGGGGGGCCTTGTTTTTATTGCCTCTGGGAATTACTT CTTTCGAACTGGAGTTGAACTGAGCTGAAATGATGTTTTAACGCGTTAGA CTACTGAAAATTGACGACAATTTATCCTAACTGATCAGTTCACGGCATTT AGCTTTTCTTAAATTCTGACAGCTTTGTGTGAGCTCTTTACAAATAGTTG TTGGAGTACAGAAACATGTTTACTTATGACCTGACTGAATGTGCGTTCGT TTCCTCTATTTCACTTTCCCATCTGAAAAGATCAAAGTGATGTTCAAATG CGTCAGGTTTAGATGGACATTTTTTGCAACAAGTTGAATTGAAATGATGC TTTAACGCGTTAGACTACTGACTTTTGATGATAATTTATCCTAACTGATT AATTCATTCTTGTAAAATTAATTGGGGCTTATTAACTGGGACTGATTTTT TTCAGGAATTTACTTCTTTCCGCTTTGATTAACTTGAACTGAAATGATGT TTCAACGCGTTAGACTACTGAATATTGGCGACAATTTATCCTAACTGATC AGTTCATGCATTTAGCTTTTCTTAGATTCTTACAGTTTTGTGTGAGCTCT TTACAAATAGTTTTTAGAGTATAGAGATATGTTTCTAATTTGATGTTCGC TTCCTCTATTCACTTTCCCATGTAACAAAGATCAAAATTATGTTAAATGC GGCAGGTTTGGGTGGACATTTATTGCGCTTGACAAGCTGAATTGAAATGA TGCTTTAACGCGTTAGACTACTGACTTTTGATGACAATTTTTTCATGACT GATTAATTCATTCTTGTAAAATTAATTTGGGCTCATTAACTGGGACTGAT TTTTTTCAGGAATTTACTTCTTTCTGCTTTGTTGATTAACTTAGCTGAAA TGATGTTTCAACGCGTTAGACTACTGAAAATTGACGACAATTTATCCTAA CTGATCAGTTCACGGCATTTAGCTTTTCTTAAATTTTGACAGGATTGTGT GAGCTCTTTACAAATAATTTCTAGAGTATAGAGATATGTCCTAATTTGAT GTATCTGCGTTCGGTTCTTCTATTCACTTTCCATGTAACAAAGATCAAAA TTAATTCAAATGCGGCAGGTTTGGGTGGACATTTTTTGTGGCAAGCTGAA TTAAAATGATGTTTTAACGCGTTAGACTACTGACTTTTGATGATAATTTA TCCTAACTGATCAATTCATTCTTGTAAAATTAATTGGGGCTTATTAACTG GGACTGATTTTTTCAGGAATTTACTACTTTCCGATTTGATTAACTTGAAC TGAAATGATGTTTTAACGCGTTAGACTACTGAATATTGACGACAATTTAT CCTAACTGATCAGTTCATGCATTAAGCTTCTCGTAAATTTTGACAGCTTT GTGTGAGCTCTTTAAAAATAGTTGTTGAAGTACGGGAATATGTTTTCTAA CTAGTAGTACCTGCGTTCGTTTACTTTATTTCACTTCCCTATGTAAGAAA GATCAAAGCGATGTTCAAATGTGTTAGGTTTCGATGGACATTCTTTGCAA GCTGAATTGAAGTAATGCTTTAACGTTAACGCGTTAGACTTACCAAGTTC TGATGAAAACCTTTTATGATGCTTTAACGCGTTATACTATTGACTGATGA AAACCTTTTATGATGCTTTAACGCGTTAGACTATTGACTGATCAAAACGT TTTATATTGTACTGATCAATTCATTGTTGTAAAATTAAAACTTTAGCTTA ATAGCTCATTATTAAGCATTAGGCTACACTCTTAAAAATGCTTTTGAATA AAAGGGCTGCCTAGAAGCGCACTGCTTATTTCGGGACCTAATATATGCTT AAAGCTAAAACATCATCACTGGGAATGTAGGGGGTTGTATATTTCTGTTT TATTGTTTGTATCAATTTTCTAATATTTTTTAAAGCTTGGAAAAAATTCA AATCTTGGAAGGGGCTGCGGCTCTTTTTTGCCTGGGACTTGGCTTGGCTT TTCTTTCGCACCGGAGTAGAACTGAGCTTAAATGATGCTTTAACGCGTTA GACTACTGAATGTTGATGACAACTTTTTCATGACTGATCAGTTCACGACA TTTAGCTTTTCTTTAAACAATGTGCATGCGGTTTTTACACTTTTCATTTT CTCCTTTTTCTTTCCTTCAGCAAAACAAGTACAAAGCAACAATCCGGACA CGAGGTGGCCACAACCTAACGACTTGAACATGAGGTTGAGAAGGATGTTT ACTTCGTTCTTGCGCTTCACTGATAAAGAACAACTCGACATTTTGAAAGC TGAAAAGGTTGGTTTCTCATTATTTTGGGTAATGTTGGGAAATGAGACAC TTTTGCTAGGGGGTCTGTGTAGATCAATACTCTGCCATATGCCTCTAGTG CTAATGTTAACTCGGTTCACTTCAGTCCCATGAAAATGCTTTCATAAATA TCAAACCTGTTTTGATATTTCAAAATTTTCGTGGAAAACTATATGCTTTG GGAATAAGCCATTTTGTTCAAATTCTATGAACAGAGCGGAAGAGACATTG CTACATAGAAAATTAAATAAAATTTTACACTTTTGAGATCTTGCCATGAG AATTATTGATAAAAATTCAAGCCTTAAATGTTTTGATATTTCAACATTTC CGTGGAAAACTATATGCTTTGGGAATAAGCCATTTTGTTCAAATTCTATG AACAGAGCGGAAGAGACATTGCTACATGGAAAATTAAATAAAATTTTACA CTTTTGAGATCTCGCCATGAGAATTCTTGATAGAAATTCAAGTCTTAAAT GTTTTGATATTTCAACATTTCCGTGGAAAACTATATGCTTTGGGAATAAG CCATTTTGTTCAAATTCTATGAACAGAGCGGAAGAGACATTGCTACATGG AAAATTTAATAAAATTTTACACTTTCGAGATCTCGCCACGAGAATTCTTG ATAGAAATTCAAGTCTTAAATGTTTTGATATTTCAAAATTGTCGCGGAAA ACTATATGCTTTGGGAATAAGCCATTTTGTTCAAATTCTATGAACAGAGC GGAAGAGACATTGCTACATGGAAAATTTAATAAAATTTTACACTTTCGAG ATCTCGCCACGAGAATTCTTGATAGAAATTCAAGTCTTAAATGTTTTGAT ATTTCAAAATTGTCGCGGAAAACTATATGCTTTGGGAATAAGCCATTTTG TTCAAATTCTATGAACAGAGCGGAAGAGACATTGCTACATGGAAAATTTA ATAAAATTTTACACTTTTGAGATCTTGCCACGAGAATTCTAGATAAAAAC TCAAGCCTTAAATGTTTTGATATTTCAAAATTCTCGTGGAAAACTATATG CTTTGGGAATAAGCCATTTTGTTCAAATTCTATGAACAGAGCGGAAGAGA CATTGCTACATTGAAAATTTAATAAAACTTTACACTTTTGAGATCTTGCC ACGAGAATTCTAGATAAAAACTCAAGCCTTAAATGTTTTGATATTTCAAA