TCONS_00073659 (transcript) - C. hemisphaerica

Overview
NameTCONS_00073659
Unique NameTCONS_00073659
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length4748

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00073659 ID=TCONS_00073659|Name=TCONS_00073659|organism=Clytia hemisphaerica|type=transcript|length=4748bp
gaaaaattttttttcatgcatGCAGAGCAGTTCATTTCACTTACAATTTC
CACACCTTATTTGAATTTTATGTTAGATACATTTCGCATTGATGACTTCA
AAAAAGGAAGTCCAAGATCCTTGGGAAATACTAGAGGTTCCAGCTGTGAT
AAATTTCTCTTCAAAATCCAATGAAGATGAGGGAGAAGAGaatgattttt
ctcaaaacaacagcaaaacaaaaaaGGACAACAAAGAAAGGTTGTGTGGC
TACTTGAATAAAATGGGAGcCGGTATCATCAAAGGTTGGAAGAAAAGATG
GTTTGTTTATGATCCACGTAGATGTCTACTTTTCTATTATCGTAGACCCC
AAGACACTGAACCATTAGGGACTATAGATATAGCAAGTGCCACATTTTCC
TACAACCCAAATGTAAAGGCCTTGTTTTCAATAAGTTCTGGAGACAGATT
GTATCAACTTGAGGCACCTGACAACAACGCCATGATGTTTTGGTTACAAG
AACTGCAAGCCAAAAGAcgagaattttcaaaacttgtAGAAGCAAATGCA
GGCAATAATAGACCAACAAGTGGTTTGCTTTCTGATCCGATAGATGCTCC
ACAAGGAGGTGATGATGAAGCTGATGGTTTCAATAAAATAATTGAAAGAC
CTCACAATGTTGGTGAGAAGACTGCTCTCGATTCTAAAGGAAATTTTTCA
TTCACACACTTGaacaaagaattcaaaaattGGAGaaaatcaacctttta
cacagaaactggggaggcaattttaaATGAGAAATCAGCTGCTTCTACGC
CAGAACAAGAAAAGAAAAGTCCTAACATGCAAAGAAGAGAAGATGATACA
AAAATTCTAGAAAGTGGAAACAAACGAAGaGTCGATTTTGGTTTCTCAAA
GATGGTAGCAAATCTGAGGAATACAAATATGCCAGTGATTAGCTCCCCTc
aaccaaacaacaacaacataaaTCAATGCCGAGATTGTATGGAGaaattg
aatatggTCAAAACTCTCCAAGAAGCAATTTCAATGGCCGAAAAGGAAAT
TACTACACGAGATGAGGTTATTGAAAGTATAAGCGAACAACTAAgaTTTG
CATCAAGCTCCCCAACATTAGTGGAAAAAGCACCAGACATCGAAGAAGCG
GAAGAGCGGGAACTCTATATACTCAAGctCAGTCGAATGATAAAAAGCTT
GAATGAAAAAGTTGACGAATTGACAACTACGATACGtgaaaatgaaCGAA
CTCTTGAAGAGTACGAGCAAAAGGAGAGAGTCTTGAAAGAAATGATTCAT
GCTAAAGATAATTCAATCATCGCCTTGACGAACCAGGTATTTTCTTTGGA
AGAGAAAGAAACAACAGACGTCGCTCAAGATGTATTGATAGCTTTTGAAG
AGAAACCGTCAGAAATGACTGATAGCAATTCATCGCCTATTGAACTAGAC
TACGACCAACTAAAGGAGGCTTGTTCAGCTTACCAagctcaaaacaattt
tttgaacaGTGAAATATTGGAGTTACACAAACTACGTACATTGGATGCTG
AAAAGATATTGAATGCAAATGATAACCTTGAGATGAAAGAAGCGGAGGTG
ATCAAAATCAGAAGTCGATATTTATGGTTACTTAAAGATTGTGCTGGACC
TAAACGAGaaacgAACATGGAGTCAGACGGAGTGCTGGAGAAATTAATCG
ATGAAGCCATCAACGAAAAAGCTGACTCAACAACTGAAAAGAAAAGCCCT
ACTGAGATAAGGTTTGCAGACAAGTATGGATTTTATGATCAAATCGAGAA
ATCTGACGAGAACGCTTTAGAATCACTTGCTGACCATTTCGAATcactca
gtggggataaagagCTCGGTTCATTAGAAGTTTCACACGGTGTGAAATGG
GAAAATTATTTGGTAGCACAAGGTACCGCACCACTACAGAAAACGGAGGA
ACTCAAAGCACTCGTCCGAAGTGGTATCCCACACGAATTCCGTGCGCGCG
TCTGGGGCGATCTCGTCCGCCTGCGTAGTGATCACGAGCGGACGATTGCT
GGGCAAGGCTACTATGCTAACTTAttgaaagagaagaaaggagcTTACTC
CCCGTCTGCCAAACAGATTGAATTGGACTTGTTGAGAACGTTACCGAACA
ACAAATATTATGATACGCTTGAATCTGAGGGGatttcaaaactACGACGC
ATTTTGACAGCGTACAGTTGGCATAACCCAGCTGTTGGATACTGTCAAGG
ATTAAATCGTTTGGGAGCCATCGCACTGTTGTATTTAGATGAAGAAACAG
CTTTCTGgTGTCTTGTAGCGATCACTGAACATCTAATGCCAATTGATTAT
TACAGCAGAACACTGCTCGGTGCGCAAATCGATCAAAAAGTATTTCGTGA
CTTGTTGGACGAAAAATGTCCGAAACTGAGTGCTCATCTTGTCTCCTTGC
AGTTCGACATATCGTTGGTATCATTCAATTGGTTCCTGACTGTTTTTGTT
GATCTCTTTCCGATTGAGTTGACGTTAAGAGTGTGGGATACATTTCTCTT
CGAAGGTAGCAAGGTTTTATTCCGGTACGCATTGTCCGTCTTCAAACTTT
TCGAAGAAGAATTCCTACGCTTTAAAGATCCTGGACCGATGTTCAACTTT
TTCCGAAATCTACCCAAAAAGAAATTCAACATTCAAAAGATTTGTTACAT
AGCTTTCAACACGATGAACCCCTTTAGTCGTCGTAATGTGGAATCGAAAA
GGAAATTCTACAGACCTATTCTTCAAGCACAACTTGACGAGTTTGAAATT
ATGCGTGAGGAATACAAGGAGAAACGGGAAGACAGTATTTCTATTCACGA
TGAAGAACCAATCAGTGACGACGAGAACTAACCATTGTCCAATCAGATGG
CGAGAAATAGTATAGTTGTCCAATCAGGATCCAAGGATTGATTTCATAAT
CCAATCAGATGGCGAGAAATAGTATAGTTGTCCAATCAGGATCCAAGGAT
TGATTTCATAATCCAATCAGATGGCGAGAAATTGTTATGGTTGTCCAATC
AGGATCCAAGGATTAATTTCATCATCCAATCAAAATCGCGAGACCACATG
AAAACTGTGATGTCACCATCCAATGAAAACACTAAGAATGATTGATAGCC
AATCTGATCAAAGAAAAGGTTTGATTCTTTCAAGTTGGACCAAAATCAAG
ATATGGCCACTCTTGTTATTTGTTAAAACACTGGAAACTAATGATTGACC
AATGAGAAAACCCGATTTAATGTCGCAATTACTGTATAGATTTCTTTCAT
TAAAACGGAAGAGCTGATTAAACCTGGATAAATTccactaaaaatatttt
atggtTTTAGCTAAATTTCAACTGTTATTCTCGCCTGAAATTTTGACTCG
TTTTTGAGGTCACTCATTGATCAAAACTAAATGAAATAAATGGATACCAA
TATTTTTTATGTGAATACAAAATTCagtttagtatttttttttcttaagg
tgaggccaatttaatttgttgttttacgggccaagcgaCCCAagaaagag
ggtcggtcgggcggttgaaaataaaaataaaagtagaattttaccTATTA
AAATCTCCTCAAAAGGCAGCAAAtctactacatcttgacaaaaatgcgaa
atagaaaataaaaaggcacaaaaaggtcgaattctagtcgaattcatgga
taaaatgaaaaatagaacattaaattctcaaaattttggaaaaacaaact
cctatttcgaaaatttgggagtctgtaaagcaatgaaaataaaaatgtgc
taccaaaatgaattttatttttatttcgatttttgaaatttcagggttGT
TTGGACCCgcaaaacaactaatcaaaatGGTCTCGCCTAATCATATAATT
GTTGATAGActgtaaatttttaaaagaatttaaagTGTATATAATGCACC
CTCGAACTTCTTCGAGTCACTAAATTGTCATAATTCAATCTCTTATTCGT
TTTAAAAAGCAAACTTTAGTCATTAAAGGATAAAAAAGGGAGCCTCGTTA
CCTACAGCAatgttttaaaacaatttttggcTTCCATTTCcctatttttg
agagggaggtcTTGTAATAGACAACACAAGGTATTCTGTCATCCATCGTT
AAGttacgtaaataaagcctgggatacacaggGACCAGGATTCGTGCACA
TATATCTTGATTAAtgatattcatgacgtaatgttttctacggaaatact
ccggtttttgccagtagtggcaaatttaactTTTATCTAGTTTAAATATA
ATATTATGAATATTATTGAAACATTattgaatatcatgaataagatCTTA
ATTTAGCATTTGGCAATTTCTTTCCAGGGATATTTTTACTCATTCGGGAT
AAGAGTTAAAAACTTACCTTCATATAACGAATTAATTAAGCTGAATTCAG
GGTAtagatttttttacttttgatttatattttttgaaattaatttaaat
tataAGCTTCGATTTTTGTTAATTATATAAATGATAACTGGGAAATTCTA
TTGTCTTTCTTGTAAATATTCAGAggatttttttatatgttttttttttt
gcaatttagtttttcttattctttttatATACCAGGataacaataatttt
tttaatttattacgATTCTACAGATTTTATTTCCTAAATTTATTGCTaat
attttttcagttttaaatcAAGATAATTCTTTGACAATAAAATATAAC
Run BLAST on NCBI

protein sequence of TCONS_00073659-protein

>TCONS_00073659-protein ID=TCONS_00073659-protein|Name=TCONS_00073659-protein|organism=Clytia hemisphaerica|type=polypeptide|length=929bp
MTSKKEVQDPWEILEVPAVINFSSKSNEDEGEENDFSQNNSKTKKDNKER
LCGYLNKMGAGIIKGWKKRWFVYDPRRCLLFYYRRPQDTEPLGTIDIASA
TFSYNPNVKALFSISSGDRLYQLEAPDNNAMMFWLQELQAKRREFSKLVE
ANAGNNRPTSGLLSDPIDAPQGGDDEADGFNKIIERPHNVGEKTALDSKG
NFSFTHLNKEFKNWRKSTFYTETGEAILNEKSAASTPEQEKKSPNMQRRE
DDTKILESGNKRRVDFGFSKMVANLRNTNMPVISSPQPNNNNINQCRDCM
EKLNMVKTLQEAISMAEKEITTRDEVIESISEQLRFASSSPTLVEKAPDI
EEAEERELYILKLSRMIKSLNEKVDELTTTIRENERTLEEYEQKERVLKE
MIHAKDNSIIALTNQVFSLEEKETTDVAQDVLIAFEEKPSEMTDSNSSPI
ELDYDQLKEACSAYQAQNNFLNSEILELHKLRTLDAEKILNANDNLEMKE
AEVIKIRSRYLWLLKDCAGPKRETNMESDGVLEKLIDEAINEKADSTTEK
KSPTEIRFADKYGFYDQIEKSDENALESLADHFESLSGDKELGSLEVSHG
VKWENYLVAQGTAPLQKTEELKALVRSGIPHEFRARVWGDLVRLRSDHER
TIAGQGYYANLLKEKKGAYSPSAKQIELDLLRTLPNNKYYDTLESEGISK
LRRILTAYSWHNPAVGYCQGLNRLGAIALLYLDEETAFWCLVAITEHLMP
IDYYSRTLLGAQIDQKVFRDLLDEKCPKLSAHLVSLQFDISLVSFNWFLT
VFVDLFPIELTLRVWDTFLFEGSKVLFRYALSVFKLFEEEFLRFKDPGPM
FNFFRNLPKKKFNIQKICYIAFNTMNPFSRRNVESKRKFYRPILQAQLDE
FEIMREEYKEKREDSISIHDEEPISDDEN
Run BLAST on NCBI

transcript from alignment at scaffold_97:393681..474055+

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00073659 ID=TCONS_00073659|Name=TCONS_00073659|organism=Clytia hemisphaerica|type=transcript|length=80375bp|location=Sequence derived from alignment at scaffold_97:393681..474055+ (Clytia hemisphaerica)
gaaaaattttttttcatgcatGCAGAGCAGTTCATTTCACTTACAATTTC CACACCTTATTTGAATTTTATGTTAGATACATTTCGCATTGATGACTTCA AAAAAGGAAGTCCAAGATCCTTGGGAAATACTAGAGGTTCCAGCTGTGAT AAATTTCTCTTCAAAATCCAATGAAGATGAGGGAGAAGAGaatgattttt ctcaaaacaacagcaaaacaaaaaaGGTATACATTATTTATGTANNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNagataactaccaaaagaaattctccaga ggtttgtttttgtatgacttttctgggttcaaagacgttcggtcgccaac tagaccagtcgccaactgggcaggggactctattGTTCAAAAGATTCAGT TGATTGGCAATGATTGTTTGTAAATCTGTATACTATTAGCTgtagtctgt atgtcagttCAGCTCACTGTGCGATATTTTGAACTCAATAATTTTGTAAA AGAATTGCCGTAATGCATTGCAATGCattgaacaaaagaaaatagtcaaa gatcaaagaaatgTACCCTTAACTTCAATTGCATTTGATTGCAAGTTTTG GAGCTTTCAAACTTTGTATATATTTAAtcttaatatttcaattttgaacg CACAagaattcaatttcaaaatataatgcAATGGAGTATACTGATATAGG GGCCATCGACTttcgattttcgaattttttatcggcatttgGCCGTTAAG GCTCTGACCCCTCCCCCCCCTCGACCTTAATGGCCATCAAAttctctaaa gttaaaaaattgtcaaaaatcgatgaattgaaactctaaattttctcctt cactttcatctttgtttcgtcagccatctttactTTCGCTATGGCTTTGC Tcagtttacatttaaaaaataacggagatagtttctaaacttttttccga aagttgcgcaaattaattatctccgtaatcATAATAAAAAGAATAGCaac atttcaaagaaaaaagaccgaccgtctgcgaaattcaagggccgcgCGGA CCGTGTAAACAAAAGGAACAcgagacataaacatcgggtcgtttgttttg gttaaaattattctaaaaaatagcGAAGTGAATACTTTAGGTATCTTAGT TGATAAAatgaggaaaagaaatatggaaagtaacatttgtatggaataaa cgtctcaaaaatcgatattttctgGTGAAAAGAATTGATATGTGGTGAGT ATACCCCTAAAGAGATTTTCGACCTTCCCTTAACGGCACATGgtcgaccc cctcccccccttaacggccaaatgccgttaaaaaattcgGCCCATAGCCA TTCcaggtttgcttgttttttatttgacgctcatgaaaattttcaatttt aggtccgactttgacaagcaattgttctttgtgtagttgagctatgaaat taataattttaatatgcaggtgtaatattctacacttttATCTAAAAACT CGTTCCAACTAAgaccatttttagaaaaattggaactgcgggacacaaaa aatttcacaactcatctttgatttcaaagcgctccggaggaaaaaatgtt cagacagtgaaacttttcatatttatcagaaaatacctgagaaatccaat ggtCTGAATTAATTCTTCCATTaaggttattattttttactttttatact ttggcaagcattttcaagcctttgtgagaaaaatgatgggtcatttatta aaatttgataagTATTTCCACAGTTGTTCCAttaatttcaaaacacaaaa gatCACCTTTCCAAAGAATCGTTTGCATGACCCCGCGccaacaagaaata attttttgaaatgaaatgaaatctaGCCTTCTGTGTGCTGTGCGTGAGAA GTTTTGGTGGCGCAGTCTGAAAATCAGCCCAATGACTTTTAAACTTTGAT TTATCGCTAATTGAGCGATCTTGTCGAAAAATtgcaatttcttttatttt tcaaaattccagacggcctgtaggttttcaaataaagcagcaTGTTATGG ATTGTAGCCTAATATTActaaaaaacagcaaaaagatgaaccagctcatt agcaacagccatttgtttccatGACCATGTGTGTCATGAATTCTCTGGTG CCGTAAGTGAGTCAGTGCTAAGTTGTGAAAAacatctttggaaagaaaag ataTTGTTAGATGCagttttttacttgtttccctgataatttctgactgt ttaaaaaaaaagaatgaacagatttggatgaaTCAAAGGTACTAAtacat tgaagttcattttggtaaattcttcatatcaatttttttgatttagtGTG ATTGCCCACatccattttgttgttttgatttgagcaggTCAAATTTCTGT ACAATAGAATGGAATGACATTTGAAACAGTTTCGAATTGACATTGTTTAT TATGActctaaattatttttgtttatactTTCAGGACAACAAAGAAAGGT TGTGTGGCTACTTGAATAAAATGGGAGGTAagtttaaatatattttttcc taATCATGACATGTGGAATAATAAAAAAACTACCAGCATTTAAATAACTT TCACATGTGTAAGCATagttattttgttttcaatttaactacggctttaa acctttttttcacattaaaatgacacatctaaatttttgaatgaaattta ttCCAGTAGAATTTCGTCTAAAATAGGGCCAACCTAGAAAGAATTAttat aaaaggtttctatatactgttggaaagataattttatcagctttccaaaa atgaaacCGGTCAAATTTTTCGTCTTGGGGTAAAAAAGTTATCAAACAGT GACAGGTGATAAAAACCCCaaaatgcagaaaatgagtttttgaaaaatct tttaaattatCTGTAACTTATGATATGATATGACCttcaaactttgcaaa aagcttTAAGATGAAGTACTAAGAGATGAGAAaagcaaaagttaaaaaaa aaatgcccaaaaattgACGACGTCATAAAAAAATGCATCATCCCAGGGCA AAAAAATTGACCGGTTTATAAATTATCTTTATTTAATAGAAACcttttat cttaattttttctaggttgacccaaatttaaaactgattttctgaggaaa atttgagaatgcttaattcaaaattgaaaatgtgtTCAAAAATTGCGCAA TAATTTGAAATGCTTGAGACTTTGCACCTCTGGTTGATCAGGAAAGTTAA GGTCAAGTTACAAAAGAATACTTGCTGGCTTAAAAGTCAACCAAACTCCG ATCCCTATTTCATCAAACTTCTAGCAATCGGATTCCTTcacttttcttaa aaaattctacTCACTCTGCTGCTTACCCTAACTGTGTCTAATtttgacat ccctcatctaatttcaACACCTTTCTTTAGAGTAAAAAAGTTGGCCAGGG TATAATACCAGGGTACGAAAAATCTCAATAGTgttaatgtaaacaaaaca tGCGCACATAACAAGCTCCCTGTCTTAATGCCTCTCAGTGCCTTTGGCGT GACCTGCTCTACAATTCCAAATTATTTCAGGACTTTTAGAATGACTATAA TATTTAATTTACGTATTTGTTGTGGAAATTTGTTGAATCCACTGGAAAcc tctcaaaaattaaaataactgAAATAAAGGTATTTTTGTAAATTAGTTAG TGGTGAGGCAAGTATTCAATATCTTACGTTGaaggatttttttcattttc tttaagcCGGTATCATCAAAGGTTGGAAGAAAAGATGGTAAGAATAAAGT CTCTCTGTTAAAAAGTTGGATGTATTTAAATAGTATAGAACAAAAGCTTA TTCTCAAAATGATAAAAGTTTTTGTCCACTAAACTTCTTggcttttaatt cttttctaaaaacaaaaaccagGGTGGTATAAATCAGTGattgaatttat gaaaaatCCTTGAAATTGCTATTCTGTATGCATGAATACTTTTTTAAAGT CTCGtctaaaagattttatttcaagtttATTATAGTAATTTTTTGAACAT CTTTTTTAACTTTAGGTTTGTTTATGATCCACGTAGATGTCTACTTTTCT ATTATCGTAGACCCCAAGACACTGAACCATTAGGGTATGATTTTATCTGT GTTTAGAAATAATATGTTATATACCCAAGTGCCAAGTGGTTCACAAAATA TGTCTGTAAAATTCAAATTATGATGTACCCTTCATATAAAAGATAACCCC TTCAAATATGCTAAACTTTAGACTGGAAATACTCTCTTAGGATTCTTTAA CTTTAAgagatcttttgattttttattgattcattttttaCCATAATAGG ACTTTGAAAAAGCAAAAGACAATATAGTTGATTCCATTTCCAACTTCCAt ttttataccgggtgcaccaaaaaaaagtatacaggtttgtcgagttATTG TGAGCTttcagatttaaattttttgttcattcttttttaatcgtatAGAG GAAgctttaacttaaattttgagctatcatacattaaatttgaaaaagtt gttcGAAAGTTATtccaaaaaaactgacttttttttcatgtcgaaatttc aaaaaatcgttaaaaacagcgagcaaattttttttaacaatcaacctaat aaaaagaaagaacgAATGACAAAAACACTATTTTATTTGTTGatactttt ttttcttattcattAGGAAAAGTAATTCCATTTACATTCAAACACTTTTG AGCACGGTTAACCATTCCTTGGAAAGCATCTCTGATCATGGCAGGGTTGA GATTTTGACATTCAGTTGTGATAGCTGCTTTTAACTGTCTCAAATTCTTT GGTTGTAGTGCAACATCCCGATTCCAAATCTGGTGTTTTAAATATCCCCA TAGAAAGAAATCACACACTGTAAGGTCTGGTGATCTTGCAGGCCAATCTT GATCCCCTCGGCCACTTAAAACTCTACCAGGAAATTGGCCAGTCAGGTAG TTTATCGCTCGATTGCTTGTGTGCGCAGGTGCACCATCTTGCTGCCACCA CATGTTGTTTCTTTGAATTCCAAGCCTTTGAAGGTCCCCTTGGATTACAC GATATCGGATTACTCGTAGATACTCTCTTGCATCCAATCTGCCTCTTACA AAGTGGGGCCCAAGAACTTGTCCACTGCCGGTTAGCCCCATCCAGACCAT CACTTGGTCAGCACCTTGTTTAAACTCAACGTAGTGATCTGGAGGGTGTC CTTGACCGTATTGAGCGTATTTGATAACGTTTCGTGAATTGACTTCAGAG TTAAGGCTAAAAATTGCTTCATCAGATACGATTAGATTGTTTAAGAAGTT GTTTACACCATTTACCATCTGGAGAAACCAGTTGCAAAAGACGACTCTTC GAGGAGGATCGGCGGGTTCAAGCTTTTGTCTCGATACTAAGACATAAGGG TGGAATTTAATGTCTTTGACTATGCGAAGAAATGAAGTTGGTGAAACATG GAGACCATTCCTTCGTGAAGAACGTTTGCCATTCCGTTGAAGAGCACGTT GGACACGCGCGATGTTTGCTGGGGTTCTAACAGTACGTTGTCTACCACTC CTCCCTTTATTTAAGTTATGACAAGTCCCCTCaccttcaaatttttcaaa gtttttcagaaTTGTTCTAACCGTAGGAGGGTTGATATTTTGCCAACGGT TTCTCCATCTTCTTTGCACCTCATGCGCATTTCCAATacgagcaaactca atgcagacccaagttctttgagcaactgTTAGTCGAGGCATGGTGAACTG TTttaccaaaaagttttttcacacaaCACATACACACATAACATAaaaac ctctcttggagatttccaaagatttttttcagctttttcgaaaatcccac atgggaatagcttatTTTTCCACATTTTCGAATTCCCTAATGACCTTTAA TGGACAACCTTGCATTTGATGGTCTTTGGATGTGTAATgaaggtaagtgt caagagaGAAATTTGCTCGCNGGATAGTATTTGGATGTGTAATgaaggta agtgtcaagagagaaatttgctcgctgtttttaacgattttttgaaattt cgacatgaaaaaaagtcagtttttttggaataactttcgaacttcttttt caaatttaatgtatgatagctcaaaatttaagttagagcTTCCTCTatac gattaaaaaagaatgaacaaaaaaatttaatttgaaagcTCACAGTAGCT CGACAaacttgtatacttttttttggtgcacccggtattcTATTGTATAT ATCCATTGAAAAGTTGGAATCTACAATATCAAACAATGGCATGCCTGATA CGAGGGTAGAAATAAATGGAGACTCCTgcagtgttaaaagttcttccttC TCAGACGGACATCTAAGTGTCTTTTCCTTCTCAAAATTCTGAATAACAAC AAAGTATATAAAGTGGCTTTTTCATCTCAgaattctgcataattcaccaa aatttctgGAATATCTGCTAAATTGCTGTGTAAAatccttgctttgacca ctgccCTTGATTATTTTGACTACTTATGACAGCTTGTGACAAAgacctct tctcacagacctggtagaatttttttagatagtgggggtaaaaataatgg actgaatactttttatggctggggatttcaattcttttgttttcaaggca aaaaaattAGTGGGGATGGGAAGAAATTCATAATATTTTACAGCGAGGAT TGTTTTATTtggttattttcagtggggacaaaagttGGAGTATAATATTT TCCACTGgtgatgatattttggccaatttttccaatgggaaggggtccca gtgggtctgtgagaagggggtgttttgtGAAACATGTCAAAATGAAGTAT ATTTTGTAGAGCTATCTTTTACTGTAGTAGAGCGCTCCTTAAATTTAACA TAACAGGACACTTCTGAAAATTTCGATGTCAAAAACTAATATTATGTGAA TTAACGAGGTATTATCCAAAGATACTACATACATATAACCTGTCCTGTCA ATTCTAATCGTTTAGAGTTTGGTTAAGTTTGGATAATAAACATAAATCTC TTCGTGGAGTTCTATTTATTTACTTCTGTCTGAAGACATTACCTTCCTTT TGTTAAAGTTCGACTTCCCTTTTGTTATTTTAGGACTATAGATATAGCAA GTGCCACATTTTCCTACAACCCAAATGTAAAGGCCTTGTTTTCAATAAGG TGAgttagtataatttttattgaaGTCAATCTAATCTAATACATCTAATA CGTCGCTAgatgtaccttattggaacttaTTTTAGTGGGAATcaatttta gggttttttgAACTCGGGAAAtacaatttttccaattttattgaaaaatt tgaaaaaatcccttgtaggaaaatgaaagaaatttgttcaaaaaagggca aaactgCGAAatttaaaacccgcgaaatgctaattttccgattttttttt tcaaccgcgAAAAATAGTTCCTATAAGGTAGTTGAGAATTACAAGAATAA AATTAAGATTCTGTTAAGATTCACATGAAAGAAACTGTGTCAAATGCaaa gaatattaaaaaattggtcaaatgaaTCTGTTTCAACTGTTTCAAAAGTA GATTTTCGAACATCAAAAGCCAAGGtatttttcaagcacttttttaccac cgTTATTCGGTGGCAAAAactcaatttcaaattgatttttcaaactcaat tttttgaagaaaaaaatgtgaagGGTAAATGATGAAAAGTAGAAGAATGA TAGTACAAAAACTTGAAGGAAAATCAACTCAATCCATTGCAAAGAGTCTA ACGAGTATTTTTTGAaggtaaaagttaaaaaaaatgttttgataagACAA GATCAAACGATTGAATTGTTTATTGCTAATTTAGCAAATTGCTTTATACA TCAACAAAGAAAGGTTAATGGCGAAAAAAAGTATTGTTTGGTTGTAATGA AACTTCTAAGTCCCATTTCAAACTTACCTTCTTCCACGGTATGAAAATGA GATTAGTTTAGTTTATTTAGTTCAAAATGAAAGCTTGCTTAAGATAAGGA CTAACACCACTGCATTGAAACTCAATTCTTCAGACCAAAATGGTGGTAAG GAAAAGTGCTTGGGAAATACCCTGCGAAACGCAATAGTCAGAACTTTAAG GGTGCAGCACTCGAACTTTTTATGATTATAATTTCTTGCTACTTCATTAC ACAGTTCTGGAGACAGATTGTATCAACTTGAGGCACCTGACAACAACGCC ATGATGTTTTGGTTACAAGAACTGCAAGCCAAAAGAcgagaattttcaaa acttgtAGAAGCAAATGCAGGCAATAATGttagtatatttattttttgaa atgttatATGTTACccatagtgcagtggtagagcatctggctacagttcg caaggttgtgggttcaaccccaagccgggtcataccaaaggttctcaaaa tggtactattgatgcctctctgcttgatgctcagcaataattaagagaag gattaagggtaagtggagcaatccagggagaaacaGTGGTGCCCTCATCT ACCTTTTGGTAGATAGCtattgaaagaggagccttcgggtcgcctccaac tgcggtcgcagacttacttatatGTTACATGATTTTTGTTCAAGAAGTtg gatttaaaaaaagggggggggggcgacAGGCTTTCATAATTAACTAATTA TATGCAGTTGATGTTAATTAAATTgagatttatatatttagaacAATAAA ATTCGGAAGGTATAAGaagaatcaaaaaatttaagatAAACTTCTCATCT GTTAATAATCATCATGTttataatttttggacctaccccggtggaggtcc tataaatgaacctatgtttgttcgtccgttcgtctgttaccaacttttct caggattgaatcataggaatcttttgatttttggtacaaaggtgcaaaat ggtggtggccaaaatgtgacagagtccgattttcgagaaaaaaatttttt ggggcaaatttgggcaaaaaaacggctaaaaaactggttttttggacttt gtgaaaaattgtatcattaattttttctgatttttttgcatgaaagtagg gtaccatcataggtaaaagatggttcaagcagatttttgcaaaacaattt tgttggctcaaaaaacggatgtttatctataagaatcactattaataagc atacatcaatgttcttagtcaaattactaaatttttttatgagatagatg tttttttttgctcacgagggcttacttttgaaaaatatgtgtgtttaaac atgaaattttgggttgcttggcgtgtttttatagaaaaactggccaaatt cgatatatttttataagcacattatcaataacttaggtattagcttttct cgagattgttttttcattctttatgattttttcacaaagatgcataatta taaaccctcgaatgtgacggagcctagTTTtcggaaaaaacttttttggg caaatttgggccaaaaaaccgctaaaaaatgggttttttgtactttgtga aaaattgtatcattctttttttctgattttttgcatgaaagtagagtacc atcataggtaaaagatggctcaagcagatttttgcaaaaaacttttgttg gctcaaaaaacgcatgtttatctataagaatcactattaataagcgtaca tcaatgttcttagtcaaattactcaatgtttttatgagatagatggtttt tttgctcacgagggcttacttttgaagaatatgtgtgtttaaacatgaaa ttttggttgcttggcgtgtttaaatagaaaaactggccaaattcgatagt ttttataagcacattatcaatattacttaggtattagcttttctcgagat tggctctttcattctttatgattttttgcacaaaaatgcataactataaa ccctcgaatgtgacggagctcgatctTTTGCTcccaaagtcttgaatatg aaagaatatttcaagagcatgaaattttggtttctaaagtgttttttttg taagaaacaaacgactaattttaatagatcgtcactatttgtgttctgaa tgattgtttaatggtcacgtcacgtagatatcaattataaatgtgttaaa tgcataatcgtcagccgtgcaaaattactcgaatctgattggtttagagg agtgcgattaatcgttaattgcactattaccactttttgcactcttcggc ggggggacacttttgtccccttattcttttctctcccaagtcctgtgtca gagacttttttttactatataataaaaaacaaagatatttttttttcaat ataaaaaagaacaaagaaattttacgttacaatagcttcttttaattgaa aacaaagaaaaattacactgcaatgttttctttttaaacaaaagaaaaaa atgaggttttcgaatgtttacaaaaatataaaagtttggaaatgattatt tactgacgattactagtactaaccaggtaggtccataaaagtatcacttg tttatttttgtatacTTATAGAGACCAACAAGTGGTTTGCTTTCTGATCC GATAGATGCTCCACAAGGAGGTGATGGTAAGAAACGTTGTACTGTAGTTT TGTGTATAAAATTACTCGTTGAATTTGTATGGATTTTTTCCattataaaa attatgaaaaaaaatatttaacctactgtactttttttattgaacaattt ttgataataGCAATGAGGCTCATAAACAACatataaaaatgagaacaatt taagaacaagaCTGAGAGTGGAGAGGTTAGACTTCAACCAAAGAACAGTT GACCCCTGATAACAGTTTACTTTCTCCTTTGTAACAACatacttaaggcc ggtctccacttacgCGTGCATCAATCACACcatttggcttcaatcctttt tgcttggaaaaagattacatcatagAAATGTAGCgtgcgctcgaaaaaaa agttgaatacatttcaacttttttcaaccgttacgtccgatcgcgccaat ggatttaattaatttttcttttgaccaatagcgtggaagcgcgcacaagt ggagaccggccctAATAGCCTTAAGCCATGTGTCCACTCCGGATAGTTTT CAACGAATCGGTACGGTTCGGAACGGTTTCTATTGTTCTGGGGATTATCT TCAACCCATTTGCTTCATATTTGTTTCACGTGAACGGTTCGAATGTTCAC GTGTTTTTGGTCCAAACGGATCGAAACGGTTCTATTGATTTCAAACAATA GAACATCTGTAGAAGATTAAACTAATTAAGATTTCTTTGTATAAATATCG TAAACAGAAAGAATCTGGTTCAGAAAATTTGAAGTGGATATTGCAAAACT GTCCGGATCGGTTTTCCAAAATATTCCGATCCAAACCGATCCGTTGAAAA TTATCCGGAGTGGACACATGGCTTTATAGGTTAAAAAATGGACGATGAAT GAAGATGGATAAACAACAGAGTTCTTTTGAATGAGTTACACAGTTTAATG AATACAGGGCTAGCAGGAGAAAATTCAGCGAAACAATACTTTGATAATCT TTACTTTCCTATCCTTTAGATGAAGCTGATGGTTTCAATAAAATAATTGA AAGACCTCACAATGTTGGTGAGAAGACTGCTCTCGATTCTAAAGGAAATT TTTCATTCACACACTTGaacaaagaattcaaaaattGGAGGTATTGATAT catattttatacttttttgttttttgtttttattttttaaactcagattg ttatacattttctaaacagccttttcaaatatttagctCTGGAGACAGTT GATATTTTGCTATAGATAAAAGTGGATTTCCAAAATATTAATGTctaact aaattttaaaattttgcaatattttgaagtaccaaaactgtaaaaaatga ttataaataaacaaaaattaaatcagACTTGTAAAAAGacataaaaaatc tttttattcacagaaaatcaaccttttacacagaaactggggaggcaatt ttaaATGAGAAATCAGCTGCTTCTACGCCAGAGTAAGGActgaaaattta taaatttcacTCTTAATTAACTATTAACAACATTGTTAAAATAACTGATA ACGATAATCActcttattttattattattattaaagggacattaaagtag taaaatgtaaacattgcgcgaaccacgtgtcattaaagagaacaattaaa atcacgtgtccaaaacaaacttgtataACANNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNttttttattttgacatgtgacatttgttttgat tttgtatccgctgcatacagtttgtttacaaatttcgcaagtactgttat gtccctttaattaTACTAAGGATTTTCATAAAGCTGCTATAAGATAAGAC TAAGATTCGACGtaaaattttttggacaaaaaagaGGCTCATTTACACAT ATTACCttgagagaagaaattttggcgagaatcaattttggcgaacgacc catttttgttaatattttaatttagctgaaaaagagggaaaaaggGTTTT Caggagaaatagagactaaatcaaaagaaaattaaatttggcaagaattt attttggcgaatgatctatagatttaaatttcttttcgcCAGAATTTTTT CCCTTAAAAGGTACATATATTTCTTTCTAAGATTTTATTTTGCTACTTAC TATTGTGTCAGAGTTCTTGATTAGAATtctattttttaatttcgatgcaa taattttgtatttttacctTTTCAGACAAGAAAAGAAAAGTCCTAACATG CAAAGAAGAGAAGGTACCTAGACTTTTAAACCCCTGTTTCTCAACGctaa tgaaagttttttccaccatggggggggggtggatttctatcaaaatctcA ATGTCGATGGAATATTCTTCCTAAAGTCGAAAAATCAGGTAGAGATGATC ATTTTGGAATGCAATTTTTCTAATGAATTTTAAATGGGGATGAATAAAAT CTAAGTCCATTTCCTattggggctgaaattgtagggtaatTTTTCTACCG GGGATTTTTCACATACGGTCATAATGTTCAAAGTTCAACCGCCTGAGACA CAATTCCCTCTCTGGAAAGAGGCGTTCCAATCAATTCAGTTAGTTATCAA AAATCTTCTGTGTTTTTTTGCCTGAAACAAAAGATATTAGTTCTgatttt cgtttaaattttaaatctgATTCGACCAATCtcaatattttcttctttca gATGATACAAAAATTCTAGAAAGTGGAAACAAACGAAGGTATCTATATTG TATTTTTAATAAAACCTCTCTCTTACAAATTTTCGAAACCATTAGAGCAA GATATCTGATCAAAAAAGAACATAATTACAATTACTACATTGGGTTTCAT GCTAGCCAAATCTTTAGATAATTCAGTATAAAGTAGATTTTATATTACTt caatcgtagaaattttagcgagactaattttagcgtatattagcgagcca ggaaaatcctgattttttttggatttattttagcgaatcacgatttcaaa aaatttcgcgtagataaattttagcgaatgctcgtattacattattgatt gaattcgttttctagcatttctttgcactgaaaccctttttttttttgaa gaaacacGGCTATAATTTCATTCCCTGtattgtttttcaatttcagaGTC GATTTTGGTTTCTCAAAGATGGTAGCAAATCTGAGGTTTGTAACTAATGG GATCTAAACGAAAACGAtccttttcaacattttagtaCTTTCAGATCTCA GGaactaaaagctcaaaaacccAATTGGAATAAAGGTATAATGGTACCAA TATTCTAACCCTAGCCCAGCTATTTTTTGGGTCTTTTTAACATCTTGAGT ATGatttgcttattttgaaataaagctttgttgtttttataCTATCATAC TAAAGGCTTAGagacacaaaaatattttttttcgcgttggtgcagtgcaa catgctccatcccaccagcCTGAAACGCCTTTATCGTGTCTCCactccat ttttctttctaccaataaaagtgaaatcttacTTTTGTCTCGTGGACAAA ATCAGGGTGTCTTtcgggtatttccctcactttttgtcccatgaaacaaa aaaaacaaccatGGGACgcgcacttttttcttgtgttggtgggatagagc attTTGCATTGCACCAAGGCAAAAAACTTCTCGTATCCCCAAGTCTTAAT ATTCCTCGTATTTCTTTTTCCAGGAATACAAATATGCCAGTGATTAGCTC CCCTcaaccaaacaacaacaacataaaTCAATGCCGAGATTGTATGGAGG TAGGTCCaagaccactgacctttatataatcCTGGACCAGGTAATTCTGA Cttttaggtgccaaataaacgaccctcccccgcttgttaattttgcgatt ttttccAATCCTTATAAGGACCCCTCCACCTCCCGTTTATAAatcttttg taaatatttccaGCTGCCAAAGAAAGGGTCCAttattttattctaaatag cctggttttaatctataattaccttattttttgttgtacTTAGTGGTACA TTTTCCAATCCCCTCATTTATTAATTCGAAGATTTTTCCAACTGCCATTT CTCCCAATCCCCTGTTTATAAGGCAGCGGAGGAATACGATATCTGTCAGC TACTTTTTTACCTAGCATTGCCCAAGGGAATATTATAAAGCTCAGCACAT CATACAAACAATGTATGTATTGGTTTCCCTCTCTGCCTTAATAAAATTAC CCCACCTAAGATTGTGGTTAGCAAAGACTATTTACAGCTGTCTTGAGGGT TATTTCTTTAATATGATTTACAGGTTTAAAGTCTAATTTAAGTCTTATTT TAACCTTATTTAGTCTTTTTGAGCTCCTTTTATAAACAGCAGAGTTCTCT ATAAGAAATTTTTCTctcatagaaattgaatatggTCAAAACTCTCCAAG AAGCAATTTCAATGGCCGAAAAGTAtgctttttttctctttttattctct aataaagtaagtaagttttCTTATTATAGTCAAAGAAAACCAGCCGAATA TCCCTTACCTCACCTTATATTTGCTATCTGTCCACCTGAGGCAGTTGGCC TTATATTTTCTTCATTGTCCTCAAGCCTTCGTATTATTAGAGcccctttt tttataaaagtaaaTATGATACAATTTTTAATGTCCTTCATAAGACCAAG CTTTTAGTTGAACTCACCACCGTAACTTCGTGTAATGTtgacataccttg tctaatttcgtcatagcaactatctggtctttaaaatatttatatatAAA ATCTTCTAAATAAGCTATCTAAAATCACTCTAACTACTCGTAGCTATTTC gcagaccagatagttgctatgtCAGAATAAGACAAGGTATGTCGACATTA CACAAAGCTCAAGGTACCTTTGCATGCAAAGCTCCATATGTTCACTAAAA TGATTACATGTAGTGCTCTCTACAAGGGGAATTGAGTTTTacatcgaata agggagagtCGTTTGAGAGTTTTTGTTGACAGTTGTTttgaatattatca aataatagAGTGTATCGAATAGTGGAATGTCGGATTGGAAAGGTTAAATG TATTTAGGTTCTTAGAAAGAGCTAAATTAGTTGCCGTGACCGTGaaagga ttccaaaaatatcaaacaaGCTGATTAATCCTTTGAATTTGAGtctatca aaatatttttttaaatttataaatttcaacttatttcaacaattttttca gGGAAATTACTACACGAGATGAGGTTATTGAAAGTATAAGCGAACAACTA AggtatattttattttgtttgaagaATATTCCTGAGCAAGGTTgggtttg attttttcattttattttaatcaTCTCAGTCGGACAGTCGCAAGAGAATT ACAATTTAACATTGAAATAATTAGTACATAcgactctctataattcgact TTTAATGAAccataaaatacaaaaatacaaatttctgATCAAGTTTTCCT GCTGAGGAGAGGGGAGTCTTGTTTTAGTTCGAGTAACAGAAGATTCATAT AAAAAGAggttcaaattagagaaagagaGATTAATAACAATGTACtacaa ttattttttatgatttagaTTTGCATCAAGCTCCCCAACATTAGTGGAAA AAGCGTAAGAATTTTAACTTGATTAAAACCTTAAGACAAACATTAATGGT AGAAACTCTCATAATAATTGTTATTAATTTAGTTTTCTTGAAATGTTCTA TGGTTAAAGCCACGTTTGTTTTAACGATGTTTAATTGAGGTTTGAATTAC TATTAAAAAAATGCTGAGCTTGCAAAAACattactttttttgaaaaagga tcacaaaaacaaaatgtaaTGCGTTCCGTCAGTTAGCCAAGGTTCTAAGC TAATAGTATAATTTTGGCTTTAGGTGTGCATACTATTAGCTTAGTTGCAA ACAAACTCGGTAAAAACATGATCGCCTTTGCCGAAGACTTTTCAAATTCC CAaggcaataaaaatatttgtcatcaaaggcaaaaaattaTAACACCTAC GTTATTCCCAAGAGCAATTAAAAAAAGCaaactttttctctttgtttcga ACGCGtttttttgatcaaaataatCAGGAACGACAAATTGTCGTTTTGAT TGCGAGAGAAAAGATACAATAATCTGATTGGACGCGATAAAAAAGAGCCG CAACGAGAGTTGTTTGCCATCAGGCGTTTGTATATAAGtgtagtgaaaac tcgttgaaCGGAggttagctctagtttagacgacccactttttgccctgc ctattctaattgtgaattaaagtgggcataaagtgagctgtctaaagtca atgcattgccctcttttgacgtcaatgcattgccctctttcaatcttttc caagcaaagattttagcTGCCAACTTTTTGCCCAacttctgcctactcta acaattagaatagacagggcagcaagtcggccgtctaaactagagcttag acATCACGTCTGACAATCTGGCTATCTGTCAGTTGACTGTTCTATTTGAC AATGGAATgtcttctttccaaaaaaattcattaatgCAGATCATCAATTT AGAACATTTTGATGTTGGAaatgttgaataaaaattgaaatggtcTTTAA AATGGTTTGAATAAACTAGCAATTAGCTTTCGCTATGATGCTCCCGATGA CAGGCATTTGACAgtgattgattgaaattcagaaaaggcgaAATGCCGTG TTTATTTTTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNTCCCCTTTAATAGATACCTTATAAAGCTTGAATTACAAagcttt tcatgttttataggcAGGGTCTTGGAATAATCTTCAGGAAATATTTAGAA TGACTTccttctcaaaagcattttctttgaaacaacaataaaataaaata aaaataacaaacatatcaaaacatgaatttataatttccaagactatatt ttgacaatgatataattttcagcTAAGTTGTTTTCTATATCGTAANNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNTAACCAAACACCTATAGTTtgattctgtttgataaa atttgatagttcaattacgaaaatttggatcaattgaattcaattgacat cgcctggagaTAAAGAGAAGGTTCGttgtatgcaaagtttttccCAATTT CTGATAATAATTATCCAAAAGTAACAGTAAAGTAACTGATGATGCctgat tgggcttttccagaaaaatgttgtaccccctatgttgaggagatcttttt tttaaaaggtgaccccccctggatttttttccaatttttcaggacctcct tggattttttttctcccatttctATGGACCACCCTTGATTTTTGACCTCC ctatactgaccaccctggattttatcattcaaaaaaccagaccaccctgg atgttttattttccagactaccctggacgtcacacctcctcaacataggg ggtacagactatttctggaatagcccattataCAACAAGgatacaaagca aaaagaaattctttaaaataattttcaatcatacatCCTATCTGAAACAT TTGGAACAATACTCTTCCTATCTGAAACActacttttgataaaatagtat tataccttctactttctgaaaccaactggtcccaagttgcttcgttgctt tttgttgtattccaagctatgactttggagcgctaAAGACGCTAAATTTN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNttgaacaatttttcgccaGCTCGATCCCCCCAGCCTCGTGAAGC AACATAGGCTCCCTTCGGGAGCAATAATTTGCATTGTTTTTACAGAgatc agaaaatatatttttgggctTTAACAAAATGATACCTAATATTTTTGGCA AATCCAAATATATATACAAAataattgtttgtttgtttgtttactttAGA CCAGACATCGAAGAAGCGGAAGAGCGGGAACTCTATATACTCAAGGTACT CTTcctaaatttattttcaatcatggataaaacatttgaaacaatTGGGA TTgatttccctgcgaaattttaaacaccacaaatgatttttaagcgcgtt aaattacagagttttaactctgagttttaatacaagacttaagacttagg accttaggatctcaggatttaaaagtaATAAGGCTTGCAATAAAGCCTCT AGAAGCCTTCGAACCcctttaaaatcgaaatattcaatgaaaggaagtgg aagtgctaaaatagcaattctcgtatgagctttaaattctgaaaaacgtt aaaatgcactaaattgtcaatatatttcgaccatgatgaTTGTAGCATGT TTgaagttgaagaaaaaatagaaacaaaaatagACAGTCATTCAAATATT AGTTTGAGATTCGTTTTCTCAACGAATCATTTCTCAACCATTTATAAAGC AATCAAAATATCTCTATATCTAACATAGAAACCAGATTTCAAACTAGTTC TCTTATAGGTtctaaataaacgccccccccgcTTCGAAacttttccaacc cccccccccggaccttattaggacccccccgtttattaattcttaagaat attttcagttggcaaaaagtccccttattttgctccaatcTCCAACCCct ccggcaattaggtccccccgtttattaaaatttcgaaaattttccaaccc cccccccggaccttattaggacccccccgtttattaatttttaagaatat tttcagttggcaaaaagtccccttattttgctccaatcTCCAACCCctcc ggcaattaggtccccccgtttattaaaatttcgaaaattttccaaccctc tcgtttattcgaaccccctcgtttattcgaccccccccgtttatttggaa cctaagagtaagagTCAACTGTTAAAATGTTATTGGGAAAGTTTTACCAC CTCCATCCCCCGATGTCGAAGAAGTCGGAGTTAACGTCTAGAGACCTAAG ATTTTTGGTCCTTTAAAAAGAGACTAAAAGAATTGAGGGCCAGCTGTTGA CCTTTCAAAAATGACCTCGACTTTCCTTTTTCCTTTTTGAACAGCCAATT TAGCCTTTATATGTTTCACCATTTATAATTTAtagtgatttattttttag ctCAGTCGAATGATAAAAAGCTTGAATGAAAAAGTTGACGAATTGACAAC TACGATACGGTATTGTACATTGTTTTGTTTATAGAACAGTTTGGCGCAGC CCTTCTCAGGTTTCACCTCCCTTCTCACACACTCGGAAGgttttttttca gccaatgggggtaaaaataacacgATTGGGTTTgatatttccattttttt ttcagcggagacaaaaattggagtttaGTTTTTTCACGGGGGACGACGAT ATTTTGGCTATATTTTCCAGTAGGAAGGAATCCCTGTTTGTTAGAAGCAA GGACATGTACTATTGCCTATGTGGAACTGTTGATGTGTCTGTCTTGAATA ATATTAAATAATATATTcttgaatgttgtaaattaaaattcgatttgaat tttttactATACTTGTGATCATGGTGCAAAGAAGAAACTGAAACGTCaag aaatgaataaaattaaatttttagttttcactcTTATTATTGATATTTAC TGCGCTTATTTTTCTGGTCTGCTGataattgagatttttttttgtctgaa tTATCTTGAAATTATTATAACATTATTTTCCTGAAATTTGcctgcaaaaa aaaacttcttacattcactttttagtgaaaatgaaCGAACTCTTGAAGAG TACGAGCAAAAGGAGAGAGTCTTGAAAGAAATGATTCATGCTAAAGATAA TTCAATCATCGCCTTGACGAACCAGGTATGACCGTTAATTTTAAAGCCTC TAATGGGCTAGATttgaaactcttggatgggaaaagaggcaacgtatttc ccatccaagactCTCGAGTGCTTTTGACACAAACGCAAGATTGAAATTAA ACCAATCGctaaatttttagaaatataccccttaaaaccaaaGAAAGGGA TAgctcatggcgttctaaattcaaGGCACTGCAATGACATCATTAATTAG GTCCACAGGATTTTGATGTCAAAGCACGATTGCTAGGCCTTGAATTTAAA ACGCCATGGGATAGATTCAATACGTCATTCTAAATGCGGCGCAAATCTTC GCAAGGATtcgctttttcttgcttgagaaaggttaagATTCCTCTATCTT TcagggctttaaactcaatgtggAAACTGCTGGTTTCAGTCGAACTCTCT CTCAATAGTTCGATCTTCAATGGATTGTTTTCAAACTATTAAAAGGCTGA AATTAAAGTCTTTTGTGAAGTCATTTCAATTGAGGCATAACCCTTGATCG GATTTTTTGTGGCACTGGTCGGGGTTGGCTGAAATTGTACACATTCataa cttttttattattttgagttttgtttcgCAATAGCTCCAATGTGAGCCTC TGGGTTTGGCTTTAAGCACACAAACGTTACGTTTTTCTTGGAAAACACCA TGGATATGCAACCTTTTTTGATACTCATATCATACACCCCCTGAAtgtcc gatatcctcaacactCCCACATACATTTTTTACTTGGAAATCTCATTGCT GGAAAAATGAACTTGATCTACACGGTGATTTGATATTATGTTTTTGTTGC TGATTTTGGTTTGCTTCTATACTATAATACTTGAGTTTGAGAGACCAAAA TCTTAATACCTCTACACTTAGTTGCTTTTGGTTTAGTGTTTAGGATTTTT TCCCTCTAGATATCTTTTTCTTCCTATGGTCAGTTAAAATAATCTGTTTT TCTCTCTCCTCCTTTCTATTAACTGTTATTTTCTTGTAAtctaaaaacat aaattttccAAATTAAAATCTGCTGTATTTTTATCTTGTTATCTTTGCTG tgtatatttttctttctctcgaaaaaaattatcaatgttttatgagaaat tttataTCTTTAATGAAGTTGAagtagaagattttttttccttttttata ccATCTCTCGCATCGTTCACGGGAATACTGGTATGTCTCCGAGTTACTGT TAAATGTATTTAGATGCGGTTTTGTTTTAAGTTCTTTTTTTATGTGATAT CGAACAGTATCGAAAGGAGGCACGCtttttatgctgacaaagcataatta acaaaagaatttttcaaattttgtgctCGCGCTGAGTGGAAGAggagaaa tttgtttttttcttatgtttagaaaaaatgctgtgtaagcaaatggtagg agatacacgtttttttattagaacacctaaatttggctgagcctggaaaT GCTTATTTtgttagcaattttcagcctagaCTGTTCTtgaatgcgttctt aatttttcagactactctaaattgacaatatcatgcaaaataaagagcac ttaaaattggtaaaatttggacaatatttgactctcgactttagaaaatc catccctaagttcggttaaaactgcttgaaaagaggagaaaattgtagtt tcttgtcattttttccaaacaTGTCATGTTCATGGTCATGTTCTTACGGT GTTCTTAATTTATCGAcgtaaatgttcttataaactgggttctgataaaa agaaacgtgtacGTTAAATGGTGTTCTTTAAAGGCACCACCGACTCTAAT AATCGGAAATAATCACAATTTAAGGCCTCAATAGTTAGGATCTAGGTCAG GGACGTGCCCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNATGGGCTAAATCTAAAAATCAGAATGGAGACTAGGGAACCAAGGC TACGAGTAGGGATATTAGAAGAATTGAAGTCAGAATTAatttaaaactaa aatggcctcAATAGTTAGGATCTAGGTCAGGGAGGTGCCCCTCGGGGGAG GGGGCACTCGaatttgaaaacgaccgtatgttcggccaaaaatcaggtct ctaaaatcggatccttacagtgcaggaaaaatttggctgaaaatcgaccc ttacagtgcaatttttcgaaatcttttgcccttttcagggcaaatttttt gaaatttctcaaattttacctcaaaatttgataattttacacccttacag tgcactttttcccactttcTCACAAATCAACCTTTACAGTGCACTtccca aagtccaaaaaaactacccttaagggccgcacgtccggtaggtcacttac ctggagtgccccccaCGGGGGGAGGtggcaagcagttagtacactTAATA CGGTGGTGGTCCACTACAGTTTTTACACCCAGTGTACTAAGTGCAAAAAC AGGTTGTATGCTTAGCACTTAACAGCTAATTTTGTGTACTAACTGCCTAA AATCAATTGGGATTTGGGGGGGTGGTGTATTTGAGGGTGATGTATTGAAA TTAGACCACAAAAACAGTTAGTACCTTGCAGACCTTgtctttcattaaaa aattaaaatattcattTGACCTCAtggcgaaaaaaaaattaagtaccTTT GCGAAAAGATTCCCAAAACCCCTTTAATTTGAAAACTAGATAAGTTTGAC ATTAAAAAATTCTGGTTTAGTAGGAATATTCCTTTCTACATCTAGCTTAA ACTTCAATTTCACTTTAAAACGGTTTTTACAGCTGATAGGAAAGCTAGAA TGTAAAGGTTTGAGTcttctttgacgtcaattaaTTGCTActgtaaacaa cacaaaaagtaGTGATCTTGCGAGAATATTCATAACTTTAAATTCATTTG AGGTAACTTTGCCAAACTTTTAGAAATGTTTGGAAATAAAACGTACAAta ctcacaaaaaaattcaagccGTTCAACTGAATAGAAAAATGTACGTCATA GATTGTAAAATAGGGGCGttttttttgacacacccgGTACATGGTGTAGA ACATTGTGATAAGAGTTGGTAGtccttttcgaaattttcagaaATCAGTT