ATTCCCGTGGAAAACTATATGCTTTGGGAATAAGCCATTTTGTTCAAATT CTATGAACAGAGCGGAAGAGACATTGCTACATGGAAAATTTAATAAAATT TTACACTTTTGAGATCTTGCCACGAGAATTCTAGATAAAAACTCAAGCCT TAAATGTTTTGATATTTCAAAATTCCCGTGGAAAACTATATGCTTTGGGA ATAAGCCATTTTGTTCAAATTCTATGAACAGAGCGGAAGAGACATTGCTA CATTGAAAATAAATTGTCGCGGAAAACTATATGCTTTGGGAATAAGCCAT TTTGTTCAAATTCTATGAACAGAGCGGAACAGACATTGCTACATGGAAAA TTTAATAAAATTTTACACTTTTGAGATCTTGCCATGAGAATTCTTGATAA TAATTCAAGCCTTAAATGTTTTGGTATTTCAAAATTCTCGTGGAAAACTA TATGCTTTGGGAATAAGCCATTTTGTTCAAATTCTATGAACAGAGCGGAA GAGACATTGCTACATGGAAAATTTAATTAAATTTTACACTTTTGAGATCC TGCCATGAGAATTCTTGATAGAAATTCAAGTCTTAAATGTTTTGATATTT CAAAATTGTCGTGGAAAACTCTATGCTTTGGAAATAAGCCATTTTGTTCA AATTCTATGAACAGAGCGGAAGAGACATTGCTACATGGAAAATTTAATAA AATTTTACACTTTTGAGATCTTGCCATGAGAATTCTTGATAGAAATTCAA GCCTTAAATGTTTTGATATTTCAACATTTCCGTGGAAAACTATATGCTTT GGGAATAAGCCATTTTGTTCAAATTCTATGAACAGAGCGGAAGAGACATT GCTACATGGAAAATTTAATAAAATTTTACACNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAAAAATTCAAGCC TTAAATGTTTTGATATTTCAACATTTCCGTGGAAAACTATATGCTTTGGG AATAAGCCATTTTGTTCAAATTCTATGAACAGAGCGGAAAAGACAATGCT ACATGGATAAACTCTTTACAATTTTTCTTTATATTTTTTTCATGGTTATT AGAAATTTTTGTTAAGAAATGTCCTCATGAAATATAGGCCAAGGGTGATA TTATTAGGCGCTTCTCCTGTGTAACGAAGGAACGGATGGAAAATGTACAG GAGAACATGAAGAGTTTTTTTGTTTTCATAGGACAAGCAGAAGCAAGTCC GGTTAGCGAACATGGTGCAGGAACGGCAACGAAAACGTGCGGAGATGCAG CAACGATGGACGAGAAGGGAAGAGAGCGATTTCTACAAAGTTCTCACTAA CTTCGGTGTTATTCAAAACCCTGAAACGAAAGAATACGANCGATTTCTAC AAAGTTCTCAGTAACTTCGGTGTTATTCAAAACCCTGAAACGAAAGAATA CGACTGGCAGAAGTTCAGGTGAGAACATAATGATTCTGATTTTCCGAACC TTCTGTTATCAATACACTCATTATTATCTACACTTAGTCTTGATTAACGT CCTCTAAGTCGGTTGTGCGGCGCTTACACACAATATTTTTGGACCTACCT CCGGGTACCCCGGTGGAGGTTCTATAAATTAACCCATGTCCGTCCGTTCG TTCGTCCGTCCGTCCGTCTGTTACCAGCTTTTCTNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNTGCCCATGACCATTTTACAATATTCAA CACACAAGCTTTATTTTTCCATTCTGAATTTTTGTACAATTATTGTCACT TTTTTCTTATTTTCATCTGATGCTAATCATTAGGTAAGTCCATTCAGCAT GTTGCTTGTTTTAAATAAACTTACTGATTTTGAGCTTTTCCCCATATTGA GTATAATTAACTTTTTTTTCAGACAACTTGCAAAATTGGACAAGAAATTG GACGAAACGTTGACACATTATTACGAAGATTTCATAGCTATGTGCAGGAG GATATGTGGACGGGCCACCGAGAACGACGAGAAAAGGCTAAAAGGTTGGT CACGAAAAATTTTCTCCTTTCCTGATCAATCACATACAGTTGACTATCTC TAATTCGATCTTCAAGTGACCAAGGATTTCTTCGAATTAGAGAAAGATTC GAATGGCAGAAAGCATTCTATACTAATTTCTAGCTGACGGGACCAATATT TTAGTTCGTATTAGAGAAAGATTCGAATAGTAGAGACTCGAATTTGAGAA AGTTGCATGTACCTCTTTAGAAAATTTTTGGTTCAACTACAATAGCACGA AGATTTCTGTTCACTAGTCAGGCAGATTACACAATTTTTGACACGCGTTG TAAGTTTTGACAAACCTTAAATTTTCTAACCTTTCAGGATGTCAAATTGA AGAGATATCAGAAGACAAAGCAAGTCGGTGTCTTCAGCGTGTGAAACTAT TGAACAAGATTCGCACTCAGGTCTTACCACACGAAAAGTTGGGAGAACGT TTGGCTCTGTGCATCAAGTCATATGATCTCCCTCACTGGTGGAAGTCTGT CAAACACGACAAAGCTCTCCTCCAGGGTGTTGCCAAGTAAGTTTTATTAT CTATAGTTTCATTATCCCCTTCGAAGAAAAAAAAGATATTTTCTAGAGAA TCCATACAAACCAAAAAAAATGATATTTGCCGCTCATCTATCCCGGAATA AAACAGCTGCGATGAGGGCTGCGAACTCCGGTAATTGTCATTCTTGAATA GCGAACTATTATGCAAACATCTTTATCGTGGTCAGCCTTTCTTAATATAT CTAACATAAAATTTAAAAGAGTATATCCTATTAAGTGCGAGCGCAAACGC AAACCAAATCGGGAAATCAAACCGGAAAGATCGGGAAATCGAACCCGACT ATCGCAATTTATCGGATTTACGCACAATTACAAATGAAAAACACTGATTT TAAGAAACTCCTTAACAGGACTTTAATTAGCCTGCCATTTTTTAGTGCGT CAGAGTGTGAATTGAAAAACGGTCAATTTTTTTTAGACATGGTCTCGGGA GAACGGAATATCAAGTCCTCCTCGACCCAGACTCCATCTTCAAAGAGATG GTCGACAAGATTGGAACACTGAAGAAAGGTATTTTCCATTTTGTTTTTGT GATTCCTTGGTCAGACTTAATCGTTCCACCCGCTTATGTTCGAGTTAAAA TTTCTCTCGGCTAAGGTTCCTTCGATATTCCAAAAGAAAAGAGAAATTGA TTAGCTAATGAAACTTCCTTATGTCTTGTTCTAATGCTATTCACCTTCAA TCACCTTCACATTGCAGAATCAGCAGACGACAACAAACCGACACTTCATG CTCAAATGAACGGTGAACATCCTGAAAAGAAACCGAAAGACGAAGCACAA CTCAATAATGACATCAAAACGGAGAACAAAATCCCCATGCATACCAACGA ATATGCTCAACTTCTTTCTTCCTGGCCCAAGGTAAGCGACGTCTATTTAG