AGTACTCACAGTGTTCTAAagtaactgcttgaccccctctGTCTAAGCTG CAAATCAAACATTGTTGCTACCCCAGGTTACCTTCCAAAGGGAATTGAGA TGTGTGCAGTCTAGATATAGGGACTAGCCTGTCTCAATACAATAGCATAC CGCAGTAATTCTAAAagacatcaaaattactgtttgtccgagtttaatcc catcatcctttgcatTACTTACTTTTGCAAGTTAATtacacttattgaca atacaaaagtaaaatttacacgcattacgaatcaagatgaaaagtattgt gggattgaatttcggtcaaatgttaaaagtaataattatgacgtttctAT ATCGGTGTGCTATTGATTTAGTCAATTTTGTTCTCTTGTCTTGCCTTATC AAGAAATGTAATGATATGAATTTGGACTAGGTCCACATGGAATACATCTA AATGAGAAAGAAGGCCTTATGATTAGGTATTATTCATATGGGCGTGATAC CACCCCACCAATGGTCAATTGTAGAATTTCATTACTACAGctgagtctct ttaactcaagCCTCTATAACGCGGAATGTCTCCTAAACACGAACAAGTTG TCTATTCTACTCAGTTAACAATGCATTTATATAAACCTTGTTCGAAATTT CAATAATTCGAATTTGTGTTTCCCATgcgggttcgagttatgaagacttc ACTTGTATTATCTATCTGTATCGTTTCCATTCATTCGTTGTCTAGGTATT TTCTTTGGAAGAGAAAGAAACAACAGACGTCGCTCAAGATGTATTGATAG CTTTTGAAGAGAAACCGTCAGAGTATGTTTTTATCGTTCATTTATTCATT CCTTTGTTCCTTGTTTAACTGCTCGTCGAATTATAAGTCATTAATTTCTT AATTCTTATATCTTGACGTAAGTTGAATATCATTAGTCCTTATTCTGTAT TTTCTTTGTCACAATATCACGCATGCAAAGGAATGGACGtcccgttcgtt cgttcgttcgttcgttcgttcgttcgttcgttcgttcgttcgttcgttcg ttcgttcgttcgttcgttcgttcgttcgttcgttcgcttcCTAAGAGCGT CATTTGCCCTATTTTACTTTGTTttataaattcattttttttttaattta ctcTGACGTAACGTGAACTGTTGAAGATTATTTGTAATCCTTATTTTGTG TTTTCTTGGTCTAACCACTAGTTCACTGTTAACTATCAAATATACAATTT CAATGTtattaaaaacattattaattttCTTCCCTTTAGAATGACTGATA GCAATTCATCGCCTATTGAACTAGACTACGACCAACTAAAGGTTTGCCAA AGAGTTTTGTTTTTGGGAAATTcggcatagtgtcctccccaccaattttc caattttggatgggtgaggggggaaatgaaaatttgaatggtaaaggggg gggggggggggggggaaaaaNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNa aattttacgtttgtgtcaggttgaaatttgagaaatttatatgggtatat ggggggaactgatattttcagaattttctggggggaaagcaaaaaagaga gGGGAagctaaaaaactgaaaagtcatagggggaaaaaaGAGGGAGGAGA TTTAAAacaatcaagaatttggtggggtaggaacaaaccctggaggacac tatgattcGGTTTTCTTCTTCACATCTTTCAGGCTCAAATAATGCATAAG TAAAGAACACAAGAAAAGGTTAAAAATGTGAAATGAAATTATCTTCGTTA GATTTGTTCAGTGTATTACTAACGCTATACTAACTGTTTATGAGAGCAAT ACCCTGAAATATTGAGTGATGTCAAAAAGTATTGTCCCGAGTAGGTActt tatcggccctttttacaccggcccttattggcgtcaTTTTTTGGCTTGTG GTGTAATGAGGGCCTGCGTACTTACTGGACCTACTTGAACTTACTTGGag atcctataaattaacccatgtacgcttttctcgagattggctcatttttt tgcatttaaGAATGTGTATCATAACCCTCGATAAAGCCCACGATAAACCA GGATAAACGAAAATAGTAATTCCCAAAATGTggcagagcccaattttcga aaaaaataatttccggTCGCCAGATCCTGTAATGGCCGGCGGAAAAACGG GAATTTAACGTTTTCTGTTCATCAGTCAGGTAGGTCCATATATATCATAA GTATAATAACATGCGACCGGAGCATGAAGGAAGAGCATCCAgatacggtg cgcaaggttgtgggttcgatccccagccgggtcataccaaagatttccaa aatgttacttgatgcctctctgcttgatgttcagcaactaaagagatgga tcaagggtaagtggagaaatccagggaaaggagtaaCGCCCTCCCCTAAC TTCAGGgaagacagctatacgaaaggggcggagcctttgggtcgcccTCG ACTTCGGTCGCAAACTTGCTTactatatatggtgaagatcagagatctga cctcaaggagagaaagtgttgaaaatacgaaataaaataaagatgaaaca taaaaaggcactaatattttNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNtttttttgaatttttcta aatatataaatcaaaccaatcaaacatcctgtcaagaaatgagaatttta tgcgaaaaagaaccaacaaaccaatagacataaagtttagTTAATTTCTT TTTGTAGGAGGCTTGTTCAGCTTACCAagctcaaaacaattttttgaaca GTGAAATATTGGAGTTACACAAACTACGTACATTGGATGCTGAAAAGATA TTGAATGCAAATGAGTAAGTGAAATATTCGCACGTGACGGCTCcatttcg ctccgaaacgaaatgaagccattctaccgggtgtcccagaaaaaagttca aagTTCACTTCAAAGGGGGGGGCTTTGAAGTGTAATTTCTCAAGTTGTAT GAACTGTTAAAGAATTGGTCCTTTTTCATTagaaagaggaaggataaact tgTTGGGGTTGTTTGTTAAATTCGGTTAACTACACCAAAGGTTATGgact aaatgctaaaatattacTTCTCACAAAAGTCgaaaaagcgaaaaatgagG GTATTAAATTTATTACAAAGATACAAAAATTTGCTAAGATTCTGAAATTT TTAGGGCTTGAAAAAGTATCATGTCTCTTGATGATACTCATGGAAGCTCG TTAAATTAGACAATTaaacaaaaggaaaattattataAAGACACCTTAAA GAACAACATGGAAAGACTTTGATCGTTAATAAATTGATAAAAGAAGtgct ttctttatgatgatttaATACCCTCGTGTTTTgcctttttcagttttttt gaaaagtaataaaTTAGCATTTAGGCCGTAACTTTTGATGTAGTtaacca aatttgacaaagaacccctcaaaatttaggtttatccttcctctttccaa tgcaaaatgATTGATTCTTTAACAGTTCATAGAACTCAGGAAATCTCACT TCAAAGAGgggggacttttttctgggacacccggtattgGTTAGAAATGA CGTAACACTaaaatgtaaccaatagaatggcttcattggtactacccttg ccgaccgacgggagTCTTCCACTGAGATCCGAAAAATGGATCCtacgcgt ttttttttttttttgctctgaatgagactgaaattcagaaaattttctct cttttttttaattcccCTAAAACGGCTCTCTACAAGAGACGATAATTTTT CTATGTTGCTGATTTTTCAACCCTACCTAGGCCTCATGCGCGCGTATCTT GTTTGGTAAAATGTGCGCACGATATACTAAATTGGTCCCTTTATggctaa acatttttgaaaatacagTGTTCGTGCATGACTACATGACTACATGACAC CGCGGATTCTCGTATTTCCTCAGATCGCATCGCTTTCGACACTAAATCCT CATATTGAAGTAAAAGAActcttctttttggacctaccccggtggggtgg aggtcctataaattaacctgtgttcgtccgtccgttcgtccgttcgtctg ttaccaacttttctcaggattgaatcNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNTTGTATTTTGACCaattatgtcttatgtgtt tcattgtttcaatgttcattgattagtttgataaccaggtaggtccataa aagtatcacttgttttgatatttttgataacttaagataattgaaataga actataaagataacttttatgtacaaacagtatgaagtaagccctaaata ctaatgtatcaactactaacgaagtctgcggccgggtcagtaaattattt ttttcacccggcctGTTTCtagaaacactacattttttattttcacctta ttggtttgttttccctcgcgggtgacgtctagtataggctgatcttttta ttttcgttttcagTAACCTTGAGATGAAAGAAGCGGAGGTGATCAAAATC AGAAGTCGATATTTATGGTTACTTAAAGATTGTGCTGGACCTAAACGAGG TATAAACTTAATCTTAATCGTACACTATCACTgagctgttccattaaaaa tccaTACAGTGGATACCCTCTAGAAatagtaaaatttgcaaaaaaaaaaa cccttggaaaaattctttactTAACGTTGCACTAactaaaaccagttttt tgctccctgaaaatttaagaataaccTTTTTACCGccttgaataattaaa aaaacacaCCTTGGGACACCCTGGAAATCATTCTCgaattatcccctgga aatgttcgtccaccccctcccctgtatggatatacgGGAAATAGAATGGC CCAATCCTTAGCGGCGCGGTTGGCTTTTGAGGAGTTTTTGTAATAAAATT ACAaggaaatagaccttttcataaaattacgtcacgaacatcacttgcct cgttttgaaattattgccatgatgattaactcccagcggattttgttgaa actattttctattcataaaaaaattatttaatgtcagggacataATCGCc gtggtaattgtttgaatacgaggcaagtgatgttcgtgacgtaacttatg aaaaggtctattacgtCAAAATTCATTGTCTATAAGGATGTTAAGTAacc aatatttttattttacggaCCAGAATCTATTGTAGAGTTAATTAAGTCAA CGGTTAATAAACGATTAAagagacataaaagtagtaaaatgtaaacattt cgCGAACCGCGTGTCatttaaagagaacaattaaaatcacgtgtccaaaa caaacttgtaaaacaattgaaacaatcaaagtcagccatatttgttttta atttttattttgacatgtgacatttgttttgattttgtatcccgctgcat acgatttgtttacaaatttcaaaagtacttttatgtccctttaacttATC TCATTATTTGAGAGTGGTatgaatttagaaattttgaccagtgatagata agtactagttatcgcatgacttcgagtgcaatacgagaaatattttacga gtgccgagatttttccgtaatatttttccgagcctttaggcgaggaNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNcggtcatatttccatactagagaaatatgaa atatcgcaaatatctcgatgctctcgaccaatcaaaacgctgatattttt ttgggtcggcaataataaGGATAATGCAAAGTAAAATTCATTGTTTTGAG CCAGTCCACGTTCaatggtattttacagaccagaatttaTGAAAGGGTTG ATAAGTCGGTAATCAATGATTAATAAgaaatcaatttattttcaatcgaT ATTTCATGGTTGGAAAGTACCATGggcttgttttattttttttgtatttt ttttactaaattgttgccatttttcctgttttcttattacatcaatcttc ttTTAATGctataaatgttcttattttcggcattgtctaaaggccggtct ccactttcacgcgaaatgggcgacagtttttttcttaattttttttgtca taaaaaagtttcgtgcgagcaaaaaaaagttgaaggaagttctacttttt tcatccgttacgtcaattttgaccaatggaattgcttcatttttcaaccg accaatgaccttacaaaaacgtcaaaaagtttttaggcCTTAAGTATTTT GGCCCAATTACCTCGGTCTCCTCAGATATTGCATGTTTTAGAGCATTAGA CTTTCttagaatgtttttaaatttttaacctcttggccttatgttcttat tataaaaaaatatatcaattaaagtttacaaattaaaaaaatgcctaaaa aatataatcaagaaataaaattttcatcattttcgtATGAACTGAAACAA TGTTCCTTTTGTGAGCTACATTTGCTACAGTGCAATGCTATTCGATTGAC CAACACTCACAAATTAGTCTAACATCGGTCCATACGTAGCTCTGATACGA ATGTTCGTCGTATCTATATGATGTTTTTCCAATGTTGCACGAACTGTTTC CacctcaatttcaatttcaaattgcCACTGTAATGTTATTAGTTTTTGGT AAGATGTTATGCGGTTTAAGAAATCCAACGCTTCTTTCGTGTTTAGAGGA AATCTTTTATCTATTAAGATGCGGAAATTATTTGCATTTTTCAACCATTC ATAAAAAATCGTGTTCAGAAAAGAAGGGTTCCCAGCCACCCAAAATTCAC TATCTTTTACATTATATCTCCAGTATGTATCTGTGCGGAAAATATTTATT ACTGCGTCATATTCACCAATGCTGGATAATGCTAATGAAATCAAGTATTG TTCTGCTTCATCAATGGACGGTGTCCTGTTATTGATTCCTAGTTTCGTTA TTGTCGTTACTTTCGATTGTTTGATTAAGTTGACAATATTTTGTGCATCT CTATATCCATTAACATGAAGCTCTGCTGATTTCAATTCAGGCGATATGAT GTTGCCACCACCTGATTCTTTGTACAAATTTAAGAATTCTATATGGTCAT TGTCATTGGCATCAATAAAAAGAATGTTGCCATCTTTGATCATACTTAAT GGTAGTTTCAGAAAAGCTCCAacgaattttttaaaagtttttgctttttt tcctttgaaaagtttaattttagTAAACCATCTTGATTGATATATTTCGA TCAACTTATCATAAAAAGTGACAAATAGTGTATTGTCTCCCGTTTCGAGC ATTCGTTGGACTCCGACCATGGTTGGCTTGCAACTTGATAATTCTCGGTT CGATTTGAAAGGTGTGATATCCTTCGTCACGCACAAGTGCAACGCGGTAT GATATTCGTGTAGTACCAAGTGTCGGAACTGGAACGTCGCTTTTTGCTTA TTCCCAGTCCGGTATTTAGTGACGAATCCGGTTTCTTCAATCGGGAAACG ACAACCCAAAGATCGGATATCGGATTCATTGAAAACGACTTTGTTTTCCA TGTATGTGGTGACAGATAGCTGCATGATAGAATACAACATTTCTACCACT TTTCGATCTTCTATGATGGACATGAGATTTGGGTATTGATTCGGTTTACT TTTGAAATGATTCCTGATGAAAATCAAAGAGGAATAGAAGTATAGTTCTG TTTGTGTGTTTATAGAGTTTTTCAGCAGGTTTTCTTTGTAAACACTACAA ATAACAAACAGAAAGACTGGAACACGTGCCATTAGACGTAAATCATATGA TTGGACGATTAAATCTTTGACAGTTGTTGCTTTCTCAACATTTTCACCGA AAAAATTGTCGATGTATTTAACGATGTTTTCGTCGTCAAATCCGCACACT TCAATGGTTTTTCTTTTAGAGTTTGTCGGTAGTTTGGTTTTGACATACTC GATAGCCTTTGGTCTGCCGCATGCTAACACTTTGTGGTTTTTGAGCCAAT CTCCTTTTGGTTCGAGTAGTTTGAAGACTAGCTGTGCTAGACTGGTTTTT GAGAAAGCTCCAGGTTTGCTTTCGACGTAAATGTCCTTGAGCTCATCGAG ACCATCGATAATCACCAATACTCTATCAGATATCTCCATCAAATCGTCGA AAGTGATCGACTCAAATACCTTGGGAAATTTCAGTTCAAANTTCATCGAG ACCATCGACAATCACCAATACTCTATCAGATATCTCCATCAAATCGTCGA AAGTGATCGACTCAAACACCTTGGGAAATTTCAGTTCAAAGAGTTCCTGG AGGTTAGAGAATTTACCGGAAGCATCATTTAAGTCCCGGCAAGTGAATTT GAAGAGGAATTTGATCGCTGAGAGATCAGGAATCTCACCTTTAGCCCATT TATAAGTGAGCATATCCAATAAACTCGTTTTACCGATACCCCCAATACCC CTGATGAACACGAGTTCATCATTGGGCAAGAGGACTTGGTTTATGGATTT ATGGATGGtggtttttggaagattctCATGTTCCATCAAAGCAGCACGAT CGGAGTTGGACCATTCTTTATCAACAATAGTAGAAGGTAACACCACAAGA TCGATAAAGACATCTTCTCGCATTACATAATCGGTTTCCCCGTCGGTTTC AGAAAGCGGCTTTTCAATCAGACATCTGATCAACTCGTCTTCATAATGCT CCTCAAGTTTCTGTGATGCGGCGCGAAGTGCTGAAAAATTAGATAATTAG AGTTTtaagttaaccctttgagcatcTTTGAGAAACATATAGCCCTCTAT TTTGAgcaaaacattttcattaattttgataGGCTTGACACATTCTGACA TTATTACGTCAttgccacctgatgacgtcataaaattttgatgtatccGA AAAAGAGCCTTGTCTAATTTTTTCCgcttttttgctcaaattttctGTAC CATCTCACCTTGGCATTATAAACTAGGAGCGGGGCGTGGGGTCAATGTTT GTCACCTCAAAGCTTTTTACTCATAGTAGGCCCGATTGATGTAATTATCT TGCAAAAATTGAAACGAAGCACAAGATTTGAAACAAACTTGCtgaatacc gtaagttggtctgttatcgacatccctcatctaatccCGACACCCTTCtc tagataggaataatataattttgaaaaaatccaaaGTTTTGAATTCTAAA GTTAGTTCATTCAAAGCTCGGACATTAAATGGATTAAAAGAATTCCTGGG AATTCTAATTCTTCTAAGACAAGGatgatttcaattttgaccTCCCCCTC CTATTATATTATGTCTTGAAATGACGCTGTTTCAGACTGATATTACCCAG AAATTAAGCTTTTGAAATTGTAAATCATGATAAATAAGTTTGAACTTTTC GAAATCAAGTGTGATCACACTAAACTTCATTTGATCAGTAGTAACCTCGC CAGTTTAAATTACCTTTGGTGATGAGAGTATTTTCCTGGATCTGTTTGAC CACATCGCGTCTTCCGATCACTTCCAATTCTCTCTTGATATCTAACCATT TCTCATCTTCCAATTTCGTTACCAGATCTTTCAATGGATCACCATCATCA TCGATACCAAGGTTCTTTAGAAGTTCTCTTGATTCGTTTTTTGTGATGGT TTTGGAGATATGGTCAAGGGCTTCTTTAACACAAGTCGAACCTGTGTAAA ATAATGTTGTATNCTGTGATGTTCTTTGAGATATGGTCCAGGGCTTCTTT AACACAAGTTGAACCTAAGATCGAATGCACAAAGTTTGATTTCATCTCTT TAACAAAACGGCAAAAAAAGTATCGTGTTGAGCATGttattgagtagaaa agtttgctTGCCAAAAAACAATGAGAAAGTACTCCGACCATCATACATGC Agacttaggcgagaccaatttaatttgttgttctacgggcagatcgttag caaaatatgggtcggtcggtcggtgaaataagaaaattttttcatttatc agggttggtaaagtaccgaaaatgttttccaaaaaatatctggttcaaaa atgcactttttttatcttcgatgaagagatcataataaaatcttagtgta tggaatgcttgattttctaaatttttcaatttcttgaattaattttcggc tttattcaaatttgattcttacaaataacttgtgtgtaaaatatattgta gtggaaattcaatattattatttttttgattttggcaaaaatagggtcgg ttggacccgtagaacaacaaattaaattggtctcgccttattacaaatat ttgttttaacgtatcaatcaatcactagcTCTCTTTATTTATTCCCTTGT TGCACCTGGTTCCACAAATGTAGAAAAGGAAAAAGATGGAGAAACTCAAA ATACAATTGATTCAAATACAcccgttttcttaggaaaatggcNGAAACTC AAAATACAATCGTTTGGCTAAACATAGTTGTGTTTCGGCTCCGAGGAAAC CTCAATAACTAAAGCATGCTTTAATTTTCCAGTGTGACTCCCCCctatag ttgtgtttcgacttgatactttttttacggacactctattgtttttataa gaacaaactatataagaacataaggcttcgatggccaaaatattaagaac aatttaagaacatttttaaggctttgataAATACAcccgttttcttagga aaatggtcacaaaatggtgaaaataagaagatTTTAGGAACATTTTGAGG Ctcgaaacccaaaaagttaagaacatcccaaggctgcaaaaattttggat gttcttataataaaaaaaatgtgtatcatACCTGCTGGTTTTTGTTGAAT TGTTTTGATTCGGCTTCTCAACGTTTTGATTTCATTCCCCAAGACGATTA ATTGCTGTTGAAGGTTTGTTTTATCTTTGGCATATTGTTGTAACGAATTG AAAACATTGTCGTAACGAGGGTCAAGAGATTGAGTTTGAAGTTTTGCGGT CAGGAAAGTAAATCCAAAGTTGTTGATAATTTGTTCTCCTTCTAGCCATT TTTGATTGAACATTGCTTGCGTTATGGTGTCAGGGTCCGTGTGATGGACA AAGTTACGCCATTCGCGTGCACGAATCACGAATGCTGCGATACTTAAATC GTTAGCTGGAGGATTTTTGTCATTCCAACCGTTTATAGGTGCGGGTATTG TCGTGAAGTTTCGTATGAGTATGCATAATAAAGTGACGTCGAAAGTACTT GAATCTGTTGCGTTCCCGCTCGGTGGTAGAAGGAGATCGAGTTGATCTTG CTGTAGAACTTTTCCTTTCAATTTGTTGATTTTCCTTTGATTGACAAGCG TTGAGAGCTCTTGGAATAGTAGTTGAGGATTTTGAGGCAATCCTTTGTAC GATGGATCATTTCCAAGGTTGTGTAAAATCCATATGAGGAACAACTTAAG TGGTTCATGTAAGAATGTTGCTAGTCTCAGCCAGAATTGAATATCGTTGA TGAGTTTTTCAATGGAGCGATTCATCTTGCTTCACctaagaaagaaacaa aaatatgtACGTTAATAGGGTTGGCGGATTTTAAAACCAATGTTGAATTA TGCACCCGGGGGGAATCTAGCATGTAATGCATACCTCAAgcaaaaattta gcatttttgtGGAACGTTTTAGCATTGCTGGTGAATAATTGGCAATTTGA TGGtgaaatgctctaaaaatggcttCTTATAGGTGCAGCCCAGGGGGGGG GCAGCTgagcaaaaggaccgacgggtatgtgcgggtcctaagggtaccat ttccaatatgtttaaaagcactgtaagggttggaaaaactagagatgcac tgtaagggtagaaatttcagaaaattcttgaaaaatctagatattttgac caaaaatgctagaattttgaccattttttgcacgaaagggatcgaataTT TGGTGGGTCTCCTTAGTTGGAAGGttgtttaaattactctctgtaattcg aaagtttctctaattcgaataacaTTTTTGGCTCctcgaagatcgaatta gagggaGTGAACcgtataaaaatgtttttcctttcaaaagtattttgtaa attCATAGAAATCACGTTTCTTTCTCGtgacatttttttaaagctACAAG ATAATTGACAAAACAAactacaaaataaataaactacAAAGCAACTGTAT TTCTTTTGAATAACAATTGCATAATAATTTTCtacaagaaaaatatcaaa tgaaagttgttgtttttttttcaagggtTTAAAGTTTTGCTACTTGATCA AAATTATCAGTTTGACCCATATTTTACTTCTTTAGAATCAATTAAGGAGT TGTTACAATTTAGATATTTTGTCCTAGCTTTTAAATTTTGTATCAAACCT TTGAATATAAGATCAATTTAGTTTCCTATAAAGAAAGGTGTTTGATTACA TTCCCTCTTTGCATTGTAAGGTAATAATGTTTGTTCATCTtgtttaaaga aacaacaaaaataataatttttttctctctcattTGTCTTATATTGtata cgtttttataagaagaaattATATAcgagcttcgatggccaaaatattaa gaacaagttgagaatcGGACCATTGCGGGTATTTCCTTCtaggaaaatgg aaaaacaaaggggggaaaataagaacatgttaagaacatttttatgctta aattccaaaaagttaagaacatccgaagccttcaaaaaaatgatgttctt taaaaaaaatgtgtttccATTTTATATAGCATCATATAGCATCATCAATA CAATCCCGAAGCTTCGCCTTCTCGCTGAGTAGGATGAAGTTATGTATGTA CGTATGTATGTATCAATACAATATCTTCTCAATTCTCGAAACTTGATACA GTTGAATTtcgctacacgcttttttttataagaatggtgtaaatccattt catcatggatattcttaacttttttgggaaaatcatcctaaaatattctt acagcattcttaggttatgaTCCTAATTGACTAAAGAATggtctaaaaat gacattcttagcttgagtagcaaaattctatgatggtgatattcttagca tattcttcattttttggccattttcatcatggacattcttataaagtgta ttcttataaaaaaaagcgtgtaattcgaactcgaacggggaattTTATTT GTTCGAACTATAGAATGCATTTTAAGAAGGTTTTTTCTTGACGGGGACTA AGATTGGAATAATAGAAGTTCCAATAAGCGAGAGTTTACTGTATATGATG CCTTCTTGTAAAAAcccttttcgctagaggatgagcagaagcctattcGA ACCTAAGTTCAAATACACGATATCGGCCAGGGTTGATTTTTTCGGCCAAC TAAATCCAAAATTCCTATTACGTACTTACTTCAAACATGTGTCTTAAAAC TTgtcccttttcacagacccggtaggattctttcagccagtggggataaa agtaacggaaacttgatggggattgatattctcatattttttatgtatgg ggatttcaattattttgtttaaaagtcaaaaaatttaatgGGGATTGAGA AAATAGCATATGTTTTGcggtgaggattggtttatttgattattttcagt ggtgACTAAAATTGGAGGACAATTTTCCTCCGGGAACGATATTTTGGAGA CCCaggggtctgtgagaagggggtgtgtgaTAATTGCCAAACGCtagaca ttttttatttttcctaatGCTGTTAAGATTCTCGATCACTTTCACTTAGA ATTAGCCTCGATAATTCACCAAACACCGACCCCCCTCAATAAGTAATATT CATCAGGGCTGCAAAATACATATTTCTACGAATGTATTAAAGGTTAAGAG ATGCTTCAAAAGTGTTCTACAGTGTGAAGGTGCCTGATACAATTTTCAGA AACAAAATACACAActactttaagtttcatgttaATACAATCGTTAGCTG TACAAGActagatgaaaaaaattcctttttatataaattacGAAAGGTTA GATATACTTGACCTGGGCATATAAACGTTTTTAAGAATGAATCTAAAAAG TTGGTGAGGTAACTTACATACCCTGTCAAAACCAAACTTCAATCAAACAt caaattgtaaattttatcAATAATAAAACGAAACAAAACAACTTTCCTTC TCATACATCAAGACCttaacttttttacaaacagtATTATCTATCAATTT ACTTAGAGCAACATCACATCCAAATTTTTGTATTGTTATTTTAATCCGCA ACGACAAGTATATGtcaatttttgctttttaagcacacgttttttttttt tacaagaatgttGTTTTTCCGTGATACAAAATAATGTTGTTTTATCGGTA TAATTTCTTCACTAATGCATATGCGAGACGTAAGAATTTGGTTGTATATG ATTGATTCGATATCGAAAAGTCTATTAGGTTATACCGCTTGAAATATCAC TTTTGCTAAACTAAAATCAAAAGTCATGAATCGAAACAACTCTGAACCAT TTTcccacaaaaataaacaactgttgctactgtttttttgtttgtttttc tgtgggttttatgctttaatgagttgaattagATCACGATTTTTGTGTGA attggttgatgatgaagttctTTCATTATTCCTTCCAGTGGCGTGATGGG GCCAAGCAAAATTTGGCGccctttttagaaattttctgtttttggcGACC CCTCTCTACACATTTAATTTGCTTACGAATACAAACTAAGCACTGGAGCT AAGATCGTTTTAAATTTTATTAGGTTTTTCTCCTATTATAGCtagtttct tacaaaaaattcatttgatAATCGAACAACTAAATCATAAACAGAGAGAA GAGTGTGCGAGGGAAGCGAGCCAGCGAAATTCAGAGTTTGTGAGTTGATA AGGGGCGccatttttggtttttcaattGCCGATCTTTCGATAGGGTCATC TAAAAAATCCCTCTTGGCACCCCTTATTTTTCGGCACCCCTTCTAAAATG