TAAGCGATAGATTCCGAATTCAGGGTTTTTCTGTACTATCTTCTGTATTA TCTTTTCGGTAATATTTCTAATTACAATCTTTCCACTACTCAATGTTGAA TAAAATGGCTTTCAATGGATTATTCTCATGTTTTAGGACAAAGGAATCGT GTCCCACCTTGAGAAAGTTTGCACTTGTGTTTTGAAAGGAGAATGGCCTA AAATGCCCAAGATCGAAATCCAACCGATGGCTGCGAAACTTCCGAGTTAC TCTCGACCACTTATTAGTACAGTTGGCCACACCACCAGTGCCGAACTGAC TGATGAAAAACATTCACGTGGCAACTGTACACCTAATCGTGATTTCAAAA TCAAAAGCATCGACGGGTTGAAATTGACCGTGAAGACAGACCCTAAAGGA GACATTTTGAAGAGGAAAAAACGTGGCGATCCGATCGATTTCTTTCCTGA TGATGATCGAAAAGTTCGCATCGATTCCATCAAGTTCATTAAGAAGCCGC GCGTCGAGCGAGGAGTAGAGATGGAAGATTCTCGTAATGTTCAGGTGAGC TTTCATCGTAATTATCTCTTTTGTTGTATCAAACACCGATTTGGATGGAT ATTTCTTACTGAATGTTAACCCATGCATTTATTCGTTGCTCTCAATTTTT CTTCCAAAGATAAAATCAAGCAATGATTTATTTTTGCAGATAATTTTAAC CTCACCCTAACCNTTCCTGGCCCAAGGTAAGCGACGTCTATTTAGTAAGC GATAGATTCCGAATTCAGGGTTTTTCTGTACTATCTTCTGTATTATCTTT TCGGTAATATTTCTAATTACAATCTTTCCACTACTCAATGTTGAATAAAA TGGCTTTCAATGGATTATTCTCATGTTTTAGGACAAAGGAATCGTGTCCC ACCTTGAGAAGGTTTGCACTTGTGTTTTGAAAGGAGAATGGCCTAAAATG CCCAAGATCGAAATCCAACCGATGGCTGCGAAACTTCCGAGTTACTCTCG ATCACTTATTAGTACGGTTGGCCACACCACCAGTGCCGAACTGACTGATG AAAAACATTCACGTGGCAACTGTACACCTAATCGTGACTTCAAAATCAAA AGCATCGACGGGTTGAAATTGACCGTGAAGACAGACCCTAAAGGAGACAT TTTGAAGAGGAAAAAACGTGGCGATCCGATCGATTTCTTTCCTGATGATG ATCGAAAAGTTCGCATCGATTCCATCAAGTTCATTAAGAAGCCGCGCGTC GAGCGAGGAGTAGAGATGGAAGATTCTCGTAATGTTCAGGTGAGCTTTCA TCGTAATTATCTCTTTTGTTGTATCAAACACCGATTTGGATGGATATTTC TTACTGAATGTTAACCCATGCATTTATTCGTTGCTCTCAATTTTTCTTCC AAAGATAAAATCAAGCAATGATTTATTTTTGCAGATAATTTTAACCTCAC CCTAACCCGATCTTTTTTTTCCAGATTCACATTCCGAGTTCACCGTCCAC CACGAAACCGTCTTCGCCTTCATCGAGACTCGACAAAAAGCCCATCATTC ATTTTCCTTCCAACGTCAAAGTTCCCAAAGTCTCTTCCATCGTTACTACT GGCTCCACCAGGTCGCGGTCATTGACCAACACCGACCACAAACCTACCAT TGTCAAAGTGCTTAGTGGGAAACCCACACGAACGAGACGACATGACTCTG ATGCTTACTCCCCTGTCAACAAATCAGCTCCACTTCCGTCCACCGCGAGC TCAGATCCAACAGTCGGTATACATATTGATAGTCCGAACTCCAATGTACG TATACAAGGTTCGAAGATTGAAGTGAAAGAGAAATCGAGTACGAAGCGCG ATCTATCTGAAGTGATTCTCAAAGTACCTGATCCTTCACGCTTCATGAAG TCACCACAAAACTCTGATTCCAGGAAATCTCGATCAACGAAAGTCGTGAA AACTTCCAAGCCTCCTCCGTTGACGCCTGACAAACATTCACCGACCACTC AATCAAAGGTATGCGAACATAAGAAAGATGCTTCCAAAGACAAACCAGTT GAAGAAGCCCCTACATTGCGTCGTCGCCCTGAACGGTCTGCCAAGAAGCG GGCCAAAGATTCAATCTCAGAGATGAGTGAAGCTGAACGGCCGCTTGGTA AAGATGATTTGCACGAGCGGTTGATGGCGCCCCTCTCACCTTCTCCACGC CACAGTTGGCGCGATATGAGGTCACCACCGCCTCATGTGTTACACCGCAG AGGGGGAGATATGTACATGGACTACTACCCTGATCGAAGCCCACCACGTG GTCGCTCTCCAGAACATCTCCGACGCGGACACCACTCTCCTGGACCCTTC CCCCGTCCTGGAAGTCCAGATCGTCGTTCGCCTCCGCCCATTCATCACCA CCATCGACCGGTGTCTCCTCCCACCAGACACAGACACACCCACTCACCAC CGCCACCACCAGTAGGCAGACACCCACACAACCACAGTCCTCACTACCGC GACCACGAAGATCATCACAAACATTTCCACTACAACGAACCGCTTTCGCC ACGTTTTCGAGGTGGCGCTCCACATGAACCATACTTCTATCCTGAACGAT CGCGCTCTCCTTACTTCTACGATTACCGTCACGAAAAAGAACGTTTGTAC GACGAATTGGAGAGACGATCCCCGCCTATTAAACACCGCCGTCTTTCACC TACCAGAGATCTTTACTCGCCTGCGCATAAACATGACTATATACACATCC CAACAGATTCGCATTCTCCACGTCATCTTGATCGACACTCTCCACACGAA GGTCGATTCCCATATGGTCGAGTTGATTGGGACAGTCCGCGGTTCCGTCA CGAGGGTCTCCATTCACCTCCGATACGTTCTTCTCCCGTCGACGCCCCTG TTCAATACCAGCCATTATCACGAAGTATGCCGCCCAGAGATGAAGCCAAG AAACCGATCATCAAGTCTCCCAGAGTTCACGAAGAGCACAGATTGAGGCG GTCGCGCTCTCCTGTTTCTTTCCCAGATAGGCAAGAAAAAAGACGTGTGC AAGACGAACCAACTCTCAAACGTAGCGCGGAAACGATCCCTGTTGCGAAT GAATTATCATCACCCTCCAAAGCCAAGAAATCGAAACCAGCAGAAGTTGA ACGACCAGTCATCGAAATCTCAACCGAAGCAGTACGACAAAACTCTCAGC AGCAACAACAACGCAAACAGCCAGCTCGCAAGAAGGGATTGGGGTTACTG GAGATGAAAATCCAAGGGCTGAAAGAGAAAATGGAACAGTCCGGTGTGTC CGACAAAATCAAAGAGAAAATGAATTCCCAACCAGAATCAACGGAAAAGA AGGAACCTTCGAAAGCCATGGAGACATCCCCCGCTCCCCCCATTACCAAA CCAACAAAGAGGCTTTCAGACGTCATCTCTAACTTAACACAGGAGAAAGG AATGAAGGAACCGGTTTCTAAGCCACCTGGTAAACGTTCCAAGTCTCTTG CAGACATCACTAAAGATCTTGCTAAATCTGTCGAGAAAAGTAGCGTTCTC GATTCGTCACTTGCTGTATCTTTCTCAAAGAACAAGCCCACCGTAAATTC AGTGTCATTCAACAAACCATCTAAACCTGTGACCAGTTCCAGCAAGCTCT CTGACGTCATTTCCACTTTAAAAGAAAAATCGAAGGCTGCCTCTGCTCAA TTACCGACATCCAAATTCAAAGGTGTTCCCTTAACTGTGAAACCATCAAA CGATTCCAAACTGCTAAATATTTTAAAAAGTGGAAATGCCGATAAAAGTC CAAGGGCATTGCAAAAGAAAGACTCACCTGAAGAAACGCCCACTAGTCCA CCGCCTCGGAGAGCGTCAGTTATCTCTTCAGTTATTTGCTCAACCATCAA ATCGCCTGTTGAAAAGAATGCTGAAGGTCATCCACCAGAACTCCAATCAG TATTAAAGTCTCCGCCGTTGGAAAGAATGAAATCGCCTTTGGAAAGACCG AACTCGCGTTCAGAGAGGATTCGATCTCCGCCCTCAGACAGATTGACTTC ATCACGTCAAACACGAAGATCATCCACTGCCGACAGACCTTTCTCGCCAT CTGATAGGCTACTTTCGCCAACTTCAGGAATACTTCACTCTCAATACGAT CAGCTACCAGAGTCACGTCCAAAAGACCGTTATCCACCAAGAGATGCATC TCCATCTGCAAGAGATTTCCTACCTTATGACACTTATCGCTCATTTAAAA GCTCGTCATCTGAAAGAATCGTTTCGCCGCGCGACCACCCAATCGAGAGA ATAGTTTCGCCGCGCGACCACTCAACTGAACGGCTCTTCTCGCCACGATC ATCGAGAAATTCTGAACGAATTACGTCACCTCGCGGACCTTCACCGTTAG ACTTGACCCCTTCACCACGATCGTCAAGGAAACCTTCACTCGATGTCCCT GCAAGAGATCCGTCACCTCGATCATCCGGTCGGCAATCGTCTTCCATTTC TCCACGGGAACCTGTCATCCACTCACCAGACAACAGACCACCTCACTCAT TGAGACTTCTCTCACCTTCACAATCAGAGAGACTGACCTCACCACCACCC TTGACCAGGGTCACTCCTCCATTGGAGAAACTTTCATCTCCAAGATCGAA ACACTCATCACCGTTGATTGATCGAAGACCGTCTCCGTTGGAGAGTGTTA TTTCACAAAACATAAGTAGAATGAAATCACCAACCGACCGAACGTCTTCC CCTTCTTCGAGAGCTAAATCGCCTATTCCGAGGGAAGCACCGCCACTCGA CCGCATAAAATCCCCAAAGAATCATCCAACTCCACCTTCGAGAATCGTAT CTCCACCCGCGAGAGAGTTTGCTTCTCCTGGAATCACTTCACCAGTCCTC CGCATGAAATCACCACGACCAATGNCGCGAGAGAGTTTGCTTCTCCTGGA CATGGAATCACTTCGCCAGTCCTCCGCATGAAATCACCACGACCAATGGA AGGCCCCCCTCCTCTTGACCGAGTTGTCTCGCCAAACTCCGAAAGACTCG GATCAACACCTTATGAACACGCGAATCTTTCTAAGGATCGAATCAAATCA CCTGTGGACAGGCTTTCGCTAAGTGAACCACGCTCTTCACCGATAGCGGA CCGTGTAATGTCACCACGAATCAAGTCTGCCAGCGTCATTTCTTCAACAG GGAGCAAGACTTCGGAACGCCTTCTTTCGCCCACTAACAACAGACGAACG CCCAACATCACCTCACCGCCACCCTTCTCGCGCGCTGAGAACGATATTCA ATCAAAGCATTCTCCCAGTAACCGTGGAACACCTGGAGATGAGAGACTGA TGGGTGAACGATTCCAATCGCCGATCAGTAGTCCGGTATATTCACCGGCC GTTGTGAGCAACCCTTTAACAATCGACTTGGAAAAGAAGAAGATCTCTTC AGGGCGTGAAAGCGCCACCCTGCAAGTTATAACGCCTACACGAACACCCA CTCCAATTAAGTCGCCTCTCACACAAACATTACAGGTTGTCACTTCGCCA CGTCATGAGAATTCAATGTCGCCCTCTTTTCCCGCCTCACCGCCCCAATT AGTCGATAAGGCGGTTTTGTCCTCGCAATTGACAAGGCCTACGGCGATTG TTGCCACGACAACAGCGAATAATGAATCGGTCGATCACGTGACTAAAACA GACGGAAAAGCATCATCTTAATTGGTTTTTGGAGATGAAAATTTTGGGGT TTTTTTGAAAAGTGGCATTGTGTCACGCACGATATTTTTATGCTATTTTT TCTACATTTTTAGTTCTGTATATTTTGATTGATTTTATTATTAGATAATT TTGCTTTTTTCTATAGTATCACGTAGTATCATATGCCTTTTCCTCTGCCG TGCTTTTCCTTGCAATGAACTTGATCATTTCGTCGTGTTGAATTGCTGAT GTCAAGTCCGTATTAAATTACCAAATTATAGGAACTCTTTCTCTCAGTTT CTCTTTGAGTAATCTACCCTACATCATTTTTAGCAAAATTATTATTAAAG AAATTTTTGGCATAAATGTAATTTTTTTATTTTTGTCTTTTAAATATCAT ATTTAAAAAATTGACAATGAAACATTTATACGATAT
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_045843XLOC_045843Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073812-exon-scaffold_98-1575043694:51819..52124TCONS_00073812-exon-scaffold_98-1575043694:51819..52124Clytia hemisphaericaexon
TCONS_00073812-exon-scaffold_98-1575043694:51531..51592TCONS_00073812-exon-scaffold_98-1575043694:51531..51592Clytia hemisphaericaexon
TCONS_00073812-exon-scaffold_98-1575043694:51209..51329TCONS_00073812-exon-scaffold_98-1575043694:51209..51329Clytia hemisphaericaexon
TCONS_00073812-exon-scaffold_98-1575043694:50841..50927TCONS_00073812-exon-scaffold_98-1575043694:50841..50927Clytia hemisphaericaexon
TCONS_00073812-exon-scaffold_98-1575043694:50635..50700TCONS_00073812-exon-scaffold_98-1575043694:50635..50700Clytia hemisphaericaexon
TCONS_00073812-exon-scaffold_98-1575043694:50029..50100TCONS_00073812-exon-scaffold_98-1575043694:50029..50100Clytia hemisphaericaexon