GCATTCGCTGGTAGGGCCTGGCCCAACCCCCTACCACCACGCCACTGATt ccttcctggatttgatgttttgtttccatttaatTGGTTTGGAATGAGAG AGATGCAATCTCTTGATAAAATAGGACCCTTTCGTCAACTTTCACCGCAA CTAACTAACTGCctttatatttacataaattgtAACAAGGCAAATGGCTG AAAATTGTGACGCGTCTCTATGCTAtactgttttcttttctttttcgttg GAACATTTTCGTCTTCATTCAGCATGTTCCCGACTACCTATATCAGGTAG GTCTATTCAACATgttgctttttggacctacctcacAGGTCTTTTaattt aacctttgttcgttcgTCCTTCCGTTCGTGCGTTCTTCCGTTCGTCTGtc accagcttttctcggggcTGGCccattaaatttttctgattttttgcata gtgatgcaaaatgacagttCTTAAAAAATAAGAGAGCCCagttttcgaaa agaaaatatttcgagtgcgaaatttgggccaaaaagtgcccaAAGTGCTT TGGCtgtaaaaatcagattttcttatttcggaacattcccttttgtcatt ttttggaaaaaataagcaTTTTTCTTAACGTCAGCATGGTGTCGATTATT TATCAATTTGTCAATAAAAAGTTTCGTCTGATAATTTGCTCACACTGTGC ACTCAATTGACTTGACACTAATCGAAACAGTTTCCAAAGCTTTGAAGTGG ATCGAAAAGTCACTTTAAccacaagtttttttttattgaagatCTTTATT GATAAGAATCAAATCCAATGTCTCTCAATTATAAAGCGGGCTTGTGTTAc acgtttatttataagaatacccAACATATTTGATAAATCAGACAAATTAC AGTCAAATCGAACGAGCCGATCAGTCAATTACATGATTTTGGTCAAGTAA AAATACCAACAGGACAGATGGCCAGACCAAAATTTCGTAAATCATCTCCA ATTATCCATGACTACTACTGGTCAANGTTAGAGGAAGTCCTCGGACTAGA CTCTATTTCAAGAAGATCTGCTGTGACTTACGcgttactgaaaatgaaat attgtaaagacGACTGATTTAGAGGCCAATGCGCCTACAAAAtgttaaat atgattatttcatagaggtcgatagacctgcgaaatatattacTATAAAT AAGATCATTTTGAACTGTATTAGTTTTTCCTCCTAACAGCtagtttctta caaaaaattcatttgataatagaaaaacaaaataaataaacacaaAACAG AGTGAGTGAGCGAAGCGAGCCAGCGAAGTATTGAGTTTGTGAGTTGATAA GGGGCGCCATTTTTGCTTTTTCAATTGCCGATCTTTCGTTATGGTCTCcg aaaaatccttcttggcgtccCTTATTTTTCGGCACCCCTTATAAAATGGG ATTCGCTGGTAGGGCCTGGCCCAACCCCCTACCACCACGCCACTGATTCC TTCCttgatttgatattttgtttccatttaatTGGTTTGGAATGAGAGTG ATGCAATCTCTTGATAAAATAGGACCCTTTCGTCAACTTTCACAActaac taacttcaattttgcctgtATTTTTACTCTTTCCTTTTTCGTTCGAACAT TTTCGTCTTCATTCAGCATGTTCCCGACTACCTATATCAGGTAGGTCTAT TCAACATGTTgcttattggacctacctcgcAGGTCCTTTgatttaacctt tgttcgttccTCCTTCCGTTCGTCCGTTCTTCCGTTCGTCTGtcaccagc ttttctcggggtTGGCccattaaatttttctgattttttacatagtgatg caaaatgacagttCTTAAAAAATAAGGGAGCCCagttttcgaaaagaaaa tgtTTCGAGTGcgaaatttgggccaaaaagtgcctaaaaatggttttttt tggACTTCGTGTGAAATtgctttcattaatttttattgattttattgcAT AAAGATAAATAAAGGagaaggttctctaaaaagtggctaaAGCAGTTTTC CGGAAATTCTTTTGgctgtaaaaatcggattttcttatttcggaaaattc tcttttatcatttttggaaaaaacgaGCATTTTTCTTAGTCAGCATGGTG TCGATTATTTatcaatttgtcaaaaaaaagttttgtctgATAATTTGCTC ACACTGTGCACTCAATTGACTTGACTAATCGAAACAGTTTCCAAAGCTTT GAAGTGGATCGAAAAGTCACGTGTGGAAATTGCCACTTTAAccacaagtt ttttttattgaagatattttttattcataagAATAACGTTCAATGTCTCT CAATTATAAAGCTGTCTTGTGTTAcacttttatttataagaatacccAAC ATATTTGATAAATCAGACAAATTACAGTCAAATCGAACGAGCCGATCAGT CAATTACATGATTTTGGTCAAGTAAAAATACCAACAGGACAGATGGCCAG ACCAAAATTTCGTAAATCATCTCCAATTATCCATGACTActactggtcaa aatttcaagttcatgCCACTTGCCaatcttgatatttttttaagggTCCT CGAGCCTCCCCCCTTCAAGATGATTCCCctagtaaaaaataggaagatgc tcgaagggttaatcacatcgtaagaacatttaagcctaaagatttcaaaa agttaagaacggcCCATTGTTAGCTCACAAGGTGTTGTTCTGGGGGTGTG ATAAATGTAAGAATTTGTAACTACGGTTTTCTTATGTCTTTACTCTATGA ACTCCGACATACTCTATTTCCAATATATTCCCTAGATAAAATTATCTCTA GGACCTGATAGCTATATCAACAACCTTGCGCATAATGATGCCCAAGGTGT GTTGATATTCGCTAGCATAGCTAACACCCATCCTGAGCCATAATtttctg gttcttataaaagaaaagcgtgtattgtTTTAGATAACCAAAAATGAAGA ATGTTTCCAGgcttgatacacgttttttataagaacaaacctatataaaa acatgaggctttgatggccaaaatgttaagaacaagttaaaaacaggCTT TTTGGACTCAAAAAGCACCCTTTTTcgtaggaaaatggtcaaagatACTC ACAAAAAGGTCAAAATAGGAACATGTtacgaacatttttaggcttaaaac tcaaaaagttaagaacatccgaaggcttcaaaaattttggatgttcttat aaaaaaacgtgtaatgtctTTATTATTCTGTTCTTATATTTAAAACGTCT CAGTATTGTCAAGAAGGTTAATTATACAAATGACGCTAATTAATTGCACA ATAACAATTCTCGTGTCAATGGGTGGCGGTTGACAATATGATTAACATAC TGCGTGATCATATCATAAAAACAAATTGTAAGAACAGATAGTAGTATTAT GTAATAGAGACAGAACGCTCTTTTTTTGACCAATAGAAATattcatcaca aaactttccaACCAAAACAAAGTGAAGTAAAAAGAAATGCTCCAACCAAA TTTTGAATTAGCTTCGATTTCTAGCTGTGATCCTTGCCCTTAGGGCAAGG CCTATTCCCTATGCTTAGGGTAGGGTAATTCTTCTTTCAAAGATATTCAT CGCAAAACGctcttttcaaccaataaagATTTATTCATCCAAAATGTTCA TACAAAGCATGTCTTTTTTCTTGCCGTCGCTTCCACTAAAGTTTGAATTA ACCTCGATGGCTATATCAAGATATTGAAATTCTGCTTATAAGGAATAGCC ATTTAAAAAATTAAGCTGACTTCTTTACATCTTTTCCAAGCGTAATTACC TTCCATTTAGggttttttttataggaatatcaATTGTTTCATTACTTTCT ATGCTCTTGATTTCTTGTGTATGTTTAAGAATGAAGAATCTAGAAGTGTT TCTATTCTAGGCATTTTGTGTGTATTATGCTATAATCTCCTAAGAAAATG TATATTCTAGAGTACTCAAAACCTTAGAATGTTCGTTCTCATgcaatttt tggccaaattctCATGTTCTTACATGGTTTGTTCTTATGTAAAATATTTG TGTTATCTTCTCTTTACATGCAATCTAATTTTTAATGACGCTTTAGCAAA TTGAGCAGTTACTTTGTGTAGGTATCTTGTCAACTACAcgggtttttata agaacatattaagaacctaaggtttcgatggccacAATATTAACACATTt tattaagaacattctaagactttgcagactctaaaacgctggatttctta gaaaaatgaacaaaatttctcaaaaaatcgcgaaaataagaacatgctaa gaacatttttaggcttaaaactcaaaaagttaagaacatccgacgaaggc ttcaaaaattttgaggatgttcttataaaagaaacgtgtagGTATTGTGT CAACTCATtaagaaattacaaaatttcgTTTATTCAATTCGTTACAGAGA TGGAtgtggattaattttcaaaacagaATATTATAGTTTTGTTTTTCATG TTGTTGACGTTAATTTGTACCATCTCATTGTCGTGTTTCTGGAGTTTGTT TATTTTAGCTGTGGATACAATTGgcgctctctctaattcgatttttaagg gaGGTTTGGATTGACATCGATCAGTAGAGCGTCGTTaataagagtttctt gttgacttCTTGTGACTTTCAATGTTtgttatcgaataatggagcgtatc gaaaaaTAGagtgtcgaattagagagcgtcaactgtagtatagtacacgt tttttataagaacaaaccgtTATAAGaacttcgatggctaaaataatTTA AGAACGATTTATGAACAATTTAAAAGGTTTTGTGGGCTTTAAAACATCCA ACTTCTTAGGGAAAATGCTTAGatatactcacaaaatggtgaaattaaga atatcttaagaacattttttaggcttaaaacttaaaaatgtaAGAGTATT TCAAGCACAGTTGACGATCTCTGATTCAATATttaaggggaattggattt acATTGGATAAGGGATAGTATAtcatcgtttatgagagtttcttgatGAC GGTGACCttaaatattatcgaataatggagtatATCGAATAgtaaaaatt cgaattagagagcttaAACTatagattttcatcgaataagggagtatATC GAATAGCAGAGTgttgtttatgagagtttcttgatGACAGTCATGACCtt aaatattatcgaataaggtAGTATATCGAATAGCAGagcgtcgaattaga gagcatcaactgtagtCTGTTTGTTTGTTGGGTGTTTGttgttctacacg ttttttataagagcatcctcaaaatttttgaagctttcggatgttctttc ctttttgggttttaaacttaaaaatgttcttaaaatgtttttaatttcac cattttgtcaccatttttacctattttcctaagaaattggctgttttaga gtcaacgaaaccttgaaatgttcttaacttgttcttaatattttggccat atggaagccttatgttcttatatagattgttcttgtaaaaaaacgtgtag tttacCATGTTCATCAAATCTTTCGAATTATACAGTACTCGATGCACGca tatttataagaacaaatgaTACAAAACTTCGATGGCTAAttatattaaga acaagttaagaatgtTTAAAGGCTTTGTGGAATATGAAAGACCAAGACAC ATTGTTCTTAAGATATTGCACGAAAATactcaaaattgtgaaaattagaa catcttaagaacattttttgggcttaaaacttaaaaattgaagaaCTGAT GCGAAGccttcaaacattttggatttttttataaaacaacGTGTATTTCA CACGGGGATAGTGTTTGCGCTTTTACTTTTTGTTTCGTTTGGAACTTAAA ACTAAAATCTCGTTCGTCTTTGTTTTGAATACAGCATGTCTGGAAAATAA GGAATAGTTATTTATATTATATTGTTAAttggttactttttcgaagcggg ctacacgactttttgcgcaatgcaattggttctttcgcatgacgacgggc ttacattgtccagagttgcccgtcgttaggaaactTCATTGTGACGTcgc tttttcaaaggaaaatgaacaatgcgttgacatcatttctctcatttttt atttctgacgtcagaaattatagcaattttttatctcttttcgcttgttt tttctgctttatttcgctatttttcctggataaagcgctaaaaatctatc gaagctgaaggaaacggttaataaatacaataatgaccggtttttttggg ctgtactgaaaatattaccctcggtcaacgcaaaaTTAAGGtttatttta aggtttttattaaggtttttagattttatcaaaatattcaaaatttattt gtttcaaaaggttttgattattttttactgAACAAAGAATACAGGTATCG TGCGTTTCATAATTTCAGTACTAGTGACTGTAAAttataagaattatttt ttctatattATTCCATATGTTCCGGacacatttaaaaaaatcttcgaTCG ATTTTATTCTCGTGGGTCTATCCATGACCAAAgtctaatatctttccaac aatttATGACAGACATTGAcgaacagaaaaaaatgaaacatcaGATATAA GTTTTAGGTCTCAAGGgcttttgaaataaataaagCCCTGTCTATCATAA CTGGCAATCTTAGTTCTATCATTGCAATTAAAGCAACTTTGGCAGAGAGt ctaatatcttttcaacgctTTTTGACAGACATTGAcgaacagaaaaaaaa acattaacaaATAGATAACTGATACCGCAATTAAAGCAGCTTTGCCAGAG AAAGTAATGTTGGACAAAATGGCAGCCGCGTCTCCTGATCTAAATGACCG GCGACGAAGTTCTAATGTTGAGCTCTTTATCAAAGCTGTTTTTTTGTTGA GTAAAAATTACATGCCAGATACTGGCAGTTCTGGCATAATCAGTTTGGtg tatgatgatgatgatgcaaGTGATGGTATAAAAACTATAGAGGAAACATT AGATCCAGATGCTAAAGCGATCCCTGGCGTCGAAGGAAATGGCGATCCGA ATCTTGGTAggtgcccagctggcacacaacgttatttcaacgtttatcta acgttatatggacgttgtggacgttagataaacgttgaaacaacgttgta tgtCGACTGGGTGGCTTAAACAAAAGATCTTAGTTAAAGGTAGAGCATAT TCGGCTTACTCTGAATTGCAgtcctctacaaaaccccaggtagtatagtt CTATGAGGAGCACGAATCTGTTAGTGGATGCGAGCAGCCCAGTAGTGTGG ACAGGAGGGGCacaaaatctgctctcctacacaattTTTGCGCTCCCTTG GCTACACTACTGCAGCCTACGTTCGGCTACGATGTGCGAAGTTGTGTTTC AATCTCTGGTCGGGTCATACCATAATAAGTTTGGTTTATGATAATTCTAA TGATTCTGTAAGAACTATAGAGGAAACACTGGACTAAGATGAAGGGGTCG TTGAAGAAAATGTTGTCCCCAATGGTAGGTGTAATTTGGACAAATGAATG AAATTGACAATTATTGGcattttttcttaaagaaaagggcaatttttatt tgataatttaTAACTTCGTAACCTCATACCATATATGTTTTGAATGACAT ACACGTCGAAAAGTTTAGCagcttttttttgttgaaatatttAAAGACGT TGTTCTAACAGGACTACATAAAAACTTAGGATCCGAGAGGGAATCGTGTC GGGCAATTCAAGAATATTTTCTAGGGGGGGGTTCTGAGGAAAGATTTTTT TCGTCATTCCTGGGAGTAAAAGGTAGTCTAGAAAAATTTTAGGGGGTAAA AGACTAAAGTTTCAGTTCGTCTACACTTACTTTAAGCTATAAATCGTACA Aagtactctaaggtcccgaataataggggggtccgaaatttttgcaaaat ataataaacgggAGGGTCTGAATAAACGCGGGGGGGGGCTGGAAATCATC ATTTGACACGTATTTGACCTGGTTTGCAGTACTCTAAGGTCGTTCGAAAT AGATTTTAAGCCTGATTTACACTTCacctcaaaaacaaaaaaaatggaaa ataaataaacggggggggggatccgaaaattttcgaaaattaataagcgg gtggggacgtctattcggaaCCTTAGAGTAATTTTGTACAATGGATATAG AAAGGAGAAGCGCTTcttttatgctgacaaagcaaagTTAACATAAGCAT TTCCCGAAATTTGTGATCGTGCTTTGCTTGAGGGGAAGaagtttgttctt tattttgtttaaaatggGGTGTAAacaaatggtaggagatacgtTAACCT TTTTTTACTGATGACGAACGATCTCGTATGCGCACTCTGTTCCAAGTGTA CCGCGGACAAATAAAATAAGCGGTCGTTAAAGGGTTAAATGATCCTTTAG Nacggctcgtcatataccaggtctcttgcccttaagggagtttatgtcga gtaaataggtttcttttgttgtcgctataaaaaatctgcataattagcgt gttgggacaaaattcttttgtttcaagcctgattatgcgcaaacctTTAC GGCTTATATTTTTAGTACACCTCTCcaatacgaaaaggtacctatatctt cttgctcagaatttcctagcgattctactgttATATAACCGCaacatgac cgcaccataatatggaaagctagagctcaagaaaattataacttcatctt gattttactcgacttctgacagttttacaagaaccaatttaatatctctg cgttaagaatttcttttgctatacattggtaaaaatattgctcctcattc ttaaaaattgaactagtaatcggcaaaaaaggaaaaacgaattttcattt ttatcgtcaaatcatgtagaaactgtccgatttgtatggcgagccgtctt ttctgaactttcatttaatgacctaatNcgtccgatttgtatggcgagcc gtcttttctggactttcatttaatgacctaatcaacgtttttacaataga tctttcaatagaagtgatcgttgaactttgagtaatcagaaaagctgttt ttccatctctttacattcctctgctttaatgctgacaaagcagaattaac ATAAGCATTTCCCGAAATTTGTGATCGTGCTTTGCTTGAGGGGAAGaaat ttgttctttattttgtttaaaatgatGTATAAacaaatggtaggagatac gtTAACCCTTTTAGAGATCGATGGCGAGATATCCCGTTATTGCGTTCCGT GCCCAAAAATACTGATGACAAACCATCTCGTATGCGCACTCTGTTCCAAG TGTACCGCGGACAAATAAAATAAGCGGTCGTTAAAAGGTTAAATGATCCT TTAGCCTTCTTATCACTCACTCCCGACTTTTTCTCCAACAAAtgatctgg cacccagatgcagaaattttcatccgacatgctaaagctctgaaggtcgg gaaaattttcagcatctggaaggtttacattacagAATTTTGCTAGACCG CTTCAATTATTCTGCAGCAGGAGTTCTGGTAACCCAGatctcgttttcgg ggattggcgggtccaaccgaaatatttttgcgctcaagggtagttgaacc cgactggggatgcggcacatcaaaggccgactatcattcatctccgatgg gaaattgaccCGCTCCTTTatagctttagcgtgggcggccgccaatccgc catcggaatatcagagaTAACCCAACAAAGTAAGCCATCAGTGCAATCTT TTAGTAGTCTTTCAtaatcctttttttttctttagaaacgAACATGGAGT CAGACGGAGTGCTGGAGAAATTAATCGATGAAGCCATCAACGAAAAAGCT GACTCAACAACTGAAAAGAAAAGCCCTACTGAGATAAGGTAAATTATCCT CTTTAAAGTCTTTCCCTTTTTGAACCATTTTGCCGAAATTCTGAAATTTA AGAATGAAATCTCCTTATTACCGAGATAAGTCTATTCCTTCGATACCGAA ACCTTTTTAGGATTGAGCTACAGAAGTAAAAACCATTGGCTTccaagcct gaagggctagccTCCAGACTCCTGGATGGGGAAAGAAGCtacttattttc catccagaactcccacgcgtggtttttacagaaacgctggattgaaagta aaatctatcgctagatttcaaaaaatgcagagTAACCGCTAGATACATGt cgtcgtcatgattgcagCGCATTCTAGGCGCATTCTGGATAGGAAACAAG TGgcctcactttttcttgcctgggaaaggttagagattctactctagccc ttcggcctTTAAACTCGATTGTTTAAAATGGTTGATTTCCGCAATACGGA AATCTCGTACTTGCTAGACTGGAGTCTTTTGTAATTCGTCTAATACAGtg atctacaatcagtgccataacatatatttttggctaatttaccatttttc gaaacttGATTTGATGGAATATTTCTATCTGGGAgcgatttattggtttc taggctatatttcaagccctactggaccatttttgaacttttggatcctc agatcctaaggtcctaagactTAAGTccagcgttaaaactcagagttaaa actctactcttCGAACTACTTTAGaacacttacaaatcgattgtggtttc aaaacttcccggtggatttcccttttgtgccaagtattttgtcaccgATT GTAGGTGTTATATAATACGACAATTGTTACAGTTTCTATAAGCACTTTGT CTCGTCCATTATTTCTTGCTCGTTTTCTATGAAGTATGTTTGAATTGgtc gtctaacaggctagacTACGTACGTATATATTGAGTTTCTCCAACCCCGC TGGGATACCGTCTGAAtttcatctttagttttttGAATAAGTAAGGTGTC ATTTATTAAGCTAAAACGGTCACTTTTCAATAATTAAGTGTTGATAACCT AAGCCCATTGTTCGAAAGGGAGATTCTTTTTAATTAAactttcaatttaa aaacaaagcgATTCcaacacttgttccttgggtgaatatctaggGATGTT GTTTCAATTTTCCATAACTTTGATTTTTGGTGGCTGGGCACtgctttttt tgtttgttttgctaCAATCGGGCCTTTTAATAATTTGAAGAAACTGAAGA ATATGCAAAAAATAAAggatttaatatttttcttaaaggTCAATGTCTGA TTATTAATTTTACTCGTGTGAATATTACCGTTATGTATTTCATCATTACC GTAATTAAAGTATCTACATCATTAATAGTTTGTATTTGAAGCAATTTTCT CCGACaactaattaaaaaattctctGTAGAGACTTAAGCATGCTTTCATA TCGCAGTTTGCTATTAGATTGCAAATTTTCTTTTCCATACGAAAGTTTGA CTAAAAACcttcaaaatgaaagttttgatCTGTTTGGAATGTCTGGCTGG GAAGGGCGTTGGGCCCACCTGACCTCCGGAGTGGATGAGACACTGAGTTA TATtgttgaatttaaacaatagatcTAGATTTCGGTCTAATACTATTATG GCTTTAATTAACCCTGTATTTTTGGGGTAGCAACGACTTGAATTTTATTT CTAATTTGATTTATTAACCTTTAGGCCCATATTATGCGATTCTTGGACAA TCCCCCGAGACTATTGCCCAGAACAGTTTTTCCCTATAGTTTCTCATCGG GAGATTGTACCCGGAGACAATTGTATCGGGACATTTAACCCCCCGGATAA TCACCCCTTAGGGTAATCGCCCCCTATGAGACGATTGCCCCCGGACAGTT ACTTCAGGAAGGCTTCCCCCTAGGGCAATGTCCCACCTCTCTTAACATAG TATCTATGCATTGTAATGATATTCTACTAAGTAATGATGCAATTTAATCT GCTTTATGACGTGAAGATATAAATTTCCTGCCTGGGAACACTTGTAATGG ATTATAAAACTCGGAAGTTAAAAACCCGGATCTGTTGTCGTGTGCTATTC ATGAAATCTCATTCCGGGACTTTTCCTTTCATATTTTTGTTTACGGATTT CAAAACAATTAGCTTAAGATTCTATTGTTAGTGTGGTAGGGTAAGAGCGT GCTTTTGGGTTGTATATATTATTATGTATATTGTATATATTGAATATTAG CCGGAGTTTTAACAAGTTGACGAAGTATTTTGCCTGTCTTACCTTCCTCA TAATGTAAATTAAAgagttaaaaagattttaatcaTTGAGGTTTTTGTCG AATTTTTCTCGTCGTTAGCAAAGTATTCCCATCATCAAAACGGatgattg tttcattttatgatttcaatgttacggcaacgaagctagcatgGCTTTCt acaaataaatacaaaggaNTTTCAATGTtacggcaacgaagctagcatgA CTTTCtacaaataaatacaaaggaaataGATGCCAAGTCGTTTATATGCT CATAActagcccagctggcacacaacgttgtgttaacgttcaaataacgt tatttggacgttatgaatgtcacatggacgttgttttgacgtagGTGTGG ACCAAGACAGCCCGTAACGTTGTTGTtttaaccattgagtttcacgAGAC TTCTGGATGGGaattgaaaccacttatttccgaTCCAGAACGCCCGCCCG CAGTTTTTATACAAacaccggattgaaactaaaatgtatcgctagatttc aagaaatgtagtcctcaaaaacaaagcgcgttttggatgagaaataagtg gcttcaatttctcttgcctgagaagggttaaagtttcgcctttagccctt cgggcttgaaactcaatggtttcaacattcattcatTCTTCGTAGGGatc tcagctggcacacaaacGTTTTTTCCACGTTCagctaacgttatatggac gttgtgaacattagattaacgttgaaacaatgttgtgtgctaGCTAGGAT GTGGCGAATTTGATGCTCTGACCTGGTTATCTAGCTAAAACATTGAAATC TTTGTTTCGTTTTGCTTTGCTTTGCTATGAAATAAATCGAAAAAAATGTC TGTGATGCCAAATCGACCAAATGTGACTGTATCACTCCTGcggattcatt cctctttgttcatcacgggaattaactacatgttgtttaaaagaatgaaa aaatacGCATACGTTAATTAACTAATGCAGGAATTGTTAGTCGAACTCAC TGATAGTGTTTATGTTGCCATACGGATCGTTATCTGTTAGAAAATTGAAA TACGAATGtaccaattaaaaaaacaacattttatgAAGCTTTTTCCAGTA AAGGAAGATGAGACTTTAATTTCCTCAGTATGTCGCAAAGTTACTAGTAA TTACACGTTATGATTAATTAATACTCATTAGAGTTAAATGCATTGACGTA CATTGCTGATTTGGCATTGATTTATGTCTCGATTACTTCTTGGTTTTTGT TACTCTGAAGTTTTTCATTCTTCGATTTGGCTTaacgaatattttttttt ttagttttagattCAATTTTGCTTTGTAAAAACAACGATGTTGTAAGGTT TAAATTCTACTGAAGCCAGCAATTTTGTCTCCTAGCCAAGCTGATAGAAT ATGTCATAGTAcgccccccccttttttttaagGGGGAAGACACCTTCCAA CAAAATGAAGAAGGGGGGGTTCAGAAAGGAGGAGGGCTTACAtgtatatt gtagattattttcaagcagtgttatgaaattttgtcttcgtgaaaggaag ttttctgttagagtagtctgTGTCAAAacgaagaaagaagtttattattt cgctttctctTAGCTATTTctgtccaaaatccttgggggataggcatttt tttAAGGTTAGGGgtatttaagaaggggggggggccAGACTCAGTTGAAT GTTGTTGTTACGTTCGAGGATTTTATAGCGAGTTTatttatttgcacttt tgaggatggtaaagtgactgaagcgatttggaataacccgcagttctgcc CCGCAAAATCAAGgatggtaaaagtgctgatttaccgtcgtcgtcctcct cagttggtcatgatctagtcagattagaaccttaccgtcccCGTCGCTTA CACACATACAGAAACTCGGTTATGTTTCAGATTTGGAGGATGATTCATTG ATAGATCTTGTTGTAAGGAAGGCTCTTCTATTCTATAcacaagaaagcct aagcggcGTAAAGGCCCAGCAGTGTTGGCAGTATCAACATATTTTTTTGT TGCTGAGTTGCAATACAAATTCACAGGAGTAAATCTTTTTGATGTATTGA CTCGAGTCATATTGAGAGAAAGAACGATATGACCATATAAGTTGGAGGTA TTAATTATATGTGGTTTTTTCTTACGCATACGCACAATAGAAAGTGAGAT AATTCTATTTTAGCCTGGACGAGTCAATGGATAATTGCACGcataggccc cgacaaagtcaaATCTTTTCGACCAGTTGCGTTTTAAAGGCCCATACCGC TGCGCGCTGGGCCAATAAGGGATTAGCCAGGGACAGATTTTGAGGTTTCA TCTTCTTATTTTAAGGGAATATAATATTTTCACCAATCGATTCATGGTTT GTGAAGAGTGGTTTTAAATGGTGCCAAAAGAGGATGTTTTTTTACAGTGA TTCTAGAACCTTAGTAATGTCAATAAGTGacacacgttttttcataagaa caaactatataagaacataaggcttcgatggccaaaatcttaagaacaag ttaagaacattttaaggctttggggattctaaaacacccaatttcttaag aaaatggataaTGTTGCtcagaaaatgatgaaaataagaacatgataaga acatttttaggcttaaaactcaaaaagttaagaacatccgaaggccttca aaaactttggattttcttataaaaagtgtgtaATTGTTTGACTGATTTTA TATtatgagaaattgaaaaaaatagttttgcttAGTTATTTAATAAATTT