TCONS_00073812-exon-scaffold_98-1575043694:49490..49617TCONS_00073812-exon-scaffold_98-1575043694:49490..49617Clytia hemisphaericaexon
TCONS_00073812-exon-scaffold_98-1575043694:48810..48885TCONS_00073812-exon-scaffold_98-1575043694:48810..48885Clytia hemisphaericaexon
TCONS_00073812-exon-scaffold_98-1575043694:47828..47995TCONS_00073812-exon-scaffold_98-1575043694:47828..47995Clytia hemisphaericaexon
TCONS_00073812-exon-scaffold_98-1575043694:47505..47568TCONS_00073812-exon-scaffold_98-1575043694:47505..47568Clytia hemisphaericaexon
TCONS_00073812-exon-scaffold_98-1575043694:47079..47353TCONS_00073812-exon-scaffold_98-1575043694:47079..47353Clytia hemisphaericaexon
TCONS_00073812-exon-scaffold_98-1575043694:44313..45299TCONS_00073812-exon-scaffold_98-1575043694:44313..45299Clytia hemisphaericaexon
TCONS_00073812-exon-scaffold_98-1575043694:43894..44001TCONS_00073812-exon-scaffold_98-1575043694:43894..44001Clytia hemisphaericaexon
TCONS_00073812-exon-scaffold_98-1575043694:43428..43642TCONS_00073812-exon-scaffold_98-1575043694:43428..43642Clytia hemisphaericaexon
TCONS_00073812-exon-scaffold_98-1575043694:42265..42878TCONS_00073812-exon-scaffold_98-1575043694:42265..42878Clytia hemisphaericaexon
TCONS_00073812-exon-scaffold_98-1575043694:41940..42069TCONS_00073812-exon-scaffold_98-1575043694:41940..42069Clytia hemisphaericaexon
TCONS_00073812-exon-scaffold_98-1575043694:41263..41465TCONS_00073812-exon-scaffold_98-1575043694:41263..41465Clytia hemisphaericaexon
TCONS_00073812-exon-scaffold_98-1575043694:38568..38704TCONS_00073812-exon-scaffold_98-1575043694:38568..38704Clytia hemisphaericaexon
TCONS_00073812-exon-scaffold_98-1575043694:35807..36043TCONS_00073812-exon-scaffold_98-1575043694:35807..36043Clytia hemisphaericaexon
TCONS_00073812-exon-scaffold_98-1575043694:34581..34702TCONS_00073812-exon-scaffold_98-1575043694:34581..34702Clytia hemisphaericaexon
TCONS_00073812-exon-scaffold_98-1575043694:34039..34237TCONS_00073812-exon-scaffold_98-1575043694:34039..34237Clytia hemisphaericaexon
TCONS_00073812-exon-scaffold_98-1575043694:33497..33588TCONS_00073812-exon-scaffold_98-1575043694:33497..33588Clytia hemisphaericaexon
TCONS_00073812-exon-scaffold_98-1575043694:33144..33307TCONS_00073812-exon-scaffold_98-1575043694:33144..33307Clytia hemisphaericaexon
TCONS_00073812-exon-scaffold_98-1575043694:32959..32988TCONS_00073812-exon-scaffold_98-1575043694:32959..32988Clytia hemisphaericaexon
TCONS_00073812-exon-scaffold_98-1575043694:31836..32213TCONS_00073812-exon-scaffold_98-1575043694:31836..32213Clytia hemisphaericaexon
TCONS_00073812-exon-scaffold_98-1575043694:26989..31650TCONS_00073812-exon-scaffold_98-1575043694:26989..31650Clytia hemisphaericaexon
TCONS_00073812-exon-scaffold_98-1510915933:51819..52124TCONS_00073812-exon-scaffold_98-1510915933:51819..52124Clytia hemisphaericaexon
TCONS_00073812-exon-scaffold_98-1510915933:51531..51592TCONS_00073812-exon-scaffold_98-1510915933:51531..51592Clytia hemisphaericaexon
TCONS_00073812-exon-scaffold_98-1510915933:51209..51329TCONS_00073812-exon-scaffold_98-1510915933:51209..51329Clytia hemisphaericaexon
TCONS_00073812-exon-scaffold_98-1510915933:50841..50927TCONS_00073812-exon-scaffold_98-1510915933:50841..50927Clytia hemisphaericaexon
TCONS_00073812-exon-scaffold_98-1510915933:50635..50700TCONS_00073812-exon-scaffold_98-1510915933:50635..50700Clytia hemisphaericaexon
TCONS_00073812-exon-scaffold_98-1510915933:50029..50100TCONS_00073812-exon-scaffold_98-1510915933:50029..50100Clytia hemisphaericaexon
TCONS_00073812-exon-scaffold_98-1510915933:49490..49617TCONS_00073812-exon-scaffold_98-1510915933:49490..49617Clytia hemisphaericaexon
TCONS_00073812-exon-scaffold_98-1510915933:48810..48885TCONS_00073812-exon-scaffold_98-1510915933:48810..48885Clytia hemisphaericaexon
TCONS_00073812-exon-scaffold_98-1510915933:47828..47995TCONS_00073812-exon-scaffold_98-1510915933:47828..47995Clytia hemisphaericaexon
TCONS_00073812-exon-scaffold_98-1510915933:47505..47568TCONS_00073812-exon-scaffold_98-1510915933:47505..47568Clytia hemisphaericaexon
TCONS_00073812-exon-scaffold_98-1510915933:47079..47353TCONS_00073812-exon-scaffold_98-1510915933:47079..47353Clytia hemisphaericaexon
TCONS_00073812-exon-scaffold_98-1510915933:44313..45299TCONS_00073812-exon-scaffold_98-1510915933:44313..45299Clytia hemisphaericaexon
TCONS_00073812-exon-scaffold_98-1510915933:43894..44001TCONS_00073812-exon-scaffold_98-1510915933:43894..44001Clytia hemisphaericaexon
TCONS_00073812-exon-scaffold_98-1510915933:43428..43642TCONS_00073812-exon-scaffold_98-1510915933:43428..43642Clytia hemisphaericaexon
TCONS_00073812-exon-scaffold_98-1510915933:42265..42878TCONS_00073812-exon-scaffold_98-1510915933:42265..42878Clytia hemisphaericaexon
TCONS_00073812-exon-scaffold_98-1510915933:41940..42069TCONS_00073812-exon-scaffold_98-1510915933:41940..42069Clytia hemisphaericaexon
TCONS_00073812-exon-scaffold_98-1510915933:41263..41465TCONS_00073812-exon-scaffold_98-1510915933:41263..41465Clytia hemisphaericaexon
TCONS_00073812-exon-scaffold_98-1510915933:38568..38704TCONS_00073812-exon-scaffold_98-1510915933:38568..38704Clytia hemisphaericaexon
TCONS_00073812-exon-scaffold_98-1510915933:35807..36043TCONS_00073812-exon-scaffold_98-1510915933:35807..36043Clytia hemisphaericaexon
TCONS_00073812-exon-scaffold_98-1510915933:34581..34702TCONS_00073812-exon-scaffold_98-1510915933:34581..34702Clytia hemisphaericaexon
TCONS_00073812-exon-scaffold_98-1510915933:34039..34237TCONS_00073812-exon-scaffold_98-1510915933:34039..34237Clytia hemisphaericaexon
TCONS_00073812-exon-scaffold_98-1510915933:33497..33588TCONS_00073812-exon-scaffold_98-1510915933:33497..33588Clytia hemisphaericaexon
TCONS_00073812-exon-scaffold_98-1510915933:33144..33307TCONS_00073812-exon-scaffold_98-1510915933:33144..33307Clytia hemisphaericaexon
TCONS_00073812-exon-scaffold_98-1510915933:32959..32988TCONS_00073812-exon-scaffold_98-1510915933:32959..32988Clytia hemisphaericaexon
TCONS_00073812-exon-scaffold_98-1510915933:31836..32213TCONS_00073812-exon-scaffold_98-1510915933:31836..32213Clytia hemisphaericaexon
TCONS_00073812-exon-scaffold_98-1510915933:26989..31650TCONS_00073812-exon-scaffold_98-1510915933:26989..31650Clytia hemisphaericaexon
TCONS_00073812-exon-scaffold_98-1491911889:51819..52124TCONS_00073812-exon-scaffold_98-1491911889:51819..52124Clytia hemisphaericaexon
TCONS_00073812-exon-scaffold_98-1491911889:51531..51592TCONS_00073812-exon-scaffold_98-1491911889:51531..51592Clytia hemisphaericaexon
TCONS_00073812-exon-scaffold_98-1491911889:51209..51329TCONS_00073812-exon-scaffold_98-1491911889:51209..51329Clytia hemisphaericaexon
TCONS_00073812-exon-scaffold_98-1491911889:50841..50927TCONS_00073812-exon-scaffold_98-1491911889:50841..50927Clytia hemisphaericaexon
TCONS_00073812-exon-scaffold_98-1491911889:50635..50700TCONS_00073812-exon-scaffold_98-1491911889:50635..50700Clytia hemisphaericaexon
TCONS_00073812-exon-scaffold_98-1491911889:50029..50100TCONS_00073812-exon-scaffold_98-1491911889:50029..50100Clytia hemisphaericaexon
TCONS_00073812-exon-scaffold_98-1491911889:49490..49617TCONS_00073812-exon-scaffold_98-1491911889:49490..49617Clytia hemisphaericaexon