GAGTATTAACTACTTCGAAATCATGATTTGACCTAGGAaggcatttttat tttattactaTACTTACTCTGCTTCCGagtattcaaaaattttaatcctA TAGATTAGTCATCAAAATTGTTTCAAGGTTAGTGTGTTTGACATTCAAGA AATTGCTTTTACGATTTGTTCATCTCCCTTTATAGATAAATTAGGGCAAG GATTTCAAGGGAATGGACGCTATGGAATGGACGTTCGTGGGTTTTTTGTA TTTAAACTCCGGTtaaggagtttcttaaaattagtgtttttcatttgtaa ttgtgcgtaaatccGATCAATCGCGATAGTCGGGTTCGAATTCCCGAATC TTTCCGGTTTGATTTCTCGATTCGGTTTGCATTAGGATATactcttttta aaattatgttaGATGTATTTTAAAGGCTGACCCATGACAATTACTGGAGT TTGCAGTCGTCATTACggctgttttatttttttcattatagCAAAACTTC TCCTACTCTGTCTACCGTAATTATACTAACGATTTTACTTGTGTTTTACC TTTTGGGTATTAAAAGGCCTTAAAACCGACTGTGAttaaattaatttatt tgtGGTACCGTAGTACTGAAGTTAATTGAGATTATTTTCTTTCGGTATGC TTCTTTGCCGGTTTTCATTTTCCGGTGTTGATACccagttgaaaatattt ttttcttattttattacCCTGAACGATGAATTATCTTTTCTATTTCAATA AATTGATATGCACTCACCGTTAAGTTTTAATGATTTGAGATTACGACAGA AAGGATTTAATAGAACAGAAAGTTTGGGATTGTGTAGTTTGTTAGCAAAA TGAATTTAATCTGTCACTACTCATCACAACTTTAGAATTTTATCTGTTCA TCGTACAGTTTTTAgcacttaaaattttaatttgttcttatcctgttctt attgctaaaagaaaaatgatgTTTATATTCTTGGCATGTTTTTTAAGCAC AGGTACAGAAACttatctttttttgttcgaattacaaagaattttagaat aaatttgataaatttttttactGGGCAAGGACTCAGAATCGATGGTCTTC AAATCATGGATCGATTGAAATCCCATTGAAATAAACGGAGTTGAAGTCCT TTATAgtaaagatttgtttttctaTGAGGATATGATGTCCAACTTTCAGA ATAGTTAAAATTACTTTGTAACGTTTGCTCGGGAAATGTCCAACAGCTTA TAGGATATTCAATAACGTTTTCTATGAGGATATAATATCCAACTTTCAGA ATGGTTAAAATTACTTTGTAACGTTTGCTCGGGAAATGTCCAACAGTTCA TAGGATATTCAATAACGTTTTCTATGAGGATATAATATCCAACTTTCAGA ATGGTTGAAATTACTTTGTAACGTTTGCTCGGGAAATGTCCAACAGCTCA TAGGATATTCAATAACGTTTTCTATGAGGATATAATATCCAACTTTCAGA ATGGTTGAAATTACTTTGTAACGTTTGCTCGGGAAATGTCCAACAGCTTA TAGGATATACAATAACGTTTTCTATGAGGATATAATATCCAACTTTTAGA ATGGTTAAAATTACTTTGTAACGTTTGCTCAGGAAATTTCCAACAGCTCA TAGTATTATCATCAAATGTCTTGTCCAGGATGTACATTAATTCACCATTC TCTCTGTCAAGATTTATTGTATTGGGATTACTGGCAATTATTTATTTCCC AATCAttcggcaatgaattttgaaattagccgtagatattgggtttgtgt acagacaatatGACTTCCTAATGCATCgactattttcattttcagcttTG AAAGGTTTATGCAACATAGATTTAGATAcactttttggcttttttgcTTT AGTTTGGGTTATAGTTGCTCGAAGATCAACCTTTttgaattagtttttta gtCAGAGTTAGgataacttttttttatctcaaagGACGAGTAACACATCG ACTATTCTCAGCTTTGAAAAGTTTATGCAACATAGTTTTAGATACACCTT TTGGCTTTTTTGCTTTAGTTTGGGTTATAGTTGCTCGAAGATCAACCCTT ttgaattagttttttagtCAGAGTTAGGATAACTTTTTTTATCTCAAAGG ACGAGTAACACATCGACTATTCTCAGCTTTGAAAAGTTTATGCAACATAG ATTTTGATACACCTTTTGGCTTTTTTGCTTTAGTTTGGGTTATAGTTGCT CGAAGATCAACCTTTttgaattagttttttagtCAGAGTTAGAATAACTT GAATAGTAAGAGGttgatttgatttgttttcattGATTCGAGTTTTAGAG TAAGATTATAGGGAGTATTCTATATCACTTTTCAGCTGAGGGACCGAAGT TTTAGAATTTAAGGGTCTGAGCTTTATTTGAACCTTGGATGCAGTTTTAC AATACCGGCTAAGcaaaacctttttcttttgattggggtgttttttttgt tgtttttttttaagtggtAGTAGCAATAATACAGAAACTCTGAAATATAG AGATTCGAATGTGAGTTGATTGTAACACATTATACATTGTTTCATAGTCC GTATGAAACCCCGGTCttgaagccttttgtttctttctattgttgtGAAC TTGAGCTtacgttgagaaattagtttgttttgttcactttttgatcatgt gataaacttttgaaccaatcccGAGAGGAATATTTGGtaatgtgatcaaa aactgagcaaatcgatttttataatcgtaattaacaaaggaaaaagttaa caaaaagttacaacaattggcttccagaccagggttttttatacagACTC TGATTGTTTCGACTTCTCTTTTTTTGTCATGTGATTGGATTctcatcaaa ttttatttttatggaCACCGAGATGAGACTTGATTTTTAGAGAGAAtaat ttaaactttaaaaaagaaCTTTCCGTACCGTTTGGATCACTGTTTAATTG ATATGGATGTCCTTTAAAGTCAGTCTTTAATTATTTACGTGTTTATCAAA GGAAGANAAGAACTTTCCGTACCGTTTGGATCACTGTTTAATTGATATGG ATGTCCTTTAAAGTCAGTCTTTAATTATTTGTTTATCAAAGGAAAAAATA GCAGTCCTTTAACCCTCCCACATTGTCTTCATGTGGTTACTTCAAAGACC AGCTACAGGCTATTTATAGGCATCTTGCGTTAGCCTTTGTTCTCAATTAT TTGCACGTTAGGAGTAGTTCTAACTAAAGAATAGAAGAGATGACGTTTTT AATTAGTATGTCGTTTCTTCGTGGCACGGCTGATTAAATAATGAAACTTT TAGGGGGTATTGACTATTTGTACCATGATACAGTTTTCAGCAGATGCTGT CATTTGCATTGGAAgattaagaccatgttcacacatCGGTATACGGTTAT ACCATATACGGTCCCGTGTCGCTCCGGTGTGATTTTCGTTAtggatcgag agtgttcatattagtttcagaacgtttcggagcaagaaaatgaagcagtt ccgttccgatgaaaatagtggaacAACAGTGTTTCGATTTGTTTTGctgt gtaacgtcttcttttttgacgtttcgaattttaacgttcacacttgtttt ggaaccgtttcggaacggaacggaactgtaacgtctgaacatggtctaaa tctAGTTATCAAACCAGTGTCCAAGAGTAGCTTTTTGGAGACGCCGACTG AATCTTGGGAGCTCATATGAGCTGGTAtctatgatatgcaccattgaaaT GACTTCTGATTTTACATCATAGACCTAAAAGTAACagttgattggttgta agtgacgtaaaatcagttaaTACGTACTAATACagactattcatgatatg caccatttcAATGTCTTCAAAGGAACCAACAACTGATttgttgaaagtga cgtattgaatGATATTACGTCACAtgtaaccaatcagctgttgggtcaaT AATGTAATGTCAAaggacattgcaatggtgcattgTTATCGTGAATAGAA CGGGGCTTATTTTGGTTTcgaaaggcttggggacacgaaaagtttttttc gcgttggtgcaatgcaacatgctctatcccaccaacacaagaaaataagt gCGTGTCCCAcggtttatttttttgtttcattggacAAGTGAGGGAAATG CCCAAAAGACACGCtcattttgtccctgggacaaaagtgagatttcactt ttattggtagaaagaaaaagagggtggagacacgagaaagcgtttcagat TGATGGAATgtagcatgttgcattgcaccaacgcgaaaaaaacttctcgt gtccccaagccttaataTTGTCGACTTTTTGTAAACAAGTTATCGACTGC AAACTGGCGACTGTTTAGtgatgaaatatttatttttaaagtgGAGGTTT tgcacgcactgcacacagagctttttaaaggagtgctcatttcaatagga aaacaatggttgttctcttgggagaagtgccttctagaggtagttggtta tctattatttttacatctcGTTGgttaaacaataaaaattcgttaaaaag tcGTTAAGTCGTACAAACTAATAAGTCCCAGGTCATTAAACGTTACGAag gaaattgaaatttaaatCCTAACTAAAACGCTTATACAAAGATTTGGTTC GTTACTATCATTACACTTTTATGTTTGTTGTTGTTAGGCATAGCCTGGAA GTTGTTAAAATGCAATAATGGTTGGaatgaaatttacaaaaaatgctaCC CAGCTGACATACgtaaaacgttttttcaacgttttttttcttctttataa tAGTGTTTCCTTGTTCTATGAGGGTGCATGTCTTTTCTTGCTGTGCTAGG GGGAAAATGGTTATGAGTGAGAAAACTAAAATAGTCGCGGTTGTTGCTTG AGTTGAATAGACCTGAATAGACTATTTTTatagtcgtttataatgcgtgt aatgcAGTAGTATAGTCGTTATATGAttatacgattattgttacgggatt tactttgtataaaattgttccctccattactttttgctgaATTAGTTGTC CAGCTTGCTAAACTACTATTTTACTGCTTTTCATTAGGAGTTGATTTTGC TTTTGATGGTATTTTAGGTTTGAAGGTGATATGCTGATACCCAAATCAGC ATCCAGAAACTATGAAAACGTCAGCGGGGCGGCGAAACGACTATGTGCTA GCTTGGTTATAATATCTGTGGGGGGGGCagttaggcaaaaatgggtgctg ggtatgaaCGGTAACGGttggttttttcacctttcaaagtctctcttagg gtcgcaaaaatcagaaatattttcaaaaaagtttctctaagggtcagaaa attcacgatttttcgtaattttttttgatttcgagagaaaaagttgtaaa aaagtctctctaagggtcatcttttcagcaaaactcagtctctctaaggg tcgatttttggaGGTCCCATCCGCCAACCCTAGCACCCCCTCCCGGGTTA TCATATCATGCACTCGTATATACGTCAACAGtgaaatacagtggagtctc cgtaAATCGAACACGAATGAGGAACACAAAtttaaggtttataaggcatt attaactgaaggaaccataaaacttgtaaaggagacattcgagttataga gagaCTCTGAGCGCTGTAGTATGCATTTATAGTGTTTTAATAAGTGATAG ATGATTCCATCAAAGAGCGCTCGATGATTATGACCAGAGCTTCATACagt gtacaagaaaaaaaatttgaattataatACTTCAATTTTTATGTCAGAGA GTAAGTGGAGTGAGGATTTTTTTTATCTGTGTCAATCATATCAGTTACTT TTGCACTGCACCCTATGAAGATGTGTTCAGGCTGTTTTTCTCTTCCCGTT TCTATGAAAGCTCTGTATAAATGGTTAGCTCAGCTGGTGTAGTGATTCAT TCAGGTGGTTAGGCGCACGTCTTTCAATACAGGGGCGAATCACGGTACAG GGGCGTGCTCCCTGGTGTTATTAACGTTCTCCTGGGAAGATGTTGAATGC GAAAGTAGCACGAGTCAAAGTTGAGATGAAATGCCCAGTAGTAATAGTTA CACGTTgcatttttatataagaacatccaaaaattttgaagccttcagat tttcttaactttttgagtttcaagcctaaaaatgttcttaacatgttctt attttcgccatttattttttgtatttttgtccattttcctaagaaattgg ctgttttttgAGTTCACGAAGGTTTGAAATGGTCTTAagttattcttaat attttggacatcgaagccttatgttcttatatagtttgttcttatcaaaa aaaacttgtaatcaATTACCGTGATTCAACCATGTAGATGTCAGACGTTC GTCTAAAAATTTGAGGTACCAAGACTGAGAGATTTTCCTCCTTGCCCCCA ACTAtgatgggcgacagtttttttccgAAATTTTGGCCCCTCAATATGGA GAGACCAACTAGgaacaatacacctttttccgGTTAGCTGCTTCGTATAA AAAGACACCGAACTTTCGAGTAAACAAATCATCccattggctaaaagcaa aaacataaacaaaaaatatgtgCAGTGTATGAGAAAAATGAGCTTTCTGT GCTTTTACTCTGAACATTTTTTtagtttatgtttttgcttttagccaatg agatggtttctttactcgaaattttggtgacttgtTTTTATACGAAGCAG CTAACCGTAAAAAGATATATTATAAGCACTgaatcaacttttttgtacCA GTGGGGAACAAGTAGATGCAAGAGTTTTAAAACGTGACTCGAATGGCAGC CCCAAAAGTTACATAAGTCGATGTAACTTCCTCTCGTTGCTATAGCACCT TTCATGAGCTCAATAGCTTATAATTAAAGCGCGATCTAAAGACGCGAGTT AATTAGTATCCTTGTCAGCTAATCATGtgggaaaattgaatttttcttag CTCTTTAACCATATAATCGATGTTTCGAAGCTATTTCGAATAGGATGTGG TTAAACGctaattttcctttttgatcTTTGAAATAATATAGCATTTTTAT TGTCAATTAGTTTTGTCTGTCTTTGGCTTCGTATATACTGCTACACGTTT CTCAACTCATTTGGTTGATTTTATGATCAGGCTTTTAGTCCTCATAAATC TTATAGACCGAGATTGGATGTCTTGTGACTACCTtttcggccctttttac gcttGCCCTtgttggcgttatttttgggctcgcgGCGTAGTAAGGGCCGG TGTTAAAAGGGGCCGGTGTTAAAAGGGGCCGGTGTtaaaaggggccggcg taaaaagggccgataaggaaTTCCATTTTCTTTGAAGTTAGGGaaaggtt cgaattacagagactaATTCAAACAACCTTCCAACTAAGAGGACCAAtac acggttttttataagaacaaactatataagaacataaggcttcgatggtc aaaatgctaagaacaagttaagaacatttttaggctttgctGACTCAAAA ACACtcgttttcttaggaaaatgggtaaaaatgctcaaaaaatggtgaaa atgagaacattttaagaacatcccaaggcttctaaaattttggatgttct cataaaaaaaacgtttatgtTGATTCGAATTAgataaagattcgaataat agaggtttgAAACAGAGGGGAGGTACTGTACACAAGACCTCGCTCAAGTA TTGCAATAACTGGTTGAAATATGTTCCTTTTCAGCTTTTCATGATAATAA GTAATAAAATTCGAAGAAAAAGTAATACATATAATTTTCTATGGTTGGCA CCTACTGGAGACATTTTGTTTAAACAAGGGCATCAGAGGGAACGttgtga aattaaaaaatgcagAGTATTGTATTTGAACTGTTCCAAGAGAATTTTCT TCCAGATCCTTGGTAATAAGATTTAGCAAAAATTGCTTTCGCATTTTTTC CGTTAGGCCAATATAACTCCCCAATATAACTTGAATTTCAGCTTCACtat gttttttttaagtttgaaagTCAATGCTAATGTCGGAGCTATTGCCCTTT AAAAACGTTTTCTACCAGTCTTGAATTCACtaactttttcacattggatt gatacggatgtggagcaagaaagaggaaaagaaaagcatttttgTGCTTA TATCAgtacaatataacaataggcagacaatgtcctggtatgaaatatgt gtctgatatgaaacgggaacacttatgtagaaataaaacctttaagagtA TAGTAGGGTAGAGATATCTgtattaacttttcctaatcatttgATATTTC TCTAGGTTTGCAGACAAGTATGGATTTTATGATCAAATCGAGAAATCTGA CGAGAACGCTTTAGAATCACTTGCTGACCATTTCGAATcactcagtgggg ataaagaggtatttttgaaaaacaaacttcaagCAATTCTGATTATcaat tacattttattttcttaagGCTTTGGGACAGGAGAAATCTTTTTCGCGTT GGTTCAATGCAACATgatccatcccaccaacctgaaacgtaTTCTCGTGT CCCCACCCTATtcttctttctaccaataataaaagtgaaatctcattgtt gtccctgggacaatggagtaAAAtcgattcgaatcaattttgttCCATTG TCCTAGGGACAAaattggtgggatggagcatgtaaaatgtaaaatacaaa agtttTCATGAGACAAATTTACATTTCAATAAAGTATAGAAAGATATATT TCTGTTTccaaattctgcaaaatttccaaaaatttcaagaatatatgCTA ATTCGCTTGTTAAAAACCCATTATCCGTCTCACACGTAAcgccttgcttt gaccactaaAAAGTTCTCTCTACATTAATATGTCTTCCAGGGTTATCGAT TGAGGAATGACCTTGCTGGCTCATAATTTACTTACACTTTTCTTATTCTT TAGCTCGGTTCATTAGAAGTTTCACACGGTGTGAAATGGGAAAATTATTT GGTAGCACAAGGTACCGCACCACTACAGAAAACGGTACGTCATGGCTCGG AATATAAATTTCATTATTGGTCCGATCAGGGTTGtcttagtttgaaaatt atgatttttggatCGAACAAGgataaatttcagaaatttggGTCAGACAA TGTTCGACCGTTCTTTTCAAGTCCAGTTTGTGTTCCCATTTCTGTAAGTT TTTGGAccgtcctataaattaacccatgtccgttcgtccgtccgtccgtc cgtccgtccgtccgtccgtctgtccgtccgtctgttaccagcttttctca ggattggctcattagttttttttgatttttggcacaatgatgcaaaatgg taatgcctaaaatgtgacggagcccgattttcgaaaatNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNaatcttt tccggtcgaaaatgccggaaatatgccggaaatcgccatttttgcagatt ttcatcggactttttccttatatttcgttgttttttcacacaaaaacata attaatagcaatgcccaccatgaagcatggttcaatcgtcaatagaaCTG AGTATTGAAgtcggaactttctaaaaatcgccgatgcagcccattttcgc cggaaaaacggtatttcttgattttctcgagctgtactttatgttttttt atgaaattttgcacactgatgcaaaatgataatacctaaaatgtgacaga gcccgaatttcgaaaaacatctttttccggccgaaaaagccggaaatatg ccggaagtattgtttttttggcattttctcgagattttatcattagtttt ttctgattttttgcacaacaatgcgtattaacaatgcccaaaacatggcc gagtccgatttttgagaaaattttatttccggcagaaaatgcctgaaata tgccggaaatcgccgttttctgGGTTTTCATTGGGCTTGTTCCTTTtaaa tggttgttttttcattcaaacacattattaatagcaatgtccaccatcaa gcatgtttcaattgtcaataaaactgatttttgcgaccacaactttctat ttattttttccttacaaccctttcctctccccccccccatcaacaatcaa tgatgaattttttgcgttatgcatttttgttaaacgctatattttctgac tgatttttttcatttttctcctcgcattgctttctaactttcatcatcag gtaggtctattcagcatctagcttgttataTGTAAGTTTAGCTATGTAAA GTGCGCCACCCTAATTTCTTACTAGTTTTAACCAGTGTCAAAAGCATTCA GAAAGTATCGCTAACTTATCATTGACCCTTAAAACCTTTTACATTTTTCA GGAGGAACTCAAAGCACTCGTCCGAAGTGGTATCCCACACGAATTCCGTG CGCGCGTCTGGGGCGATCTCGTCCGCCTGCGTAGTGATCACGAGCGGACG ATTGCTGGGCAAGGCTACTATGCTAACTTAttgaaagagaagaaaggagc TTACTCCCCGTCTGCCAAACAGATTGAATTGGACTTGTTGAGAACGTTAC CGAACAACAAATATTATGATACGCTTGAATCTGAGGGGGTGAGTAATTTG ATATTATTGTCcctagtggaaaattatactctaatttctGTACCCACTGA AAATattcagataagcaaatcctcagcGCTGAATATAGTGCTACTTTTCT ATcgccactgaattttctggctcgaaaacaatggaattcaaatcctcagc cataaaaaacatgggaatatcaatccccatcaagtttgGTCCGtcaattt tacccccactggccgAAAAAATTCCTACCTACCCAACATTTTTCTATATG TCAAGAGGAGTGTACTAGAATGAAAGTGTTACAATTCTTTAAAAGAAACC TCGATAATTTGACTTTTCTgacttttcatttctttttttcagatttcaaa actACGACGCATTTTGACAGCGTACAGTTGGCATAACCCAGCTGTTGGAT ACTGTCAAGGATTAAATCGTTTGGGAGCCATCGCACTGTTGTATTTAGAT GAAGAAACAGCTTTCTGGTAAGAGaattattgttgttttttgagaCGAAA ATTTTCTTATGTGAAACCCTTCAGGTTTTCTGCCTTTCGCAGATCAAAAT TACCAGTTTATGTATTGGAGGATGttgagggcgacggtaagtgaagccaa cgcaaaacaaagtcgaaAGTTGATATAccgctctatatcgcctttgctaa cctaacagacgacggtattttggtatttttaccgtcgtcgagccaAAGTG AACGGTGATTTTGgtgacatgtcaactttgctttaaaCCGTCTCCCACGA TTTATTTCGagtacataaactcgctattgaaaagaaaaactgttctcttt taatttaaaaacatgCCTTTAGAATCGTTTTAAGTTATTATGTTTCTCAA AATTGCCTAAAGCATGCAGTGTCAAAAGTTAAAAGAGGAGACGGAACGAA AACAGTGTCAAAAGTTAATTTACCATTTGTATTTGTATCATTTTCCAtca attttcttccttttctttttgttttaggTGTCTTGTAGCGATCACTGAAC ATCTAATGCCAATTGATTATTACAGCAGAACACTGCTCGGTGCGCAAATC GATCAAGTGAGTAAAGTCGTGGCTTTCAAGGAAAGGCTACTGAAGTCTGA AGAAATCGTTTTCTTGTTCCTTCAACTAGCAATATAactcaaatttaaat ttctccCTGGCGTGTTCGAGCAATGGAGACTGCATTGTATATAATTGTAT ATTCAATGTCGAAGACCTAAACAGCTATAGTTTAGGTGTTTTTGTGTCCG TTTCGCCCTCTCGACATACATCTCAATGCATGGTTTATTATTTAGCTTAT TACATATTAGGTAGATTTTTCCatatatttttaatattatttttgttCCT TTCCAGAAAGTATTTCGTGACTTGTTGGACGAAAAATGTCCGAAACTGAG TGCTCATCTTGTCTCCTTGCAGTAAGTTATTTTCAATTGTTATGGTTATA ATAATTGtgttagctctagtttagacggcctaCTTCTGaactgcctattc taattgctaGAGTAGGAAAAAAATGGtacattgacgtcaaaaaaggcAAT ACATTGACTTTAGTCATCCAACTTTTTGCCCACTTCAATTCAAAATTAGG ATAGGCAGGGCAacaagtgggccgtctaaactagatgTAATTGTTTCTTT CCGGTCTTGGTTCTCACGTAACTTGATCAAAAGATGATTATGAATATGAT AATGAttgtgaaaatatgaaaatcaaCGCGTGATAATCATCGGGATGTAG ACCGATCGGTGATCTTTTACTTGTGATCTGATATTTATTGTCGTAGgacg agaccaatttgattagttgttttatgGGCCCggccgaccctgaaattcca aaaatcgaaataaaaataaaatttattttgagtagtacatttttattttc attgcttttacAGACTGctaaattttggtagtttttccaaagttttgaga atttgatGTTCAATTTTCCATTTTATCCATGTTttcgagctttttgtgtc tttttattttctatctcacatttttgtcaagatgtagtagtttttgctgc ctttttaggagattttataatgtgaaattctacttttatttttattgttt tgccgaccgaccgaccctcttttttgggtagcttggcccgtaaaacaaca ctttaaattggcctcgcctagTTTTTGAAGTATCGAGTAGTCCCATaaca tgatttttttattgacttATAGGTTCGACATATCGTTGGTATCATTCAAT TGGTTCCTGACTGTTTTTGTTGATCTCTTTCCGATTGAGGTAAGTTTCCG AAGGTGTTATAAGAATATGAGGCTGATCAGGGGAATCAGATGGTTTCTGT GGATTTCTTTCCAGGGTCCTAAGAAAacctgcaaaatatttttgtctgac TCCTTTCAAAAGTTGAGATAACACATTTTGAAATTCGGTTCTTACACGTC CTATTCGTTTATTGCTAAAgaagtcaaaaacttttaacTAGAATGTATCG ACTTTTGGAAAGAGTTGTGCAagaatattttgaggttttgatCAGGACTA TTGAAGAAATCTACGGTCAAAATATATCCCAGatcatcaaattttaaatt aaatgTCAGATTcaacaaattaatttgaaaataggaaatatttcaacaaa aaaaagaacCGTCGGGTTAAAATTTATTAACTGTTAaccattaaaggttt tgtttttaaataaaagtgatatcgtttgcttactttactcataaatttta attcacaatctTTTTCACATTTATTTGACACGgaaaagaaaacctttttt tgtttatatcagcatacagcacctgaccccgagaatgNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCt ctgaaacaaatttttatgaagttgaactatcgttagggctacaatgctaa aaaatgagaaacctacattctcggggtttactacattcttggggtcaggt gctgtaatataacaataggcagacactgtcctgatatgaaatatgtgtct gatatgaaatatgtgtctgatatgaaacgggaacacttgtgtaaaaataa aacctttaagctttttttatggaaaaatcATTGAGAACAGGTTAAGAATC AGAGAAAATAGGATAACTTCTAGATGCGATCATTAAAATGCTTAACGATT TATTGAAATAATTTGTTATTTTCAGTTGACGTTAAGAGTGTGGGATACAT TTCTCTTCGAAGGTAGCAAGGTAAGTTTTGTTTTCAGGCCATATTAACTC TCTCGAAACACTCACTGTCGGttacgcaattttttttccgtaagcaATAG ACCTACGtgatggtgattatgtcccttgagacataaaatgattttttttg aatagaaagtagttttattaaaatccgctgggagttaatcaccatggcaa taatttctaaacggggcaagtgatgttcgtaacgtaatttatgaaaaagt ctatcCAAGACCTCCAAAACTTTTTTAGCGCAAAATCTAGCTATCCAAGA CCTGATTTAGCTATCTAAGACCTTCCTGTTTTGCCGTGCGGAAGCATTTA GCTATCCAAGACCTGATTTAACGATCAAAGACCTGTAAGACTTACAAATC TATCATATTTTAGCTATCCAAGACCTTCAACTCAATTTGCGTCGAGAATT CTCTCCAAATCGGCCGTCATACTCGTACTAAATAAATTTCCTTTGTACAC AAAATGTACGAGTAGGTAAAAATCTCGTAATATCGCGGGAACAAATTTTC CCAGTGCGAGGGTATTACATTGGCGCATTttgtggaactaattttcgcgt ttaACACCCACTTTTTGcgaaattctttcatattcctagaggtttttgag gatttttagtAAAAGTCACATTTCGCGGAACTATCTTTCgcggtagacac ccaaaaacgcgaaaattagttcccttaagggtAGTAAAGTTAGTCTTGTA CAGTTTGCTGCAATCTGTCGAAATTTGAACAGCTATTGGCCTTCTTCTAT CCTCTTAAGCTATGTtatgaaaaacaacaaactCGAACCCAGGCCCTTAG CctgctttttttataattttgattgttACATAGACGTGTACCAACGTcta tcagaaaaataaaaaaagttatttaagGGGCCCTTGGTACGAGAGTGGGG AAACTCCACACTGAGTAAGGTCAATAATTTTGAcgcagttgacgctctct aatttgatcttcaaggggaattggatttttatcgaataagagagcttatc gaataagggagcgtcgtttatgagagtttgttgttgacTGGGACTTTAAA TTCCATCGAAGAAGGGAGCcaatcgaatagtagaacgtcgaattagagag cgtcaactgtataatttttatttttacgcAGGTTTTATTCCGGTACGCAT TGTCCGTCTTCAAACTTTTCGAAGAAGAATTCCTACGCTTTAAAGATCCT GGACCGATGTTCAACTTTTTCCGAAATCTACCCAAAAAGAAATTCAACAT TCAAAAGATTTGTTACATAGCTTTCAACACGATGAACCCCTTTAGTCGTC GTAATGTGGAATCGAAAAGGAAATTCTACAGACCTATTCTTCAAGTAAGC CTTTGTTAATACAGTTGAATTAAATTTCTAACATGATCTTCAAAGGACGA AGAATTTCcttcaaattagagaaagatttgaattatatCAAGTATTTTAT ACTAAATGCTAGCTGAGAGGACTAATATTTTATTTCGAAATACACAGAGA GATTCGGATAAAGGGATTCTATTTAGAAACAGTTGACTgtagaatatttt tttctgcattgatttgttttttgttgtctttttatcgagtttatgtattt gcacttttgaggacgagAACGGTAAAAGTGTCGTCCTCAGTTAGTCAGGA TGTAGTCGAAATAGACGCTAACCGTCTCGTGTGTTATTCCAAATTGCCTC AGTCACTCCACCGCCctcaaaaatgcaaatacataaacttgctaatATTA CGTCGCACGTTTTTCTTaccgacccttatagtgcatttTCATGGCGATGG ATGTTTCTAAAAAACAGtcatttgtaaaaaaatgtattttttcaaCTTCA AAGGCACAACTTGACGAGTTTGAAATTATGCGTGAGGAATACAAGGAGAA ACGGGAAGACAGTATTTCTATTCACGATGAAGAACCAATCAGTGACGACG AGAACTAACCATTGTCCAATCAGATGGCGAGAAATAGTATAGTTGTCCAA TCAGGATCCAAGGATTGATTTCATAATCCAATCAGATGGCGAGAAATAGT ATAGTTGTCCAATCAGGATCCAAGGATTGATTTCATAATCCAATCAGATG GCGAGAAATTGTTATGGTTGTCCAATCAGGATCCAAGGATTAATTTCATC ATCCAATCAAAATCGCGAGACCACATGAAAACTGTGATGTCACCATCCAA TGAAAACACTAAGAATGATTGATAGCCAATCTGATCAAAGAAAAGGTTTG ATTCTTTCAAGTTGGACCAAAATCAAGATATGGCCACTCTTGTTATTTGT TAAAACACTGGAAACTAATGATTGACCAATGAGAAAACCCGATTTAATGT CGCAATTACTGTATAGATTTCTTTCATTAAAACGGAAGAGCTGATTAAAC CTGGATAAATTccactaaaaatattttatggtTTTAGCTAAATTTCAACT GTTATTCTCGCCTGAAATTTTGACTCGTTTTTGAGGTCACTCATTGATCA AAACTAAATGAAATAAATGGATACCAATATTTTTTATGTGAATACAAAAT TCagtttagtatttttttttcttaaggtgaggccaatttaatttgttgtt ttacgggccaagcgaCCCAagaaagagggtcggtcgggcggttgaaaata aaaataaaagtagaattttaccTATTAAAATCTCCTCAAAAGGCAGCAAA tctactacatcttgacaaaaatgcgaaatagaaaataaaaaggcacaaaa aggtcgaattctagtcgaattcatggataaaatgaaaaatagaacattaa attctcaaaattttggaaaaacaaactcctatttcgaaaatttgggagtc tgtaaagcaatgaaaataaaaatgtgctaccaaaatgaattttattttta tttcgatttttgaaatttcagggttGTTTGGACCCgcaaaacaactaatc aaaatGGTCTCGCCTAATCATATAATTGTTGATAGActgtaaatttttaa aagaatttaaagTGTATATAATGCACCCTCGAACTTCTTCGAGTCACTAA ATTGTCATAATTCAATCTCTTATTCGTTTTAAAAAGCAAACTTTAGTCAT TAAAGGATAAAAAAGGGAGCCTCGTTACCTACAGCAatgttttaaaacaa tttttggcTTCCATTTCcctatttttgagagggaggtcTTGTAATAGACA ACACAAGGTATTCTGTCATCCATCGTTAAGttacgtaaataaagcctggg atacacaggGACCAGGATTCGTGCACATATATCTTGATTAAtgatattca tgacgtaatgttttctacggaaatactccggtttttgccagtagtggcaa atttaactTTTATCTAGTTTAAATATAATATTATGAATATTATTGAAACA TTattgaatatcatgaataagatCTTAATTTAGCATTTGGCAATTTCTTT CCAGGGATATTTTTACTCATTCGGGATAAGAGTTAAAAACTTACCTTCAT ATAACGAATTAATTAAGCTGAATTCAGGGTAtagatttttttacttttga tttatattttttgaaattaatttaaattataAGCTTCGATTTTTGTTAAT TATATAAATGATAACTGGGAAATTCTATTGTCTTTCTTGTAAATATTCAG Aggatttttttatatgtttttttttttgcaatttagtttttcttattctt tttatATACCAGGataacaataatttttttaatttattacgATTCTACAG ATTTTATTTCCTAAATTTATTGCTaatattttttcagttttaaatcAAGA TAATTCTTTGACAATAAAATATAAC

Coding sequence (CDS) from alignment at scaffold_97:393681..474055+

>TCONS_00073659 ID=TCONS_00073659|Name=TCONS_00073659|organism=Clytia hemisphaerica|type=CDS|length=94860bp|location=Sequence derived from alignment at scaffold_97:393681..474055+ (Clytia hemisphaerica)
ATGACTTCAAAAAAGGAAGTCCAAGATCCTTGGGAAATACTAGAGGTTCC
AGCTGTGATAAATTTCTCTTCAAAATCCAATGAAGATGAGGGAGAAGAGa
atgatttttctcaaaacaacagcaaaacaaaaaaGGACAACAAAGAAAGG
TTGTGTGGCTACTTGAATAAAATGGGAGcCGGTATCATCAAAGGTTGGAA
GAAAAGATGGTTTGTTTATGATCCACGTAGATGTCTACTTTTCTATTATC
GTAGACCCCAAGACACTGAACCATTAGGGACTATAGATATAGCAAGTGCC
ACATTTTCCTACAACCCAAATGTAAAGGCCTTGTTTTCAATAAGTTCTGG
AGACAGATTGTATCAACTTGAGGCACCTGACAACAACGCCATGATGTTTT
GGTTACAAGAACTGCAAGCCAAAAGAcgagaattttcaaaacttgtAGAA
GCAAATGCAGGCAATAATAGACCAACAAGTGGTTTGCTTTCTGATCCGAT
AGATGCTCCACAAGGAGGTGATGATGAAGCTGATGGTTTCAATAAAATAA
TTGAAAGACCTCACAATGTTGGTGAGAAGACTGCTCTCGATTCTAAAGGA
AATTTTTCATTCACACACTTGaacaaagaattcaaaaattGGAGaaaatc
aaccttttacacagaaactggggaggcaattttaaATGAGAAATCAGCTG
CTTCTACGCCAGAACAAGAAAAGAAAAGTCCTAACATGCAAAGAAGAGAA
GATGATACAAAAATTCTAGAAAGTGGAAACAAACGAAGaGTCGATTTTGG
TTTCTCAAAGATGGTAGCAAATCTGAGGAATACAAATATGCCAGTGATTA
GCTCCCCTcaaccaaacaacaacaacataaaTCAATGCCGAGATTGTATG
GAGaaattgaatatggTCAAAACTCTCCAAGAAGCAATTTCAATGGCCGA
AAAGGAAATTACTACACGAGATGAGGTTATTGAAAGTATAAGCGAACAAC
TAAgaTTTGCATCAAGCTCCCCAACATTAGTGGAAAAAGCACCAGACATC
GAAGAAGCGGAAGAGCGGGAACTCTATATACTCAAGctCAGTCGAATGAT
AAAAAGCTTGAATGAAAAAGTTGACGAATTGACAACTACGATACGtgaaa
atgaaCGAACTCTTGAAGAGTACGAGCAAAAGGAGAGAGTCTTGAAAGAA
ATGATTCATGCTAAAGATAATTCAATCATCGCCTTGACGAACCAGGTATT
TTCTTTGGAAGAGAAAGAAACAACAGACGTCGCTCAAGATGTATTGATAG
CTTTTGAAGAGAAACCGTCAGAAATGACTGATAGCAATTCATCGCCTATT
GAACTAGACTACGACCAACTAAAGGAGGCTTGTTCAGCTTACCAagctca
aaacaattttttgaacaGTGAAATATTGGAGTTACACAAACTACGTACAT
TGGATGCTGAAAAGATATTGAATGCAAATGATAACCTTGAGATGAAAGAA
GCGGAGGTGATCAAAATCAGAAGTCGATATTTATGGTTACTTAAAGATTG
TGCTGGACCTAAACGAGaaacgAACATGGAGTCAGACGGAGTGCTGGAGA
AATTAATCGATGAAGCCATCAACGAAAAAGCTGACTCAACAACTGAAAAG
AAAAGCCCTACTGAGATAAGGTTTGCAGACAAGTATGGATTTTATGATCA
AATCGAGAAATCTGACGAGAACGCTTTAGAATCACTTGCTGACCATTTCG
AATcactcagtggggataaagagCTCGGTTCATTAGAAGTTTCACACGGT
GTGAAATGGGAAAATTATTTGGTAGCACAAGGTACCGCACCACTACAGAA
AACGGAGGAACTCAAAGCACTCGTCCGAAGTGGTATCCCACACGAATTCC
GTGCGCGCGTCTGGGGCGATCTCGTCCGCCTGCGTAGTGATCACGAGCGG
ACGATTGCTGGGCAAGGCTACTATGCTAACTTAttgaaagagaagaaagg
agcTTACTCCCCGTCTGCCAAACAGATTGAATTGGACTTGTTGAGAACGT
TACCGAACAACAAATATTATGATACGCTTGAATCTGAGGGGatttcaaaa
ctACGACGCATTTTGACAGCGTACAGTTGGCATAACCCAGCTGTTGGATA
CTGTCAAGGATTAAATCGTTTGGGAGCCATCGCACTGTTGTATTTAGATG
AAGAAACAGCTTTCTGgTGTCTTGTAGCGATCACTGAACATCTAATGCCA
ATTGATTATTACAGCAGAACACTGCTCGGTGCGCAAATCGATCAAAAAGT
ATTTCGTGACTTGTTGGACGAAAAATGTCCGAAACTGAGTGCTCATCTTG
TCTCCTTGCAGTTCGACATATCGTTGGTATCATTCAATTGGTTCCTGACT
GTTTTTGTTGATCTCTTTCCGATTGAGTTGACGTTAAGAGTGTGGGATAC
ATTTCTCTTCGAAGGTAGCAAGGTTTTATTCCGGTACGCATTGTCCGTCT
TCAAACTTTTCGAAGAAGAATTCCTACGCTTTAAAGATCCTGGACCGATG
TTCAACTTTTTCCGAAATCTACCCAAAAAGAAATTCAACATTCAAAAGAT
TTGTTACATAGCTTTCAACACGATGAACCCCTTTAGTCGTCGTAATGTGG
AATCGAAAAGGAAATTCTACAGACCTATTCTTCAAGCACAACTTGACGAG
TTTGAAATTATGCGTGAGGAATACAAGGAGAAACGGGAAGACAGTATTTC
TATTCACGATGAAGAACCAATCAGTGACGACGAGAACTAAATGACTTCAA
AAAAGGAAGTCCAAGATCCTTGGGAAATACTAGAGGTTCCAGCTGTGATA
AATTTCTCTTCAAAATCCAATGAAGATGAGGGAGAAGAGaatgatttttc
tcaaaacaacagcaaaacaaaaaaGGACAACAAAGAAAGGTTGTGTGGCT
ACTTGAATAAAATGGGAGcCGGTATCATCAAAGGTTGGAAGAAAAGATGG
TTTGTTTATGATCCACGTAGATGTCTACTTTTCTATTATCGTAGACCCCA
AGACACTGAACCATTAGGGACTATAGATATAGCAAGTGCCACATTTTCCT
ACAACCCAAATGTAAAGGCCTTGTTTTCAATAAGTTCTGGAGACAGATTG
TATCAACTTGAGGCACCTGACAACAACGCCATGATGTTTTGGTTACAAGA
ACTGCAAGCCAAAAGAcgagaattttcaaaacttgtAGAAGCAAATGCAG
GCAATAATAGACCAACAAGTGGTTTGCTTTCTGATCCGATAGATGCTCCA
CAAGGAGGTGATGATGAAGCTGATGGTTTCAATAAAATAATTGAAAGACC
TCACAATGTTGGTGAGAAGACTGCTCTCGATTCTAAAGGAAATTTTTCAT
TCACACACTTGaacaaagaattcaaaaattGGAGaaaatcaaccttttac
acagaaactggggaggcaattttaaATGAGAAATCAGCTGCTTCTACGCC
AGAACAAGAAAAGAAAAGTCCTAACATGCAAAGAAGAGAAGATGATACAA
AAATTCTAGAAAGTGGAAACAAACGAAGaGTCGATTTTGGTTTCTCAAAG
ATGGTAGCAAATCTGAGGAATACAAATATGCCAGTGATTAGCTCCCCTca
accaaacaacaacaacataaaTCAATGCCGAGATTGTATGGAGaaattga
atatggTCAAAACTCTCCAAGAAGCAATTTCAATGGCCGAAAAGGAAATT
ACTACACGAGATGAGGTTATTGAAAGTATAAGCGAACAACTAAgaTTTGC
ATCAAGCTCCCCAACATTAGTGGAAAAAGCACCAGACATCGAAGAAGCGG
AAGAGCGGGAACTCTATATACTCAAGctCAGTCGAATGATAAAAAGCTTG
AATGAAAAAGTTGACGAATTGACAACTACGATACGtgaaaatgaaCGAAC
TCTTGAAGAGTACGAGCAAAAGGAGAGAGTCTTGAAAGAAATGATTCATG
CTAAAGATAATTCAATCATCGCCTTGACGAACCAGGTATTTTCTTTGGAA
GAGAAAGAAACAACAGACGTCGCTCAAGATGTATTGATAGCTTTTGAAGA
GAAACCGTCAGAAATGACTGATAGCAATTCATCGCCTATTGAACTAGACT
ACGACCAACTAAAGGAGGCTTGTTCAGCTTACCAagctcaaaacaatttt
ttgaacaGTGAAATATTGGAGTTACACAAACTACGTACATTGGATGCTGA
AAAGATATTGAATGCAAATGATAACCTTGAGATGAAAGAAGCGGAGGTGA
TCAAAATCAGAAGTCGATATTTATGGTTACTTAAAGATTGTGCTGGACCT
AAACGAGaaacgAACATGGAGTCAGACGGAGTGCTGGAGAAATTAATCGA
TGAAGCCATCAACGAAAAAGCTGACTCAACAACTGAAAAGAAAAGCCCTA
CTGAGATAAGGTTTGCAGACAAGTATGGATTTTATGATCAAATCGAGAAA
TCTGACGAGAACGCTTTAGAATCACTTGCTGACCATTTCGAATcactcag
tggggataaagagCTCGGTTCATTAGAAGTTTCACACGGTGTGAAATGGG
AAAATTATTTGGTAGCACAAGGTACCGCACCACTACAGAAAACGGAGGAA
CTCAAAGCACTCGTCCGAAGTGGTATCCCACACGAATTCCGTGCGCGCGT
CTGGGGCGATCTCGTCCGCCTGCGTAGTGATCACGAGCGGACGATTGCTG
GGCAAGGCTACTATGCTAACTTAttgaaagagaagaaaggagcTTACTCC
CCGTCTGCCAAACAGATTGAATTGGACTTGTTGAGAACGTTACCGAACAA
CAAATATTATGATACGCTTGAATCTGAGGGGatttcaaaactACGACGCA
TTTTGACAGCGTACAGTTGGCATAACCCAGCTGTTGGATACTGTCAAGGA
TTAAATCGTTTGGGAGCCATCGCACTGTTGTATTTAGATGAAGAAACAGC
TTTCTGgTGTCTTGTAGCGATCACTGAACATCTAATGCCAATTGATTATT
ACAGCAGAACACTGCTCGGTGCGCAAATCGATCAAAAAGTATTTCGTGAC
TTGTTGGACGAAAAATGTCCGAAACTGAGTGCTCATCTTGTCTCCTTGCA
GTTCGACATATCGTTGGTATCATTCAATTGGTTCCTGACTGTTTTTGTTG
ATCTCTTTCCGATTGAGTTGACGTTAAGAGTGTGGGATACATTTCTCTTC
GAAGGTAGCAAGGTTTTATTCCGGTACGCATTGTCCGTCTTCAAACTTTT
CGAAGAAGAATTCCTACGCTTTAAAGATCCTGGACCGATGTTCAACTTTT
TCCGAAATCTACCCAAAAAGAAATTCAACATTCAAAAGATTTGTTACATA
GCTTTCAACACGATGAACCCCTTTAGTCGTCGTAATGTGGAATCGAAAAG
GAAATTCTACAGACCTATTCTTCAAGCACAACTTGACGAGTTTGAAATTA
TGCGTGAGGAATACAAGGAGAAACGGGAAGACAGTATTTCTATTCACGAT
GAAGAACCAATCAGTGACGACGAGAACTAAATGACTTCAAAAAAGGAAGT
CCAAGATCCTTGGGAAATACTAGAGGTTCCAGCTGTGATAAATTTCTCTT
CAAAATCCAATGAAGATGAGGGAGAAGAGaatgatttttctcaaaacaac
agcaaaacaaaaaaGGACAACAAAGAAAGGTTGTGTGGCTACTTGAATAA
AATGGGAGcCGGTATCATCAAAGGTTGGAAGAAAAGATGGTTTGTTTATG
ATCCACGTAGATGTCTACTTTTCTATTATCGTAGACCCCAAGACACTGAA
CCATTAGGGACTATAGATATAGCAAGTGCCACATTTTCCTACAACCCAAA
TGTAAAGGCCTTGTTTTCAATAAGTTCTGGAGACAGATTGTATCAACTTG
AGGCACCTGACAACAACGCCATGATGTTTTGGTTACAAGAACTGCAAGCC
AAAAGAcgagaattttcaaaacttgtAGAAGCAAATGCAGGCAATAATAG
ACCAACAAGTGGTTTGCTTTCTGATCCGATAGATGCTCCACAAGGAGGTG
ATGATGAAGCTGATGGTTTCAATAAAATAATTGAAAGACCTCACAATGTT
GGTGAGAAGACTGCTCTCGATTCTAAAGGAAATTTTTCATTCACACACTT
GaacaaagaattcaaaaattGGAGaaaatcaaccttttacacagaaactg
gggaggcaattttaaATGAGAAATCAGCTGCTTCTACGCCAGAACAAGAA
AAGAAAAGTCCTAACATGCAAAGAAGAGAAGATGATACAAAAATTCTAGA
AAGTGGAAACAAACGAAGaGTCGATTTTGGTTTCTCAAAGATGGTAGCAA
ATCTGAGGAATACAAATATGCCAGTGATTAGCTCCCCTcaaccaaacaac
aacaacataaaTCAATGCCGAGATTGTATGGAGaaattgaatatggTCAA
AACTCTCCAAGAAGCAATTTCAATGGCCGAAAAGGAAATTACTACACGAG
ATGAGGTTATTGAAAGTATAAGCGAACAACTAAgaTTTGCATCAAGCTCC
CCAACATTAGTGGAAAAAGCACCAGACATCGAAGAAGCGGAAGAGCGGGA
ACTCTATATACTCAAGctCAGTCGAATGATAAAAAGCTTGAATGAAAAAG
TTGACGAATTGACAACTACGATACGtgaaaatgaaCGAACTCTTGAAGAG
TACGAGCAAAAGGAGAGAGTCTTGAAAGAAATGATTCATGCTAAAGATAA
TTCAATCATCGCCTTGACGAACCAGGTATTTTCTTTGGAAGAGAAAGAAA
CAACAGACGTCGCTCAAGATGTATTGATAGCTTTTGAAGAGAAACCGTCA
GAAATGACTGATAGCAATTCATCGCCTATTGAACTAGACTACGACCAACT
AAAGGAGGCTTGTTCAGCTTACCAagctcaaaacaattttttgaacaGTG
AAATATTGGAGTTACACAAACTACGTACATTGGATGCTGAAAAGATATTG
AATGCAAATGATAACCTTGAGATGAAAGAAGCGGAGGTGATCAAAATCAG
AAGTCGATATTTATGGTTACTTAAAGATTGTGCTGGACCTAAACGAGaaa
cgAACATGGAGTCAGACGGAGTGCTGGAGAAATTAATCGATGAAGCCATC
AACGAAAAAGCTGACTCAACAACTGAAAAGAAAAGCCCTACTGAGATAAG
GTTTGCAGACAAGTATGGATTTTATGATCAAATCGAGAAATCTGACGAGA
ACGCTTTAGAATCACTTGCTGACCATTTCGAATcactcagtggggataaa
gagCTCGGTTCATTAGAAGTTTCACACGGTGTGAAATGGGAAAATTATTT
GGTAGCACAAGGTACCGCACCACTACAGAAAACGGAGGAACTCAAAGCAC
TCGTCCGAAGTGGTATCCCACACGAATTCCGTGCGCGCGTCTGGGGCGAT
CTCGTCCGCCTGCGTAGTGATCACGAGCGGACGATTGCTGGGCAAGGCTA
CTATGCTAACTTAttgaaagagaagaaaggagcTTACTCCCCGTCTGCCA
AACAGATTGAATTGGACTTGTTGAGAACGTTACCGAACAACAAATATTAT
GATACGCTTGAATCTGAGGGGatttcaaaactACGACGCATTTTGACAGC
GTACAGTTGGCATAACCCAGCTGTTGGATACTGTCAAGGATTAAATCGTT
TGGGAGCCATCGCACTGTTGTATTTAGATGAAGAAACAGCTTTCTGgTGT
CTTGTAGCGATCACTGAACATCTAATGCCAATTGATTATTACAGCAGAAC
ACTGCTCGGTGCGCAAATCGATCAAAAAGTATTTCGTGACTTGTTGGACG
AAAAATGTCCGAAACTGAGTGCTCATCTTGTCTCCTTGCAGTTCGACATA
TCGTTGGTATCATTCAATTGGTTCCTGACTGTTTTTGTTGATCTCTTTCC
GATTGAGTTGACGTTAAGAGTGTGGGATACATTTCTCTTCGAAGGTAGCA
AGGTTTTATTCCGGTACGCATTGTCCGTCTTCAAACTTTTCGAAGAAGAA
TTCCTACGCTTTAAAGATCCTGGACCGATGTTCAACTTTTTCCGAAATCT
ACCCAAAAAGAAATTCAACATTCAAAAGATTTGTTACATAGCTTTCAACA
CGATGAACCCCTTTAGTCGTCGTAATGTGGAATCGAAAAGGAAATTCTAC
AGACCTATTCTTCAAGCACAACTTGACGAGTTTGAAATTATGCGTGAGGA
ATACAAGGAGAAACGGGAAGACAGTATTTCTATTCACGATGAAGAACCAA
TCAGTGACGACGAGAACTAAATGACTTCAAAAAAGGAAGTCCAAGATCCT
TGGGAAATACTAGAGGTTCCAGCTGTGATAAATTTCTCTTCAAAATCCAA
TGAAGATGAGGGAGAAGAGaatgatttttctcaaaacaacagcaaaacaa
aaaaGGACAACAAAGAAAGGTTGTGTGGCTACTTGAATAAAATGGGAGcC
GGTATCATCAAAGGTTGGAAGAAAAGATGGTTTGTTTATGATCCACGTAG
ATGTCTACTTTTCTATTATCGTAGACCCCAAGACACTGAACCATTAGGGA
CTATAGATATAGCAAGTGCCACATTTTCCTACAACCCAAATGTAAAGGCC
TTGTTTTCAATAAGTTCTGGAGACAGATTGTATCAACTTGAGGCACCTGA
CAACAACGCCATGATGTTTTGGTTACAAGAACTGCAAGCCAAAAGAcgag
aattttcaaaacttgtAGAAGCAAATGCAGGCAATAATAGACCAACAAGT
GGTTTGCTTTCTGATCCGATAGATGCTCCACAAGGAGGTGATGATGAAGC
TGATGGTTTCAATAAAATAATTGAAAGACCTCACAATGTTGGTGAGAAGA
CTGCTCTCGATTCTAAAGGAAATTTTTCATTCACACACTTGaacaaagaa
ttcaaaaattGGAGaaaatcaaccttttacacagaaactggggaggcaat
tttaaATGAGAAATCAGCTGCTTCTACGCCAGAACAAGAAAAGAAAAGTC
CTAACATGCAAAGAAGAGAAGATGATACAAAAATTCTAGAAAGTGGAAAC
AAACGAAGaGTCGATTTTGGTTTCTCAAAGATGGTAGCAAATCTGAGGAA
TACAAATATGCCAGTGATTAGCTCCCCTcaaccaaacaacaacaacataa
aTCAATGCCGAGATTGTATGGAGaaattgaatatggTCAAAACTCTCCAA
GAAGCAATTTCAATGGCCGAAAAGGAAATTACTACACGAGATGAGGTTAT
TGAAAGTATAAGCGAACAACTAAgaTTTGCATCAAGCTCCCCAACATTAG
TGGAAAAAGCACCAGACATCGAAGAAGCGGAAGAGCGGGAACTCTATATA
CTCAAGctCAGTCGAATGATAAAAAGCTTGAATGAAAAAGTTGACGAATT
GACAACTACGATACGtgaaaatgaaCGAACTCTTGAAGAGTACGAGCAAA
AGGAGAGAGTCTTGAAAGAAATGATTCATGCTAAAGATAATTCAATCATC
GCCTTGACGAACCAGGTATTTTCTTTGGAAGAGAAAGAAACAACAGACGT
CGCTCAAGATGTATTGATAGCTTTTGAAGAGAAACCGTCAGAAATGACTG
ATAGCAATTCATCGCCTATTGAACTAGACTACGACCAACTAAAGGAGGCT
TGTTCAGCTTACCAagctcaaaacaattttttgaacaGTGAAATATTGGA
GTTACACAAACTACGTACATTGGATGCTGAAAAGATATTGAATGCAAATG
ATAACCTTGAGATGAAAGAAGCGGAGGTGATCAAAATCAGAAGTCGATAT
TTATGGTTACTTAAAGATTGTGCTGGACCTAAACGAGaaacgAACATGGA
GTCAGACGGAGTGCTGGAGAAATTAATCGATGAAGCCATCAACGAAAAAG
CTGACTCAACAACTGAAAAGAAAAGCCCTACTGAGATAAGGTTTGCAGAC
AAGTATGGATTTTATGATCAAATCGAGAAATCTGACGAGAACGCTTTAGA
ATCACTTGCTGACCATTTCGAATcactcagtggggataaagagCTCGGTT
CATTAGAAGTTTCACACGGTGTGAAATGGGAAAATTATTTGGTAGCACAA
GGTACCGCACCACTACAGAAAACGGAGGAACTCAAAGCACTCGTCCGAAG
TGGTATCCCACACGAATTCCGTGCGCGCGTCTGGGGCGATCTCGTCCGCC
TGCGTAGTGATCACGAGCGGACGATTGCTGGGCAAGGCTACTATGCTAAC
TTAttgaaagagaagaaaggagcTTACTCCCCGTCTGCCAAACAGATTGA
ATTGGACTTGTTGAGAACGTTACCGAACAACAAATATTATGATACGCTTG
AATCTGAGGGGatttcaaaactACGACGCATTTTGACAGCGTACAGTTGG
CATAACCCAGCTGTTGGATACTGTCAAGGATTAAATCGTTTGGGAGCCAT
CGCACTGTTGTATTTAGATGAAGAAACAGCTTTCTGgTGTCTTGTAGCGA
TCACTGAACATCTAATGCCAATTGATTATTACAGCAGAACACTGCTCGGT
GCGCAAATCGATCAAAAAGTATTTCGTGACTTGTTGGACGAAAAATGTCC
GAAACTGAGTGCTCATCTTGTCTCCTTGCAGTTCGACATATCGTTGGTAT
CATTCAATTGGTTCCTGACTGTTTTTGTTGATCTCTTTCCGATTGAGTTG
ACGTTAAGAGTGTGGGATACATTTCTCTTCGAAGGTAGCAAGGTTTTATT
CCGGTACGCATTGTCCGTCTTCAAACTTTTCGAAGAAGAATTCCTACGCT
TTAAAGATCCTGGACCGATGTTCAACTTTTTCCGAAATCTACCCAAAAAG
AAATTCAACATTCAAAAGATTTGTTACATAGCTTTCAACACGATGAACCC
CTTTAGTCGTCGTAATGTGGAATCGAAAAGGAAATTCTACAGACCTATTC
TTCAAGCACAACTTGACGAGTTTGAAATTATGCGTGAGGAATACAAGGAG
AAACGGGAAGACAGTATTTCTATTCACGATGAAGAACCAATCAGTGACGA
CGAGAACTAAATGACTTCAAAAAAGGAAGTCCAAGATCCTTGGGAAATAC
TAGAGGTTCCAGCTGTGATAAATTTCTCTTCAAAATCCAATGAAGATGAG
GGAGAAGAGaatgatttttctcaaaacaacagcaaaacaaaaaaGGACAA
CAAAGAAAGGTTGTGTGGCTACTTGAATAAAATGGGAGcCGGTATCATCA
AAGGTTGGAAGAAAAGATGGTTTGTTTATGATCCACGTAGATGTCTACTT
TTCTATTATCGTAGACCCCAAGACACTGAACCATTAGGGACTATAGATAT
AGCAAGTGCCACATTTTCCTACAACCCAAATGTAAAGGCCTTGTTTTCAA
TAAGTTCTGGAGACAGATTGTATCAACTTGAGGCACCTGACAACAACGCC
ATGATGTTTTGGTTACAAGAACTGCAAGCCAAAAGAcgagaattttcaaa
acttgtAGAAGCAAATGCAGGCAATAATAGACCAACAAGTGGTTTGCTTT
CTGATCCGATAGATGCTCCACAAGGAGGTGATGATGAAGCTGATGGTTTC
AATAAAATAATTGAAAGACCTCACAATGTTGGTGAGAAGACTGCTCTCGA
TTCTAAAGGAAATTTTTCATTCACACACTTGaacaaagaattcaaaaatt
GGAGaaaatcaaccttttacacagaaactggggaggcaattttaaATGAG
AAATCAGCTGCTTCTACGCCAGAACAAGAAAAGAAAAGTCCTAACATGCA
AAGAAGAGAAGATGATACAAAAATTCTAGAAAGTGGAAACAAACGAAGaG
TCGATTTTGGTTTCTCAAAGATGGTAGCAAATCTGAGGAATACAAATATG
CCAGTGATTAGCTCCCCTcaaccaaacaacaacaacataaaTCAATGCCG
AGATTGTATGGAGaaattgaatatggTCAAAACTCTCCAAGAAGCAATTT
CAATGGCCGAAAAGGAAATTACTACACGAGATGAGGTTATTGAAAGTATA
AGCGAACAACTAAgaTTTGCATCAAGCTCCCCAACATTAGTGGAAAAAGC