TCONS_00073812-exon-scaffold_98-1491911889:48810..48885TCONS_00073812-exon-scaffold_98-1491911889:48810..48885Clytia hemisphaericaexon
TCONS_00073812-exon-scaffold_98-1491911889:47828..47995TCONS_00073812-exon-scaffold_98-1491911889:47828..47995Clytia hemisphaericaexon
TCONS_00073812-exon-scaffold_98-1491911889:47505..47568TCONS_00073812-exon-scaffold_98-1491911889:47505..47568Clytia hemisphaericaexon
TCONS_00073812-exon-scaffold_98-1491911889:47079..47353TCONS_00073812-exon-scaffold_98-1491911889:47079..47353Clytia hemisphaericaexon
TCONS_00073812-exon-scaffold_98-1491911889:44313..45299TCONS_00073812-exon-scaffold_98-1491911889:44313..45299Clytia hemisphaericaexon
TCONS_00073812-exon-scaffold_98-1491911889:43894..44001TCONS_00073812-exon-scaffold_98-1491911889:43894..44001Clytia hemisphaericaexon
TCONS_00073812-exon-scaffold_98-1491911889:43428..43642TCONS_00073812-exon-scaffold_98-1491911889:43428..43642Clytia hemisphaericaexon
TCONS_00073812-exon-scaffold_98-1491911889:42265..42878TCONS_00073812-exon-scaffold_98-1491911889:42265..42878Clytia hemisphaericaexon
TCONS_00073812-exon-scaffold_98-1491911889:41940..42069TCONS_00073812-exon-scaffold_98-1491911889:41940..42069Clytia hemisphaericaexon
TCONS_00073812-exon-scaffold_98-1491911889:41263..41465TCONS_00073812-exon-scaffold_98-1491911889:41263..41465Clytia hemisphaericaexon
TCONS_00073812-exon-scaffold_98-1491911889:38568..38704TCONS_00073812-exon-scaffold_98-1491911889:38568..38704Clytia hemisphaericaexon
TCONS_00073812-exon-scaffold_98-1491911889:35807..36043TCONS_00073812-exon-scaffold_98-1491911889:35807..36043Clytia hemisphaericaexon
TCONS_00073812-exon-scaffold_98-1491911889:34581..34702TCONS_00073812-exon-scaffold_98-1491911889:34581..34702Clytia hemisphaericaexon
TCONS_00073812-exon-scaffold_98-1491911889:34039..34237TCONS_00073812-exon-scaffold_98-1491911889:34039..34237Clytia hemisphaericaexon
TCONS_00073812-exon-scaffold_98-1491911889:33497..33588TCONS_00073812-exon-scaffold_98-1491911889:33497..33588Clytia hemisphaericaexon
TCONS_00073812-exon-scaffold_98-1491911889:33144..33307TCONS_00073812-exon-scaffold_98-1491911889:33144..33307Clytia hemisphaericaexon
TCONS_00073812-exon-scaffold_98-1491911889:32959..32988TCONS_00073812-exon-scaffold_98-1491911889:32959..32988Clytia hemisphaericaexon
TCONS_00073812-exon-scaffold_98-1491911889:31836..32213TCONS_00073812-exon-scaffold_98-1491911889:31836..32213Clytia hemisphaericaexon
TCONS_00073812-exon-scaffold_98-1491911889:26989..31650TCONS_00073812-exon-scaffold_98-1491911889:26989..31650Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_98supercontigscaffold_98:26989..52124 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0 5.08515e-11 0 0 0 0 0 0 0 0 0 6.12818e-11 0 0 0 0 0 0 0 0 4.70104e-09 6.76851e-11 0 0 0 0 1.21473e-09 0.040276 0 5.11507e-09
Blast
BLAST of TCONS_00073812 vs. Swiss-Prot (Human)
Match: CHD9 (Chromodomain-helicase-DNA-binding protein 9 OS=Homo sapiens GN=CHD9 PE=1 SV=2)

HSP 1 Score: 1164.06 bits (3010), Expect = 0.000e+0
Identity = 579/1037 (55.83%), Postives = 756/1037 (72.90%), Query Frame = 1