ACCAGACATCGAAGAAGCGGAAGAGCGGGAACTCTATATACTCAAGctCA
GTCGAATGATAAAAAGCTTGAATGAAAAAGTTGACGAATTGACAACTACG
ATACGtgaaaatgaaCGAACTCTTGAAGAGTACGAGCAAAAGGAGAGAGT
CTTGAAAGAAATGATTCATGCTAAAGATAATTCAATCATCGCCTTGACGA
ACCAGGTATTTTCTTTGGAAGAGAAAGAAACAACAGACGTCGCTCAAGAT
GTATTGATAGCTTTTGAAGAGAAACCGTCAGAAATGACTGATAGCAATTC
ATCGCCTATTGAACTAGACTACGACCAACTAAAGGAGGCTTGTTCAGCTT
ACCAagctcaaaacaattttttgaacaGTGAAATATTGGAGTTACACAAA
CTACGTACATTGGATGCTGAAAAGATATTGAATGCAAATGATAACCTTGA
GATGAAAGAAGCGGAGGTGATCAAAATCAGAAGTCGATATTTATGGTTAC
TTAAAGATTGTGCTGGACCTAAACGAGaaacgAACATGGAGTCAGACGGA
GTGCTGGAGAAATTAATCGATGAAGCCATCAACGAAAAAGCTGACTCAAC
AACTGAAAAGAAAAGCCCTACTGAGATAAGGTTTGCAGACAAGTATGGAT
TTTATGATCAAATCGAGAAATCTGACGAGAACGCTTTAGAATCACTTGCT
GACCATTTCGAATcactcagtggggataaagagCTCGGTTCATTAGAAGT
TTCACACGGTGTGAAATGGGAAAATTATTTGGTAGCACAAGGTACCGCAC
CACTACAGAAAACGGAGGAACTCAAAGCACTCGTCCGAAGTGGTATCCCA
CACGAATTCCGTGCGCGCGTCTGGGGCGATCTCGTCCGCCTGCGTAGTGA
TCACGAGCGGACGATTGCTGGGCAAGGCTACTATGCTAACTTAttgaaag
agaagaaaggagcTTACTCCCCGTCTGCCAAACAGATTGAATTGGACTTG
TTGAGAACGTTACCGAACAACAAATATTATGATACGCTTGAATCTGAGGG
GatttcaaaactACGACGCATTTTGACAGCGTACAGTTGGCATAACCCAG
CTGTTGGATACTGTCAAGGATTAAATCGTTTGGGAGCCATCGCACTGTTG
TATTTAGATGAAGAAACAGCTTTCTGgTGTCTTGTAGCGATCACTGAACA
TCTAATGCCAATTGATTATTACAGCAGAACACTGCTCGGTGCGCAAATCG
ATCAAAAAGTATTTCGTGACTTGTTGGACGAAAAATGTCCGAAACTGAGT
GCTCATCTTGTCTCCTTGCAGTTCGACATATCGTTGGTATCATTCAATTG
GTTCCTGACTGTTTTTGTTGATCTCTTTCCGATTGAGTTGACGTTAAGAG
TGTGGGATACATTTCTCTTCGAAGGTAGCAAGGTTTTATTCCGGTACGCA
TTGTCCGTCTTCAAACTTTTCGAAGAAGAATTCCTACGCTTTAAAGATCC
TGGACCGATGTTCAACTTTTTCCGAAATCTACCCAAAAAGAAATTCAACA
TTCAAAAGATTTGTTACATAGCTTTCAACACGATGAACCCCTTTAGTCGT
CGTAATGTGGAATCGAAAAGGAAATTCTACAGACCTATTCTTCAAGCACA
ACTTGACGAGTTTGAAATTATGCGTGAGGAATACAAGGAGAAACGGGAAG
ACAGTATTTCTATTCACGATGAAGAACCAATCAGTGACGACGAGAACTAA
ATGACTTCAAAAAAGGAAGTCCAAGATCCTTGGGAAATACTAGAGGTTCC
AGCTGTGATAAATTTCTCTTCAAAATCCAATGAAGATGAGGGAGAAGAGa
atgatttttctcaaaacaacagcaaaacaaaaaaGGACAACAAAGAAAGG
TTGTGTGGCTACTTGAATAAAATGGGAGcCGGTATCATCAAAGGTTGGAA
GAAAAGATGGTTTGTTTATGATCCACGTAGATGTCTACTTTTCTATTATC
GTAGACCCCAAGACACTGAACCATTAGGGACTATAGATATAGCAAGTGCC
ACATTTTCCTACAACCCAAATGTAAAGGCCTTGTTTTCAATAAGTTCTGG
AGACAGATTGTATCAACTTGAGGCACCTGACAACAACGCCATGATGTTTT
GGTTACAAGAACTGCAAGCCAAAAGAcgagaattttcaaaacttgtAGAA
GCAAATGCAGGCAATAATAGACCAACAAGTGGTTTGCTTTCTGATCCGAT
AGATGCTCCACAAGGAGGTGATGATGAAGCTGATGGTTTCAATAAAATAA
TTGAAAGACCTCACAATGTTGGTGAGAAGACTGCTCTCGATTCTAAAGGA
AATTTTTCATTCACACACTTGaacaaagaattcaaaaattGGAGaaaatc
aaccttttacacagaaactggggaggcaattttaaATGAGAAATCAGCTG
CTTCTACGCCAGAACAAGAAAAGAAAAGTCCTAACATGCAAAGAAGAGAA
GATGATACAAAAATTCTAGAAAGTGGAAACAAACGAAGaGTCGATTTTGG
TTTCTCAAAGATGGTAGCAAATCTGAGGAATACAAATATGCCAGTGATTA
GCTCCCCTcaaccaaacaacaacaacataaaTCAATGCCGAGATTGTATG
GAGaaattgaatatggTCAAAACTCTCCAAGAAGCAATTTCAATGGCCGA
AAAGGAAATTACTACACGAGATGAGGTTATTGAAAGTATAAGCGAACAAC
TAAgaTTTGCATCAAGCTCCCCAACATTAGTGGAAAAAGCACCAGACATC
GAAGAAGCGGAAGAGCGGGAACTCTATATACTCAAGctCAGTCGAATGAT
AAAAAGCTTGAATGAAAAAGTTGACGAATTGACAACTACGATACGtgaaa
atgaaCGAACTCTTGAAGAGTACGAGCAAAAGGAGAGAGTCTTGAAAGAA
ATGATTCATGCTAAAGATAATTCAATCATCGCCTTGACGAACCAGGTATT
TTCTTTGGAAGAGAAAGAAACAACAGACGTCGCTCAAGATGTATTGATAG
CTTTTGAAGAGAAACCGTCAGAAATGACTGATAGCAATTCATCGCCTATT
GAACTAGACTACGACCAACTAAAGGAGGCTTGTTCAGCTTACCAagctca
aaacaattttttgaacaGTGAAATATTGGAGTTACACAAACTACGTACAT
TGGATGCTGAAAAGATATTGAATGCAAATGATAACCTTGAGATGAAAGAA
GCGGAGGTGATCAAAATCAGAAGTCGATATTTATGGTTACTTAAAGATTG
TGCTGGACCTAAACGAGaaacgAACATGGAGTCAGACGGAGTGCTGGAGA
AATTAATCGATGAAGCCATCAACGAAAAAGCTGACTCAACAACTGAAAAG
AAAAGCCCTACTGAGATAAGGTTTGCAGACAAGTATGGATTTTATGATCA
AATCGAGAAATCTGACGAGAACGCTTTAGAATCACTTGCTGACCATTTCG
AATcactcagtggggataaagagCTCGGTTCATTAGAAGTTTCACACGGT
GTGAAATGGGAAAATTATTTGGTAGCACAAGGTACCGCACCACTACAGAA
AACGGAGGAACTCAAAGCACTCGTCCGAAGTGGTATCCCACACGAATTCC
GTGCGCGCGTCTGGGGCGATCTCGTCCGCCTGCGTAGTGATCACGAGCGG
ACGATTGCTGGGCAAGGCTACTATGCTAACTTAttgaaagagaagaaagg
agcTTACTCCCCGTCTGCCAAACAGATTGAATTGGACTTGTTGAGAACGT
TACCGAACAACAAATATTATGATACGCTTGAATCTGAGGGGatttcaaaa
ctACGACGCATTTTGACAGCGTACAGTTGGCATAACCCAGCTGTTGGATA
CTGTCAAGGATTAAATCGTTTGGGAGCCATCGCACTGTTGTATTTAGATG
AAGAAACAGCTTTCTGgTGTCTTGTAGCGATCACTGAACATCTAATGCCA
ATTGATTATTACAGCAGAACACTGCTCGGTGCGCAAATCGATCAAAAAGT
ATTTCGTGACTTGTTGGACGAAAAATGTCCGAAACTGAGTGCTCATCTTG
TCTCCTTGCAGTTCGACATATCGTTGGTATCATTCAATTGGTTCCTGACT
GTTTTTGTTGATCTCTTTCCGATTGAGTTGACGTTAAGAGTGTGGGATAC
ATTTCTCTTCGAAGGTAGCAAGGTTTTATTCCGGTACGCATTGTCCGTCT
TCAAACTTTTCGAAGAAGAATTCCTACGCTTTAAAGATCCTGGACCGATG
TTCAACTTTTTCCGAAATCTACCCAAAAAGAAATTCAACATTCAAAAGAT
TTGTTACATAGCTTTCAACACGATGAACCCCTTTAGTCGTCGTAATGTGG
AATCGAAAAGGAAATTCTACAGACCTATTCTTCAAGCACAACTTGACGAG
TTTGAAATTATGCGTGAGGAATACAAGGAGAAACGGGAAGACAGTATTTC
TATTCACGATGAAGAACCAATCAGTGACGACGAGAACTAAATGACTTCAA
AAAAGGAAGTCCAAGATCCTTGGGAAATACTAGAGGTTCCAGCTGTGATA
AATTTCTCTTCAAAATCCAATGAAGATGAGGGAGAAGAGaatgatttttc
tcaaaacaacagcaaaacaaaaaaGGACAACAAAGAAAGGTTGTGTGGCT
ACTTGAATAAAATGGGAGcCGGTATCATCAAAGGTTGGAAGAAAAGATGG
TTTGTTTATGATCCACGTAGATGTCTACTTTTCTATTATCGTAGACCCCA
AGACACTGAACCATTAGGGACTATAGATATAGCAAGTGCCACATTTTCCT
ACAACCCAAATGTAAAGGCCTTGTTTTCAATAAGTTCTGGAGACAGATTG
TATCAACTTGAGGCACCTGACAACAACGCCATGATGTTTTGGTTACAAGA
ACTGCAAGCCAAAAGAcgagaattttcaaaacttgtAGAAGCAAATGCAG
GCAATAATAGACCAACAAGTGGTTTGCTTTCTGATCCGATAGATGCTCCA
CAAGGAGGTGATGATGAAGCTGATGGTTTCAATAAAATAATTGAAAGACC
TCACAATGTTGGTGAGAAGACTGCTCTCGATTCTAAAGGAAATTTTTCAT
TCACACACTTGaacaaagaattcaaaaattGGAGaaaatcaaccttttac
acagaaactggggaggcaattttaaATGAGAAATCAGCTGCTTCTACGCC
AGAACAAGAAAAGAAAAGTCCTAACATGCAAAGAAGAGAAGATGATACAA
AAATTCTAGAAAGTGGAAACAAACGAAGaGTCGATTTTGGTTTCTCAAAG
ATGGTAGCAAATCTGAGGAATACAAATATGCCAGTGATTAGCTCCCCTca
accaaacaacaacaacataaaTCAATGCCGAGATTGTATGGAGaaattga
atatggTCAAAACTCTCCAAGAAGCAATTTCAATGGCCGAAAAGGAAATT
ACTACACGAGATGAGGTTATTGAAAGTATAAGCGAACAACTAAgaTTTGC
ATCAAGCTCCCCAACATTAGTGGAAAAAGCACCAGACATCGAAGAAGCGG
AAGAGCGGGAACTCTATATACTCAAGctCAGTCGAATGATAAAAAGCTTG
AATGAAAAAGTTGACGAATTGACAACTACGATACGtgaaaatgaaCGAAC
TCTTGAAGAGTACGAGCAAAAGGAGAGAGTCTTGAAAGAAATGATTCATG
CTAAAGATAATTCAATCATCGCCTTGACGAACCAGGTATTTTCTTTGGAA
GAGAAAGAAACAACAGACGTCGCTCAAGATGTATTGATAGCTTTTGAAGA
GAAACCGTCAGAAATGACTGATAGCAATTCATCGCCTATTGAACTAGACT
ACGACCAACTAAAGGAGGCTTGTTCAGCTTACCAagctcaaaacaatttt
ttgaacaGTGAAATATTGGAGTTACACAAACTACGTACATTGGATGCTGA
AAAGATATTGAATGCAAATGATAACCTTGAGATGAAAGAAGCGGAGGTGA
TCAAAATCAGAAGTCGATATTTATGGTTACTTAAAGATTGTGCTGGACCT
AAACGAGaaacgAACATGGAGTCAGACGGAGTGCTGGAGAAATTAATCGA
TGAAGCCATCAACGAAAAAGCTGACTCAACAACTGAAAAGAAAAGCCCTA
CTGAGATAAGGTTTGCAGACAAGTATGGATTTTATGATCAAATCGAGAAA
TCTGACGAGAACGCTTTAGAATCACTTGCTGACCATTTCGAATcactcag
tggggataaagagCTCGGTTCATTAGAAGTTTCACACGGTGTGAAATGGG
AAAATTATTTGGTAGCACAAGGTACCGCACCACTACAGAAAACGGAGGAA
CTCAAAGCACTCGTCCGAAGTGGTATCCCACACGAATTCCGTGCGCGCGT
CTGGGGCGATCTCGTCCGCCTGCGTAGTGATCACGAGCGGACGATTGCTG
GGCAAGGCTACTATGCTAACTTAttgaaagagaagaaaggagcTTACTCC
CCGTCTGCCAAACAGATTGAATTGGACTTGTTGAGAACGTTACCGAACAA
CAAATATTATGATACGCTTGAATCTGAGGGGatttcaaaactACGACGCA
TTTTGACAGCGTACAGTTGGCATAACCCAGCTGTTGGATACTGTCAAGGA
TTAAATCGTTTGGGAGCCATCGCACTGTTGTATTTAGATGAAGAAACAGC
TTTCTGgTGTCTTGTAGCGATCACTGAACATCTAATGCCAATTGATTATT
ACAGCAGAACACTGCTCGGTGCGCAAATCGATCAAAAAGTATTTCGTGAC
TTGTTGGACGAAAAATGTCCGAAACTGAGTGCTCATCTTGTCTCCTTGCA
GTTCGACATATCGTTGGTATCATTCAATTGGTTCCTGACTGTTTTTGTTG
ATCTCTTTCCGATTGAGTTGACGTTAAGAGTGTGGGATACATTTCTCTTC
GAAGGTAGCAAGGTTTTATTCCGGTACGCATTGTCCGTCTTCAAACTTTT
CGAAGAAGAATTCCTACGCTTTAAAGATCCTGGACCGATGTTCAACTTTT
TCCGAAATCTACCCAAAAAGAAATTCAACATTCAAAAGATTTGTTACATA
GCTTTCAACACGATGAACCCCTTTAGTCGTCGTAATGTGGAATCGAAAAG
GAAATTCTACAGACCTATTCTTCAAGCACAACTTGACGAGTTTGAAATTA
TGCGTGAGGAATACAAGGAGAAACGGGAAGACAGTATTTCTATTCACGAT
GAAGAACCAATCAGTGACGACGAGAACTAAATGACTTCAAAAAAGGAAGT
CCAAGATCCTTGGGAAATACTAGAGGTTCCAGCTGTGATAAATTTCTCTT
CAAAATCCAATGAAGATGAGGGAGAAGAGaatgatttttctcaaaacaac
agcaaaacaaaaaaGGACAACAAAGAAAGGTTGTGTGGCTACTTGAATAA
AATGGGAGcCGGTATCATCAAAGGTTGGAAGAAAAGATGGTTTGTTTATG
ATCCACGTAGATGTCTACTTTTCTATTATCGTAGACCCCAAGACACTGAA
CCATTAGGGACTATAGATATAGCAAGTGCCACATTTTCCTACAACCCAAA
TGTAAAGGCCTTGTTTTCAATAAGTTCTGGAGACAGATTGTATCAACTTG
AGGCACCTGACAACAACGCCATGATGTTTTGGTTACAAGAACTGCAAGCC
AAAAGAcgagaattttcaaaacttgtAGAAGCAAATGCAGGCAATAATAG
ACCAACAAGTGGTTTGCTTTCTGATCCGATAGATGCTCCACAAGGAGGTG
ATGATGAAGCTGATGGTTTCAATAAAATAATTGAAAGACCTCACAATGTT
GGTGAGAAGACTGCTCTCGATTCTAAAGGAAATTTTTCATTCACACACTT
GaacaaagaattcaaaaattGGAGaaaatcaaccttttacacagaaactg
gggaggcaattttaaATGAGAAATCAGCTGCTTCTACGCCAGAACAAGAA
AAGAAAAGTCCTAACATGCAAAGAAGAGAAGATGATACAAAAATTCTAGA
AAGTGGAAACAAACGAAGaGTCGATTTTGGTTTCTCAAAGATGGTAGCAA
ATCTGAGGAATACAAATATGCCAGTGATTAGCTCCCCTcaaccaaacaac
aacaacataaaTCAATGCCGAGATTGTATGGAGaaattgaatatggTCAA
AACTCTCCAAGAAGCAATTTCAATGGCCGAAAAGGAAATTACTACACGAG
ATGAGGTTATTGAAAGTATAAGCGAACAACTAAgaTTTGCATCAAGCTCC
CCAACATTAGTGGAAAAAGCACCAGACATCGAAGAAGCGGAAGAGCGGGA
ACTCTATATACTCAAGctCAGTCGAATGATAAAAAGCTTGAATGAAAAAG
TTGACGAATTGACAACTACGATACGtgaaaatgaaCGAACTCTTGAAGAG
TACGAGCAAAAGGAGAGAGTCTTGAAAGAAATGATTCATGCTAAAGATAA
TTCAATCATCGCCTTGACGAACCAGGTATTTTCTTTGGAAGAGAAAGAAA
CAACAGACGTCGCTCAAGATGTATTGATAGCTTTTGAAGAGAAACCGTCA
GAAATGACTGATAGCAATTCATCGCCTATTGAACTAGACTACGACCAACT
AAAGGAGGCTTGTTCAGCTTACCAagctcaaaacaattttttgaacaGTG
AAATATTGGAGTTACACAAACTACGTACATTGGATGCTGAAAAGATATTG
AATGCAAATGATAACCTTGAGATGAAAGAAGCGGAGGTGATCAAAATCAG
AAGTCGATATTTATGGTTACTTAAAGATTGTGCTGGACCTAAACGAGaaa
cgAACATGGAGTCAGACGGAGTGCTGGAGAAATTAATCGATGAAGCCATC
AACGAAAAAGCTGACTCAACAACTGAAAAGAAAAGCCCTACTGAGATAAG
GTTTGCAGACAAGTATGGATTTTATGATCAAATCGAGAAATCTGACGAGA
ACGCTTTAGAATCACTTGCTGACCATTTCGAATcactcagtggggataaa
gagCTCGGTTCATTAGAAGTTTCACACGGTGTGAAATGGGAAAATTATTT
GGTAGCACAAGGTACCGCACCACTACAGAAAACGGAGGAACTCAAAGCAC
TCGTCCGAAGTGGTATCCCACACGAATTCCGTGCGCGCGTCTGGGGCGAT
CTCGTCCGCCTGCGTAGTGATCACGAGCGGACGATTGCTGGGCAAGGCTA
CTATGCTAACTTAttgaaagagaagaaaggagcTTACTCCCCGTCTGCCA
AACAGATTGAATTGGACTTGTTGAGAACGTTACCGAACAACAAATATTAT
GATACGCTTGAATCTGAGGGGatttcaaaactACGACGCATTTTGACAGC
GTACAGTTGGCATAACCCAGCTGTTGGATACTGTCAAGGATTAAATCGTT
TGGGAGCCATCGCACTGTTGTATTTAGATGAAGAAACAGCTTTCTGgTGT
CTTGTAGCGATCACTGAACATCTAATGCCAATTGATTATTACAGCAGAAC
ACTGCTCGGTGCGCAAATCGATCAAAAAGTATTTCGTGACTTGTTGGACG
AAAAATGTCCGAAACTGAGTGCTCATCTTGTCTCCTTGCAGTTCGACATA
TCGTTGGTATCATTCAATTGGTTCCTGACTGTTTTTGTTGATCTCTTTCC
GATTGAGTTGACGTTAAGAGTGTGGGATACATTTCTCTTCGAAGGTAGCA
AGGTTTTATTCCGGTACGCATTGTCCGTCTTCAAACTTTTCGAAGAAGAA
TTCCTACGCTTTAAAGATCCTGGACCGATGTTCAACTTTTTCCGAAATCT
ACCCAAAAAGAAATTCAACATTCAAAAGATTTGTTACATAGCTTTCAACA
CGATGAACCCCTTTAGTCGTCGTAATGTGGAATCGAAAAGGAAATTCTAC
AGACCTATTCTTCAAGCACAACTTGACGAGTTTGAAATTATGCGTGAGGA
ATACAAGGAGAAACGGGAAGACAGTATTTCTATTCACGATGAAGAACCAA
TCAGTGACGACGAGAACTAAATGACTTCAAAAAAGGAAGTCCAAGATCCT
TGGGAAATACTAGAGGTTCCAGCTGTGATAAATTTCTCTTCAAAATCCAA
TGAAGATGAGGGAGAAGAGaatgatttttctcaaaacaacagcaaaacaa
aaaaGGACAACAAAGAAAGGTTGTGTGGCTACTTGAATAAAATGGGAGcC
GGTATCATCAAAGGTTGGAAGAAAAGATGGTTTGTTTATGATCCACGTAG
ATGTCTACTTTTCTATTATCGTAGACCCCAAGACACTGAACCATTAGGGA
CTATAGATATAGCAAGTGCCACATTTTCCTACAACCCAAATGTAAAGGCC
TTGTTTTCAATAAGTTCTGGAGACAGATTGTATCAACTTGAGGCACCTGA
CAACAACGCCATGATGTTTTGGTTACAAGAACTGCAAGCCAAAAGAcgag
aattttcaaaacttgtAGAAGCAAATGCAGGCAATAATAGACCAACAAGT
GGTTTGCTTTCTGATCCGATAGATGCTCCACAAGGAGGTGATGATGAAGC
TGATGGTTTCAATAAAATAATTGAAAGACCTCACAATGTTGGTGAGAAGA
CTGCTCTCGATTCTAAAGGAAATTTTTCATTCACACACTTGaacaaagaa
ttcaaaaattGGAGaaaatcaaccttttacacagaaactggggaggcaat
tttaaATGAGAAATCAGCTGCTTCTACGCCAGAACAAGAAAAGAAAAGTC
CTAACATGCAAAGAAGAGAAGATGATACAAAAATTCTAGAAAGTGGAAAC
AAACGAAGaGTCGATTTTGGTTTCTCAAAGATGGTAGCAAATCTGAGGAA
TACAAATATGCCAGTGATTAGCTCCCCTcaaccaaacaacaacaacataa
aTCAATGCCGAGATTGTATGGAGaaattgaatatggTCAAAACTCTCCAA
GAAGCAATTTCAATGGCCGAAAAGGAAATTACTACACGAGATGAGGTTAT
TGAAAGTATAAGCGAACAACTAAgaTTTGCATCAAGCTCCCCAACATTAG
TGGAAAAAGCACCAGACATCGAAGAAGCGGAAGAGCGGGAACTCTATATA
CTCAAGctCAGTCGAATGATAAAAAGCTTGAATGAAAAAGTTGACGAATT
GACAACTACGATACGtgaaaatgaaCGAACTCTTGAAGAGTACGAGCAAA
AGGAGAGAGTCTTGAAAGAAATGATTCATGCTAAAGATAATTCAATCATC
GCCTTGACGAACCAGGTATTTTCTTTGGAAGAGAAAGAAACAACAGACGT
CGCTCAAGATGTATTGATAGCTTTTGAAGAGAAACCGTCAGAAATGACTG
ATAGCAATTCATCGCCTATTGAACTAGACTACGACCAACTAAAGGAGGCT
TGTTCAGCTTACCAagctcaaaacaattttttgaacaGTGAAATATTGGA
GTTACACAAACTACGTACATTGGATGCTGAAAAGATATTGAATGCAAATG
ATAACCTTGAGATGAAAGAAGCGGAGGTGATCAAAATCAGAAGTCGATAT
TTATGGTTACTTAAAGATTGTGCTGGACCTAAACGAGaaacgAACATGGA
GTCAGACGGAGTGCTGGAGAAATTAATCGATGAAGCCATCAACGAAAAAG
CTGACTCAACAACTGAAAAGAAAAGCCCTACTGAGATAAGGTTTGCAGAC
AAGTATGGATTTTATGATCAAATCGAGAAATCTGACGAGAACGCTTTAGA
ATCACTTGCTGACCATTTCGAATcactcagtggggataaagagCTCGGTT
CATTAGAAGTTTCACACGGTGTGAAATGGGAAAATTATTTGGTAGCACAA
GGTACCGCACCACTACAGAAAACGGAGGAACTCAAAGCACTCGTCCGAAG
TGGTATCCCACACGAATTCCGTGCGCGCGTCTGGGGCGATCTCGTCCGCC
TGCGTAGTGATCACGAGCGGACGATTGCTGGGCAAGGCTACTATGCTAAC
TTAttgaaagagaagaaaggagcTTACTCCCCGTCTGCCAAACAGATTGA
ATTGGACTTGTTGAGAACGTTACCGAACAACAAATATTATGATACGCTTG
AATCTGAGGGGatttcaaaactACGACGCATTTTGACAGCGTACAGTTGG
CATAACCCAGCTGTTGGATACTGTCAAGGATTAAATCGTTTGGGAGCCAT
CGCACTGTTGTATTTAGATGAAGAAACAGCTTTCTGgTGTCTTGTAGCGA
TCACTGAACATCTAATGCCAATTGATTATTACAGCAGAACACTGCTCGGT
GCGCAAATCGATCAAAAAGTATTTCGTGACTTGTTGGACGAAAAATGTCC
GAAACTGAGTGCTCATCTTGTCTCCTTGCAGTTCGACATATCGTTGGTAT
CATTCAATTGGTTCCTGACTGTTTTTGTTGATCTCTTTCCGATTGAGTTG
ACGTTAAGAGTGTGGGATACATTTCTCTTCGAAGGTAGCAAGGTTTTATT
CCGGTACGCATTGTCCGTCTTCAAACTTTTCGAAGAAGAATTCCTACGCT
TTAAAGATCCTGGACCGATGTTCAACTTTTTCCGAAATCTACCCAAAAAG
AAATTCAACATTCAAAAGATTTGTTACATAGCTTTCAACACGATGAACCC
CTTTAGTCGTCGTAATGTGGAATCGAAAAGGAAATTCTACAGACCTATTC
TTCAAGCACAACTTGACGAGTTTGAAATTATGCGTGAGGAATACAAGGAG
AAACGGGAAGACAGTATTTCTATTCACGATGAAGAACCAATCAGTGACGA
CGAGAACTAAATGACTTCAAAAAAGGAAGTCCAAGATCCTTGGGAAATAC
TAGAGGTTCCAGCTGTGATAAATTTCTCTTCAAAATCCAATGAAGATGAG
GGAGAAGAGaatgatttttctcaaaacaacagcaaaacaaaaaaGGACAA
CAAAGAAAGGTTGTGTGGCTACTTGAATAAAATGGGAGcCGGTATCATCA
AAGGTTGGAAGAAAAGATGGTTTGTTTATGATCCACGTAGATGTCTACTT
TTCTATTATCGTAGACCCCAAGACACTGAACCATTAGGGACTATAGATAT
AGCAAGTGCCACATTTTCCTACAACCCAAATGTAAAGGCCTTGTTTTCAA
TAAGTTCTGGAGACAGATTGTATCAACTTGAGGCACCTGACAACAACGCC
ATGATGTTTTGGTTACAAGAACTGCAAGCCAAAAGAcgagaattttcaaa
acttgtAGAAGCAAATGCAGGCAATAATAGACCAACAAGTGGTTTGCTTT
CTGATCCGATAGATGCTCCACAAGGAGGTGATGATGAAGCTGATGGTTTC
AATAAAATAATTGAAAGACCTCACAATGTTGGTGAGAAGACTGCTCTCGA
TTCTAAAGGAAATTTTTCATTCACACACTTGaacaaagaattcaaaaatt
GGAGaaaatcaaccttttacacagaaactggggaggcaattttaaATGAG
AAATCAGCTGCTTCTACGCCAGAACAAGAAAAGAAAAGTCCTAACATGCA
AAGAAGAGAAGATGATACAAAAATTCTAGAAAGTGGAAACAAACGAAGaG
TCGATTTTGGTTTCTCAAAGATGGTAGCAAATCTGAGGAATACAAATATG
CCAGTGATTAGCTCCCCTcaaccaaacaacaacaacataaaTCAATGCCG
AGATTGTATGGAGaaattgaatatggTCAAAACTCTCCAAGAAGCAATTT
CAATGGCCGAAAAGGAAATTACTACACGAGATGAGGTTATTGAAAGTATA
AGCGAACAACTAAgaTTTGCATCAAGCTCCCCAACATTAGTGGAAAAAGC
ACCAGACATCGAAGAAGCGGAAGAGCGGGAACTCTATATACTCAAGctCA
GTCGAATGATAAAAAGCTTGAATGAAAAAGTTGACGAATTGACAACTACG
ATACGtgaaaatgaaCGAACTCTTGAAGAGTACGAGCAAAAGGAGAGAGT
CTTGAAAGAAATGATTCATGCTAAAGATAATTCAATCATCGCCTTGACGA
ACCAGGTATTTTCTTTGGAAGAGAAAGAAACAACAGACGTCGCTCAAGAT
GTATTGATAGCTTTTGAAGAGAAACCGTCAGAAATGACTGATAGCAATTC
ATCGCCTATTGAACTAGACTACGACCAACTAAAGGAGGCTTGTTCAGCTT
ACCAagctcaaaacaattttttgaacaGTGAAATATTGGAGTTACACAAA
CTACGTACATTGGATGCTGAAAAGATATTGAATGCAAATGATAACCTTGA
GATGAAAGAAGCGGAGGTGATCAAAATCAGAAGTCGATATTTATGGTTAC
TTAAAGATTGTGCTGGACCTAAACGAGaaacgAACATGGAGTCAGACGGA
GTGCTGGAGAAATTAATCGATGAAGCCATCAACGAAAAAGCTGACTCAAC
AACTGAAAAGAAAAGCCCTACTGAGATAAGGTTTGCAGACAAGTATGGAT
TTTATGATCAAATCGAGAAATCTGACGAGAACGCTTTAGAATCACTTGCT
GACCATTTCGAATcactcagtggggataaagagCTCGGTTCATTAGAAGT
TTCACACGGTGTGAAATGGGAAAATTATTTGGTAGCACAAGGTACCGCAC
CACTACAGAAAACGGAGGAACTCAAAGCACTCGTCCGAAGTGGTATCCCA
CACGAATTCCGTGCGCGCGTCTGGGGCGATCTCGTCCGCCTGCGTAGTGA
TCACGAGCGGACGATTGCTGGGCAAGGCTACTATGCTAACTTAttgaaag
agaagaaaggagcTTACTCCCCGTCTGCCAAACAGATTGAATTGGACTTG
TTGAGAACGTTACCGAACAACAAATATTATGATACGCTTGAATCTGAGGG
GatttcaaaactACGACGCATTTTGACAGCGTACAGTTGGCATAACCCAG
CTGTTGGATACTGTCAAGGATTAAATCGTTTGGGAGCCATCGCACTGTTG
TATTTAGATGAAGAAACAGCTTTCTGgTGTCTTGTAGCGATCACTGAACA