Query:  337 VEEYYVKYKGYSYLHCEWGTLEYLAKKDKRVPAKIKRYKQKRDSSYAYLNELDDEPFNPDYVEIDRVLDYTTTVDPVTNDTIDHYLVKWRGLPYEDSTWELKMNIDESVIQNFHEMKKPPPVEQRRFKPRPQEGDWVKELQSPMYKNGNRLHDYQLEGMNWLTFCWYKRINCILADEMGLGKTIQSISLLCAMKKYGIRGPFLVIAPLSTIGNWQREFETWTDINAIVYHGSAVSRNNIQQYEMYYKDEKGNSINDVYKFEAIITTYEIVLSANQFLCTIPFRCLIIDEAHRLKNQKCKLMEGLNNLKMEHRVLLTGTPLQNNVEELFSLLNFLEPTRFPSQGAFMFEFGNLKTEGQVEKLKQILKPMMLRRVKADVQTNIASKXXXXXXXXXXXXQKKFYRAILERNFSFLAKGSGYSNLPNLMNTMMELRKCCNHPFLIKGAREKISSDYSDPEQPDKQLTHLSGLIESSGKMVLIDKLLPKLKSGGHKILVFSQMIKVLDLIQEYLMEKQYQFERIDGGVQGNMRQAAIDRFCRPDSDRFVFLLCTRAGGLGINLTAADTVIIFDSDWNPQNDLQAQARCHRIGQEKPVKVYRLICRNTYEREMFDRASLKLGLDKAVLGNMNQKEAS--GQKAMSKKEVEDLLKKGAYGAVMENDEDASNFCEEDIDQILQRRTQVIQIEGEGKGSTFSKASFVSDKAGLDVDIDDPDFWKKWAQKASIKLEDLEQDKQLIMAEPRKRKQTKRFGNIDGDALEMSDLDSDDEVYEPNKSKSKSSQYIERT-AWTRVECFKVEKLLLIYGWDRWQDITSQVQFKQEVRNNDVEGISRTILAYCFRFYKTDEKSKDFFTNLIDESVKNAPPKNEKFDITDQILGSAPPPKNGRGRKRNATTNPGRNALRRLTHQYSKPALIECGLDWL-TVDPDTLIIDSSYRKHLQQHCHKIMSRIRLIHSLKHDIIKEASVDIFEGKPHEEIEFTVPPAEGGELPAVWWDEKADKSLLIGTYKHGYEKYQQIRNDPCLYFYHKIGPYQMDEKA 3435
             EE++VKYK YSYLHCEW T E L K DKR+  KIKR+K ++     +  ++++EPFNPDYVE+DRVL+ +   D  T + + +YLVKW  LPYEDSTWELK ++D + I+ F +++   P + RR   RP    W K  QS  YKNGN+L +YQLEG+NWL F WY R NCILADEMGLGKTIQSI+ L  +   GIRGPFL+IAPLSTI NW+REF TWTDIN +VYHGS +SR  IQQYEMY++D +G  I   Y+F+AIITT+E++L     L  I +RC+IIDEAHRLKN+ CKL+EGL  + +EH+VLLTGTPLQN VEELFSLL+FLEP RFPS+  FM EFG+LKTE QV+KL+ ILKPMMLRR+K DV+  +A KEETI+EVELT IQKK+YRAILE+NFSFL+KG+G +N+PNL+NTMMELRKCCNHP+LIKGA EKI  ++ D   P     HL  +I+S+GK+VLIDKLLPK+K+GGHK+L+FSQM++ LD++++YL+ K+Y +ERIDG V+GN+RQAAIDRF +PDSDRFVFLLCTRAGGLGINLTAADT IIFDSDWNPQNDLQAQARCHRIGQ K VKVYRL+ RN+YEREMFDRASLKLGLDKAVL +M+ +E++  G + +SKKE+EDLL++GAYGA+ME +++ S FCEEDIDQIL RRT+ I IE EG+GSTF+KASFV+     D+ +DDP+FW+KWA+KA I +E +     L++  PR RKQT+ F     +  E+S+ +S+ +       K K  +  +R+  + R ECF+VEK LL+YGW RW++I S  +FK+++  +DVE I R +LAYC   Y+ DEK K F  +LI  +        +  ++ + +  SAP P+  +G+K    T+                +      +WL   +P+ L+ D  Y+KH++ HC+K++ R+R+++ LK ++I      +F+G    +I+  VP  +  E+PA WWD  ADKSLLIG +KHGYEKY  IR DP L F  ++G  + DEKA
Sbjct:  713 TEEFFVKYKNYSYLHCEWATEEQLLK-DKRIQQKIKRFKLRQAQRAHFFADMEEEPFNPDYVEVDRVLEVSFCEDKDTGEPVIYYLVKWCSLPYEDSTWELKEDVDLAKIEEFEQLQASRP-DTRRLD-RPPSNIWKKIDQSRDYKNGNQLREYQLEGLNWLLFNWYNRRNCILADEMGLGKTIQSITFLYEILLTGIRGPFLIIAPLSTIANWEREFRTWTDINVVVYHGSLISRQMIQQYEMYFRDSQGRIIRGAYRFQAIITTFEMILGGCGELNAIEWRCVIIDEAHRLKNKNCKLLEGLKLMNLEHKVLLTGTPLQNTVEELFSLLHFLEPLRFPSESTFMQEFGDLKTEEQVQKLQAILKPMMLRRLKEDVEKKLAPKEETIIEVELTNIQKKYYRAILEKNFSFLSKGAGQTNVPNLVNTMMELRKCCNHPYLIKGAEEKILGEFRDTYNPAASDFHLQAMIQSAGKLVLIDKLLPKMKAGGHKVLIFSQMVRCLDILEDYLIHKRYLYERIDGRVRGNLRQAAIDRFSKPDSDRFVFLLCTRAGGLGINLTAADTCIIFDSDWNPQNDLQAQARCHRIGQNKAVKVYRLVTRNSYEREMFDRASLKLGLDKAVLQSMSGRESNVGGIQQLSKKEIEDLLRRGAYGAIMEEEDEGSKFCEEDIDQILLRRTKTITIESEGRGSTFAKASFVASGNRTDISLDDPNFWQKWAKKAEIDIEAISGRNSLVIDTPRIRKQTRPFSATKDELAELSEAESEGD------EKPKLRRPCDRSNGYGRTECFRVEKNLLVYGWGRWREILSHGRFKRQLNEHDVEIICRALLAYCLVHYRGDEKIKGFIWDLITPT-----EDGQTRELQNHLGLSAPVPRGRKGKKVKTQTS----------------SFDIQKAEWLRKYNPEQLLQDEGYKKHIKHHCNKVLLRVRMLYYLKQEVIGNECQKVFDGVDASDIDVWVPEPDHSEVPAEWWDFDADKSLLIGVFKHGYEKYNTIRADPALCFLERVG--KPDEKA 1717          

HSP 2 Score: 152.91 bits (385), Expect = 2.291e-36
Identity = 72/156 (46.15%), Postives = 103/156 (66.03%), Query Frame = 2
Query: 3965 RKNTXDFYKVLSNFGVIQNPETKEYDWQKFRQLAKLDKKLDETLTHYYEDFIAMCRRICGRATENDEKRLKGCQIEEISEDKASRCLQRVKLLNKIRTQVLPHEKLGERLALCIKSYDLPHWWKSVKHDKALLQGVAKHGLGRTEYQVLLDPDSIF 4432
            R+   DFY+V+S FGV+ +P+  ++DW KFR +A+L KK D++L  Y   F++MCRR+C R    +E       I+ I+E++ASR L R++LL K+R Q L H +L ERL LC  + DLP WW+   HD+ LL G AKHG+ RT+Y +L DP+  F
Sbjct: 1840 RREEADFYRVVSTFGVVFDPDRGQFDWTKFRAMARLHKKTDDSLEKYLYAFMSMCRRVC-RLPSKEELVDPNIFIQPITEERASRTLYRIELLRKVREQALRHPQLFERLKLCHPNPDLPVWWECGPHDRDLLIGAAKHGVSRTDYHILRDPELSF 1994          
The following BLAST results are available for this feature:
BLAST of TCONS_00073812 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
CHD92.291e-3655.83Chromodomain-helicase-DNA-binding protein 9 OS=Hom... [more]
back to top