TCTAATGCCAATTGATTATTACAGCAGAACACTGCTCGGTGCGCAAATCG
ATCAAAAAGTATTTCGTGACTTGTTGGACGAAAAATGTCCGAAACTGAGT
GCTCATCTTGTCTCCTTGCAGTTCGACATATCGTTGGTATCATTCAATTG
GTTCCTGACTGTTTTTGTTGATCTCTTTCCGATTGAGTTGACGTTAAGAG
TGTGGGATACATTTCTCTTCGAAGGTAGCAAGGTTTTATTCCGGTACGCA
TTGTCCGTCTTCAAACTTTTCGAAGAAGAATTCCTACGCTTTAAAGATCC
TGGACCGATGTTCAACTTTTTCCGAAATCTACCCAAAAAGAAATTCAACA
TTCAAAAGATTTGTTACATAGCTTTCAACACGATGAACCCCTTTAGTCGT
CGTAATGTGGAATCGAAAAGGAAATTCTACAGACCTATTCTTCAAGCACA
ACTTGACGAGTTTGAAATTATGCGTGAGGAATACAAGGAGAAACGGGAAG
ACAGTATTTCTATTCACGATGAAGAACCAATCAGTGACGACGAGAACTAA
ATGACTTCAAAAAAGGAAGTCCAAGATCCTTGGGAAATACTAGAGGTTCC
AGCTGTGATAAATTTCTCTTCAAAATCCAATGAAGATGAGGGAGAAGAGa
atgatttttctcaaaacaacagcaaaacaaaaaaGGACAACAAAGAAAGG
TTGTGTGGCTACTTGAATAAAATGGGAGcCGGTATCATCAAAGGTTGGAA
GAAAAGATGGTTTGTTTATGATCCACGTAGATGTCTACTTTTCTATTATC
GTAGACCCCAAGACACTGAACCATTAGGGACTATAGATATAGCAAGTGCC
ACATTTTCCTACAACCCAAATGTAAAGGCCTTGTTTTCAATAAGTTCTGG
AGACAGATTGTATCAACTTGAGGCACCTGACAACAACGCCATGATGTTTT
GGTTACAAGAACTGCAAGCCAAAAGAcgagaattttcaaaacttgtAGAA
GCAAATGCAGGCAATAATAGACCAACAAGTGGTTTGCTTTCTGATCCGAT
AGATGCTCCACAAGGAGGTGATGATGAAGCTGATGGTTTCAATAAAATAA
TTGAAAGACCTCACAATGTTGGTGAGAAGACTGCTCTCGATTCTAAAGGA
AATTTTTCATTCACACACTTGaacaaagaattcaaaaattGGAGaaaatc
aaccttttacacagaaactggggaggcaattttaaATGAGAAATCAGCTG
CTTCTACGCCAGAACAAGAAAAGAAAAGTCCTAACATGCAAAGAAGAGAA
GATGATACAAAAATTCTAGAAAGTGGAAACAAACGAAGaGTCGATTTTGG
TTTCTCAAAGATGGTAGCAAATCTGAGGAATACAAATATGCCAGTGATTA
GCTCCCCTcaaccaaacaacaacaacataaaTCAATGCCGAGATTGTATG
GAGaaattgaatatggTCAAAACTCTCCAAGAAGCAATTTCAATGGCCGA
AAAGGAAATTACTACACGAGATGAGGTTATTGAAAGTATAAGCGAACAAC
TAAgaTTTGCATCAAGCTCCCCAACATTAGTGGAAAAAGCACCAGACATC
GAAGAAGCGGAAGAGCGGGAACTCTATATACTCAAGctCAGTCGAATGAT
AAAAAGCTTGAATGAAAAAGTTGACGAATTGACAACTACGATACGtgaaa
atgaaCGAACTCTTGAAGAGTACGAGCAAAAGGAGAGAGTCTTGAAAGAA
ATGATTCATGCTAAAGATAATTCAATCATCGCCTTGACGAACCAGGTATT
TTCTTTGGAAGAGAAAGAAACAACAGACGTCGCTCAAGATGTATTGATAG
CTTTTGAAGAGAAACCGTCAGAAATGACTGATAGCAATTCATCGCCTATT
GAACTAGACTACGACCAACTAAAGGAGGCTTGTTCAGCTTACCAagctca
aaacaattttttgaacaGTGAAATATTGGAGTTACACAAACTACGTACAT
TGGATGCTGAAAAGATATTGAATGCAAATGATAACCTTGAGATGAAAGAA
GCGGAGGTGATCAAAATCAGAAGTCGATATTTATGGTTACTTAAAGATTG
TGCTGGACCTAAACGAGaaacgAACATGGAGTCAGACGGAGTGCTGGAGA
AATTAATCGATGAAGCCATCAACGAAAAAGCTGACTCAACAACTGAAAAG
AAAAGCCCTACTGAGATAAGGTTTGCAGACAAGTATGGATTTTATGATCA
AATCGAGAAATCTGACGAGAACGCTTTAGAATCACTTGCTGACCATTTCG
AATcactcagtggggataaagagCTCGGTTCATTAGAAGTTTCACACGGT
GTGAAATGGGAAAATTATTTGGTAGCACAAGGTACCGCACCACTACAGAA
AACGGAGGAACTCAAAGCACTCGTCCGAAGTGGTATCCCACACGAATTCC
GTGCGCGCGTCTGGGGCGATCTCGTCCGCCTGCGTAGTGATCACGAGCGG
ACGATTGCTGGGCAAGGCTACTATGCTAACTTAttgaaagagaagaaagg
agcTTACTCCCCGTCTGCCAAACAGATTGAATTGGACTTGTTGAGAACGT
TACCGAACAACAAATATTATGATACGCTTGAATCTGAGGGGatttcaaaa
ctACGACGCATTTTGACAGCGTACAGTTGGCATAACCCAGCTGTTGGATA
CTGTCAAGGATTAAATCGTTTGGGAGCCATCGCACTGTTGTATTTAGATG
AAGAAACAGCTTTCTGgTGTCTTGTAGCGATCACTGAACATCTAATGCCA
ATTGATTATTACAGCAGAACACTGCTCGGTGCGCAAATCGATCAAAAAGT
ATTTCGTGACTTGTTGGACGAAAAATGTCCGAAACTGAGTGCTCATCTTG
TCTCCTTGCAGTTCGACATATCGTTGGTATCATTCAATTGGTTCCTGACT
GTTTTTGTTGATCTCTTTCCGATTGAGTTGACGTTAAGAGTGTGGGATAC
ATTTCTCTTCGAAGGTAGCAAGGTTTTATTCCGGTACGCATTGTCCGTCT
TCAAACTTTTCGAAGAAGAATTCCTACGCTTTAAAGATCCTGGACCGATG
TTCAACTTTTTCCGAAATCTACCCAAAAAGAAATTCAACATTCAAAAGAT
TTGTTACATAGCTTTCAACACGATGAACCCCTTTAGTCGTCGTAATGTGG
AATCGAAAAGGAAATTCTACAGACCTATTCTTCAAGCACAACTTGACGAG
TTTGAAATTATGCGTGAGGAATACAAGGAGAAACGGGAAGACAGTATTTC
TATTCACGATGAAGAACCAATCAGTGACGACGAGAACTAAATGACTTCAA
AAAAGGAAGTCCAAGATCCTTGGGAAATACTAGAGGTTCCAGCTGTGATA
AATTTCTCTTCAAAATCCAATGAAGATGAGGGAGAAGAGaatgatttttc
tcaaaacaacagcaaaacaaaaaaGGACAACAAAGAAAGGTTGTGTGGCT
ACTTGAATAAAATGGGAGcCGGTATCATCAAAGGTTGGAAGAAAAGATGG
TTTGTTTATGATCCACGTAGATGTCTACTTTTCTATTATCGTAGACCCCA
AGACACTGAACCATTAGGGACTATAGATATAGCAAGTGCCACATTTTCCT
ACAACCCAAATGTAAAGGCCTTGTTTTCAATAAGTTCTGGAGACAGATTG
TATCAACTTGAGGCACCTGACAACAACGCCATGATGTTTTGGTTACAAGA
ACTGCAAGCCAAAAGAcgagaattttcaaaacttgtAGAAGCAAATGCAG
GCAATAATAGACCAACAAGTGGTTTGCTTTCTGATCCGATAGATGCTCCA
CAAGGAGGTGATGATGAAGCTGATGGTTTCAATAAAATAATTGAAAGACC
TCACAATGTTGGTGAGAAGACTGCTCTCGATTCTAAAGGAAATTTTTCAT
TCACACACTTGaacaaagaattcaaaaattGGAGaaaatcaaccttttac
acagaaactggggaggcaattttaaATGAGAAATCAGCTGCTTCTACGCC
AGAACAAGAAAAGAAAAGTCCTAACATGCAAAGAAGAGAAGATGATACAA
AAATTCTAGAAAGTGGAAACAAACGAAGaGTCGATTTTGGTTTCTCAAAG
ATGGTAGCAAATCTGAGGAATACAAATATGCCAGTGATTAGCTCCCCTca
accaaacaacaacaacataaaTCAATGCCGAGATTGTATGGAGaaattga
atatggTCAAAACTCTCCAAGAAGCAATTTCAATGGCCGAAAAGGAAATT
ACTACACGAGATGAGGTTATTGAAAGTATAAGCGAACAACTAAgaTTTGC
ATCAAGCTCCCCAACATTAGTGGAAAAAGCACCAGACATCGAAGAAGCGG
AAGAGCGGGAACTCTATATACTCAAGctCAGTCGAATGATAAAAAGCTTG
AATGAAAAAGTTGACGAATTGACAACTACGATACGtgaaaatgaaCGAAC
TCTTGAAGAGTACGAGCAAAAGGAGAGAGTCTTGAAAGAAATGATTCATG
CTAAAGATAATTCAATCATCGCCTTGACGAACCAGGTATTTTCTTTGGAA
GAGAAAGAAACAACAGACGTCGCTCAAGATGTATTGATAGCTTTTGAAGA
GAAACCGTCAGAAATGACTGATAGCAATTCATCGCCTATTGAACTAGACT
ACGACCAACTAAAGGAGGCTTGTTCAGCTTACCAagctcaaaacaatttt
ttgaacaGTGAAATATTGGAGTTACACAAACTACGTACATTGGATGCTGA
AAAGATATTGAATGCAAATGATAACCTTGAGATGAAAGAAGCGGAGGTGA
TCAAAATCAGAAGTCGATATTTATGGTTACTTAAAGATTGTGCTGGACCT
AAACGAGaaacgAACATGGAGTCAGACGGAGTGCTGGAGAAATTAATCGA
TGAAGCCATCAACGAAAAAGCTGACTCAACAACTGAAAAGAAAAGCCCTA
CTGAGATAAGGTTTGCAGACAAGTATGGATTTTATGATCAAATCGAGAAA
TCTGACGAGAACGCTTTAGAATCACTTGCTGACCATTTCGAATcactcag
tggggataaagagCTCGGTTCATTAGAAGTTTCACACGGTGTGAAATGGG
AAAATTATTTGGTAGCACAAGGTACCGCACCACTACAGAAAACGGAGGAA
CTCAAAGCACTCGTCCGAAGTGGTATCCCACACGAATTCCGTGCGCGCGT
CTGGGGCGATCTCGTCCGCCTGCGTAGTGATCACGAGCGGACGATTGCTG
GGCAAGGCTACTATGCTAACTTAttgaaagagaagaaaggagcTTACTCC
CCGTCTGCCAAACAGATTGAATTGGACTTGTTGAGAACGTTACCGAACAA
CAAATATTATGATACGCTTGAATCTGAGGGGatttcaaaactACGACGCA
TTTTGACAGCGTACAGTTGGCATAACCCAGCTGTTGGATACTGTCAAGGA
TTAAATCGTTTGGGAGCCATCGCACTGTTGTATTTAGATGAAGAAACAGC
TTTCTGgTGTCTTGTAGCGATCACTGAACATCTAATGCCAATTGATTATT
ACAGCAGAACACTGCTCGGTGCGCAAATCGATCAAAAAGTATTTCGTGAC
TTGTTGGACGAAAAATGTCCGAAACTGAGTGCTCATCTTGTCTCCTTGCA
GTTCGACATATCGTTGGTATCATTCAATTGGTTCCTGACTGTTTTTGTTG
ATCTCTTTCCGATTGAGTTGACGTTAAGAGTGTGGGATACATTTCTCTTC
GAAGGTAGCAAGGTTTTATTCCGGTACGCATTGTCCGTCTTCAAACTTTT
CGAAGAAGAATTCCTACGCTTTAAAGATCCTGGACCGATGTTCAACTTTT
TCCGAAATCTACCCAAAAAGAAATTCAACATTCAAAAGATTTGTTACATA
GCTTTCAACACGATGAACCCCTTTAGTCGTCGTAATGTGGAATCGAAAAG
GAAATTCTACAGACCTATTCTTCAAGCACAACTTGACGAGTTTGAAATTA
TGCGTGAGGAATACAAGGAGAAACGGGAAGACAGTATTTCTATTCACGAT
GAAGAACCAATCAGTGACGACGAGAACTAAATGACTTCAAAAAAGGAAGT
CCAAGATCCTTGGGAAATACTAGAGGTTCCAGCTGTGATAAATTTCTCTT
CAAAATCCAATGAAGATGAGGGAGAAGAGaatgatttttctcaaaacaac
agcaaaacaaaaaaGGACAACAAAGAAAGGTTGTGTGGCTACTTGAATAA
AATGGGAGcCGGTATCATCAAAGGTTGGAAGAAAAGATGGTTTGTTTATG
ATCCACGTAGATGTCTACTTTTCTATTATCGTAGACCCCAAGACACTGAA
CCATTAGGGACTATAGATATAGCAAGTGCCACATTTTCCTACAACCCAAA
TGTAAAGGCCTTGTTTTCAATAAGTTCTGGAGACAGATTGTATCAACTTG
AGGCACCTGACAACAACGCCATGATGTTTTGGTTACAAGAACTGCAAGCC
AAAAGAcgagaattttcaaaacttgtAGAAGCAAATGCAGGCAATAATAG
ACCAACAAGTGGTTTGCTTTCTGATCCGATAGATGCTCCACAAGGAGGTG
ATGATGAAGCTGATGGTTTCAATAAAATAATTGAAAGACCTCACAATGTT
GGTGAGAAGACTGCTCTCGATTCTAAAGGAAATTTTTCATTCACACACTT
GaacaaagaattcaaaaattGGAGaaaatcaaccttttacacagaaactg
gggaggcaattttaaATGAGAAATCAGCTGCTTCTACGCCAGAACAAGAA
AAGAAAAGTCCTAACATGCAAAGAAGAGAAGATGATACAAAAATTCTAGA
AAGTGGAAACAAACGAAGaGTCGATTTTGGTTTCTCAAAGATGGTAGCAA
ATCTGAGGAATACAAATATGCCAGTGATTAGCTCCCCTcaaccaaacaac
aacaacataaaTCAATGCCGAGATTGTATGGAGaaattgaatatggTCAA
AACTCTCCAAGAAGCAATTTCAATGGCCGAAAAGGAAATTACTACACGAG
ATGAGGTTATTGAAAGTATAAGCGAACAACTAAgaTTTGCATCAAGCTCC
CCAACATTAGTGGAAAAAGCACCAGACATCGAAGAAGCGGAAGAGCGGGA
ACTCTATATACTCAAGctCAGTCGAATGATAAAAAGCTTGAATGAAAAAG
TTGACGAATTGACAACTACGATACGtgaaaatgaaCGAACTCTTGAAGAG
TACGAGCAAAAGGAGAGAGTCTTGAAAGAAATGATTCATGCTAAAGATAA
TTCAATCATCGCCTTGACGAACCAGGTATTTTCTTTGGAAGAGAAAGAAA
CAACAGACGTCGCTCAAGATGTATTGATAGCTTTTGAAGAGAAACCGTCA
GAAATGACTGATAGCAATTCATCGCCTATTGAACTAGACTACGACCAACT
AAAGGAGGCTTGTTCAGCTTACCAagctcaaaacaattttttgaacaGTG
AAATATTGGAGTTACACAAACTACGTACATTGGATGCTGAAAAGATATTG
AATGCAAATGATAACCTTGAGATGAAAGAAGCGGAGGTGATCAAAATCAG
AAGTCGATATTTATGGTTACTTAAAGATTGTGCTGGACCTAAACGAGaaa
cgAACATGGAGTCAGACGGAGTGCTGGAGAAATTAATCGATGAAGCCATC
AACGAAAAAGCTGACTCAACAACTGAAAAGAAAAGCCCTACTGAGATAAG
GTTTGCAGACAAGTATGGATTTTATGATCAAATCGAGAAATCTGACGAGA
ACGCTTTAGAATCACTTGCTGACCATTTCGAATcactcagtggggataaa
gagCTCGGTTCATTAGAAGTTTCACACGGTGTGAAATGGGAAAATTATTT
GGTAGCACAAGGTACCGCACCACTACAGAAAACGGAGGAACTCAAAGCAC
TCGTCCGAAGTGGTATCCCACACGAATTCCGTGCGCGCGTCTGGGGCGAT
CTCGTCCGCCTGCGTAGTGATCACGAGCGGACGATTGCTGGGCAAGGCTA
CTATGCTAACTTAttgaaagagaagaaaggagcTTACTCCCCGTCTGCCA
AACAGATTGAATTGGACTTGTTGAGAACGTTACCGAACAACAAATATTAT
GATACGCTTGAATCTGAGGGGatttcaaaactACGACGCATTTTGACAGC
GTACAGTTGGCATAACCCAGCTGTTGGATACTGTCAAGGATTAAATCGTT
TGGGAGCCATCGCACTGTTGTATTTAGATGAAGAAACAGCTTTCTGgTGT
CTTGTAGCGATCACTGAACATCTAATGCCAATTGATTATTACAGCAGAAC
ACTGCTCGGTGCGCAAATCGATCAAAAAGTATTTCGTGACTTGTTGGACG
AAAAATGTCCGAAACTGAGTGCTCATCTTGTCTCCTTGCAGTTCGACATA
TCGTTGGTATCATTCAATTGGTTCCTGACTGTTTTTGTTGATCTCTTTCC
GATTGAGTTGACGTTAAGAGTGTGGGATACATTTCTCTTCGAAGGTAGCA
AGGTTTTATTCCGGTACGCATTGTCCGTCTTCAAACTTTTCGAAGAAGAA
TTCCTACGCTTTAAAGATCCTGGACCGATGTTCAACTTTTTCCGAAATCT
ACCCAAAAAGAAATTCAACATTCAAAAGATTTGTTACATAGCTTTCAACA
CGATGAACCCCTTTAGTCGTCGTAATGTGGAATCGAAAAGGAAATTCTAC
AGACCTATTCTTCAAGCACAACTTGACGAGTTTGAAATTATGCGTGAGGA
ATACAAGGAGAAACGGGAAGACAGTATTTCTATTCACGATGAAGAACCAA
TCAGTGACGACGAGAACTAAATGACTTCAAAAAAGGAAGTCCAAGATCCT
TGGGAAATACTAGAGGTTCCAGCTGTGATAAATTTCTCTTCAAAATCCAA
TGAAGATGAGGGAGAAGAGaatgatttttctcaaaacaacagcaaaacaa
aaaaGGACAACAAAGAAAGGTTGTGTGGCTACTTGAATAAAATGGGAGcC
GGTATCATCAAAGGTTGGAAGAAAAGATGGTTTGTTTATGATCCACGTAG
ATGTCTACTTTTCTATTATCGTAGACCCCAAGACACTGAACCATTAGGGA
CTATAGATATAGCAAGTGCCACATTTTCCTACAACCCAAATGTAAAGGCC
TTGTTTTCAATAAGTTCTGGAGACAGATTGTATCAACTTGAGGCACCTGA
CAACAACGCCATGATGTTTTGGTTACAAGAACTGCAAGCCAAAAGAcgag
aattttcaaaacttgtAGAAGCAAATGCAGGCAATAATAGACCAACAAGT
GGTTTGCTTTCTGATCCGATAGATGCTCCACAAGGAGGTGATGATGAAGC
TGATGGTTTCAATAAAATAATTGAAAGACCTCACAATGTTGGTGAGAAGA
CTGCTCTCGATTCTAAAGGAAATTTTTCATTCACACACTTGaacaaagaa
ttcaaaaattGGAGaaaatcaaccttttacacagaaactggggaggcaat
tttaaATGAGAAATCAGCTGCTTCTACGCCAGAACAAGAAAAGAAAAGTC
CTAACATGCAAAGAAGAGAAGATGATACAAAAATTCTAGAAAGTGGAAAC
AAACGAAGaGTCGATTTTGGTTTCTCAAAGATGGTAGCAAATCTGAGGAA
TACAAATATGCCAGTGATTAGCTCCCCTcaaccaaacaacaacaacataa
aTCAATGCCGAGATTGTATGGAGaaattgaatatggTCAAAACTCTCCAA
GAAGCAATTTCAATGGCCGAAAAGGAAATTACTACACGAGATGAGGTTAT
TGAAAGTATAAGCGAACAACTAAgaTTTGCATCAAGCTCCCCAACATTAG
TGGAAAAAGCACCAGACATCGAAGAAGCGGAAGAGCGGGAACTCTATATA
CTCAAGctCAGTCGAATGATAAAAAGCTTGAATGAAAAAGTTGACGAATT
GACAACTACGATACGtgaaaatgaaCGAACTCTTGAAGAGTACGAGCAAA
AGGAGAGAGTCTTGAAAGAAATGATTCATGCTAAAGATAATTCAATCATC
GCCTTGACGAACCAGGTATTTTCTTTGGAAGAGAAAGAAACAACAGACGT
CGCTCAAGATGTATTGATAGCTTTTGAAGAGAAACCGTCAGAAATGACTG
ATAGCAATTCATCGCCTATTGAACTAGACTACGACCAACTAAAGGAGGCT
TGTTCAGCTTACCAagctcaaaacaattttttgaacaGTGAAATATTGGA
GTTACACAAACTACGTACATTGGATGCTGAAAAGATATTGAATGCAAATG
ATAACCTTGAGATGAAAGAAGCGGAGGTGATCAAAATCAGAAGTCGATAT
TTATGGTTACTTAAAGATTGTGCTGGACCTAAACGAGaaacgAACATGGA
GTCAGACGGAGTGCTGGAGAAATTAATCGATGAAGCCATCAACGAAAAAG
CTGACTCAACAACTGAAAAGAAAAGCCCTACTGAGATAAGGTTTGCAGAC
AAGTATGGATTTTATGATCAAATCGAGAAATCTGACGAGAACGCTTTAGA
ATCACTTGCTGACCATTTCGAATcactcagtggggataaagagCTCGGTT
CATTAGAAGTTTCACACGGTGTGAAATGGGAAAATTATTTGGTAGCACAA
GGTACCGCACCACTACAGAAAACGGAGGAACTCAAAGCACTCGTCCGAAG
TGGTATCCCACACGAATTCCGTGCGCGCGTCTGGGGCGATCTCGTCCGCC
TGCGTAGTGATCACGAGCGGACGATTGCTGGGCAAGGCTACTATGCTAAC
TTAttgaaagagaagaaaggagcTTACTCCCCGTCTGCCAAACAGATTGA
ATTGGACTTGTTGAGAACGTTACCGAACAACAAATATTATGATACGCTTG
AATCTGAGGGGatttcaaaactACGACGCATTTTGACAGCGTACAGTTGG
CATAACCCAGCTGTTGGATACTGTCAAGGATTAAATCGTTTGGGAGCCAT
CGCACTGTTGTATTTAGATGAAGAAACAGCTTTCTGgTGTCTTGTAGCGA
TCACTGAACATCTAATGCCAATTGATTATTACAGCAGAACACTGCTCGGT
GCGCAAATCGATCAAAAAGTATTTCGTGACTTGTTGGACGAAAAATGTCC
GAAACTGAGTGCTCATCTTGTCTCCTTGCAGTTCGACATATCGTTGGTAT
CATTCAATTGGTTCCTGACTGTTTTTGTTGATCTCTTTCCGATTGAGTTG
ACGTTAAGAGTGTGGGATACATTTCTCTTCGAAGGTAGCAAGGTTTTATT
CCGGTACGCATTGTCCGTCTTCAAACTTTTCGAAGAAGAATTCCTACGCT
TTAAAGATCCTGGACCGATGTTCAACTTTTTCCGAAATCTACCCAAAAAG
AAATTCAACATTCAAAAGATTTGTTACATAGCTTTCAACACGATGAACCC
CTTTAGTCGTCGTAATGTGGAATCGAAAAGGAAATTCTACAGACCTATTC
TTCAAGCACAACTTGACGAGTTTGAAATTATGCGTGAGGAATACAAGGAG
AAACGGGAAGACAGTATTTCTATTCACGATGAAGAACCAATCAGTGACGA
CGAGAACTAAATGACTTCAAAAAAGGAAGTCCAAGATCCTTGGGAAATAC
TAGAGGTTCCAGCTGTGATAAATTTCTCTTCAAAATCCAATGAAGATGAG
GGAGAAGAGaatgatttttctcaaaacaacagcaaaacaaaaaaGGACAA
CAAAGAAAGGTTGTGTGGCTACTTGAATAAAATGGGAGcCGGTATCATCA
AAGGTTGGAAGAAAAGATGGTTTGTTTATGATCCACGTAGATGTCTACTT
TTCTATTATCGTAGACCCCAAGACACTGAACCATTAGGGACTATAGATAT
AGCAAGTGCCACATTTTCCTACAACCCAAATGTAAAGGCCTTGTTTTCAA
TAAGTTCTGGAGACAGATTGTATCAACTTGAGGCACCTGACAACAACGCC
ATGATGTTTTGGTTACAAGAACTGCAAGCCAAAAGAcgagaattttcaaa
acttgtAGAAGCAAATGCAGGCAATAATAGACCAACAAGTGGTTTGCTTT
CTGATCCGATAGATGCTCCACAAGGAGGTGATGATGAAGCTGATGGTTTC
AATAAAATAATTGAAAGACCTCACAATGTTGGTGAGAAGACTGCTCTCGA
TTCTAAAGGAAATTTTTCATTCACACACTTGaacaaagaattcaaaaatt
GGAGaaaatcaaccttttacacagaaactggggaggcaattttaaATGAG
AAATCAGCTGCTTCTACGCCAGAACAAGAAAAGAAAAGTCCTAACATGCA
AAGAAGAGAAGATGATACAAAAATTCTAGAAAGTGGAAACAAACGAAGaG
TCGATTTTGGTTTCTCAAAGATGGTAGCAAATCTGAGGAATACAAATATG
CCAGTGATTAGCTCCCCTcaaccaaacaacaacaacataaaTCAATGCCG
AGATTGTATGGAGaaattgaatatggTCAAAACTCTCCAAGAAGCAATTT
CAATGGCCGAAAAGGAAATTACTACACGAGATGAGGTTATTGAAAGTATA
AGCGAACAACTAAgaTTTGCATCAAGCTCCCCAACATTAGTGGAAAAAGC
ACCAGACATCGAAGAAGCGGAAGAGCGGGAACTCTATATACTCAAGctCA
GTCGAATGATAAAAAGCTTGAATGAAAAAGTTGACGAATTGACAACTACG
ATACGtgaaaatgaaCGAACTCTTGAAGAGTACGAGCAAAAGGAGAGAGT
CTTGAAAGAAATGATTCATGCTAAAGATAATTCAATCATCGCCTTGACGA
ACCAGGTATTTTCTTTGGAAGAGAAAGAAACAACAGACGTCGCTCAAGAT
GTATTGATAGCTTTTGAAGAGAAACCGTCAGAAATGACTGATAGCAATTC
ATCGCCTATTGAACTAGACTACGACCAACTAAAGGAGGCTTGTTCAGCTT
ACCAagctcaaaacaattttttgaacaGTGAAATATTGGAGTTACACAAA
CTACGTACATTGGATGCTGAAAAGATATTGAATGCAAATGATAACCTTGA
GATGAAAGAAGCGGAGGTGATCAAAATCAGAAGTCGATATTTATGGTTAC
TTAAAGATTGTGCTGGACCTAAACGAGaaacgAACATGGAGTCAGACGGA
GTGCTGGAGAAATTAATCGATGAAGCCATCAACGAAAAAGCTGACTCAAC
AACTGAAAAGAAAAGCCCTACTGAGATAAGGTTTGCAGACAAGTATGGAT
TTTATGATCAAATCGAGAAATCTGACGAGAACGCTTTAGAATCACTTGCT
GACCATTTCGAATcactcagtggggataaagagCTCGGTTCATTAGAAGT
TTCACACGGTGTGAAATGGGAAAATTATTTGGTAGCACAAGGTACCGCAC
CACTACAGAAAACGGAGGAACTCAAAGCACTCGTCCGAAGTGGTATCCCA
CACGAATTCCGTGCGCGCGTCTGGGGCGATCTCGTCCGCCTGCGTAGTGA
TCACGAGCGGACGATTGCTGGGCAAGGCTACTATGCTAACTTAttgaaag
agaagaaaggagcTTACTCCCCGTCTGCCAAACAGATTGAATTGGACTTG
TTGAGAACGTTACCGAACAACAAATATTATGATACGCTTGAATCTGAGGG
GatttcaaaactACGACGCATTTTGACAGCGTACAGTTGGCATAACCCAG
CTGTTGGATACTGTCAAGGATTAAATCGTTTGGGAGCCATCGCACTGTTG
TATTTAGATGAAGAAACAGCTTTCTGgTGTCTTGTAGCGATCACTGAACA
TCTAATGCCAATTGATTATTACAGCAGAACACTGCTCGGTGCGCAAATCG
ATCAAAAAGTATTTCGTGACTTGTTGGACGAAAAATGTCCGAAACTGAGT
GCTCATCTTGTCTCCTTGCAGTTCGACATATCGTTGGTATCATTCAATTG
GTTCCTGACTGTTTTTGTTGATCTCTTTCCGATTGAGTTGACGTTAAGAG
TGTGGGATACATTTCTCTTCGAAGGTAGCAAGGTTTTATTCCGGTACGCA
TTGTCCGTCTTCAAACTTTTCGAAGAAGAATTCCTACGCTTTAAAGATCC
TGGACCGATGTTCAACTTTTTCCGAAATCTACCCAAAAAGAAATTCAACA
TTCAAAAGATTTGTTACATAGCTTTCAACACGATGAACCCCTTTAGTCGT
CGTAATGTGGAATCGAAAAGGAAATTCTACAGACCTATTCTTCAAGCACA
ACTTGACGAGTTTGAAATTATGCGTGAGGAATACAAGGAGAAACGGGAAG
ACAGTATTTCTATTCACGATGAAGAACCAATCAGTGACGACGAGAACTAA
ATGACTTCAAAAAAGGAAGTCCAAGATCCTTGGGAAATACTAGAGGTTCC
AGCTGTGATAAATTTCTCTTCAAAATCCAATGAAGATGAGGGAGAAGAGa
atgatttttctcaaaacaacagcaaaacaaaaaaGGACAACAAAGAAAGG
TTGTGTGGCTACTTGAATAAAATGGGAGcCGGTATCATCAAAGGTTGGAA
GAAAAGATGGTTTGTTTATGATCCACGTAGATGTCTACTTTTCTATTATC
GTAGACCCCAAGACACTGAACCATTAGGGACTATAGATATAGCAAGTGCC
ACATTTTCCTACAACCCAAATGTAAAGGCCTTGTTTTCAATAAGTTCTGG
AGACAGATTGTATCAACTTGAGGCACCTGACAACAACGCCATGATGTTTT
GGTTACAAGAACTGCAAGCCAAAAGAcgagaattttcaaaacttgtAGAA
GCAAATGCAGGCAATAATAGACCAACAAGTGGTTTGCTTTCTGATCCGAT
AGATGCTCCACAAGGAGGTGATGATGAAGCTGATGGTTTCAATAAAATAA
TTGAAAGACCTCACAATGTTGGTGAGAAGACTGCTCTCGATTCTAAAGGA
AATTTTTCATTCACACACTTGaacaaagaattcaaaaattGGAGaaaatc
aaccttttacacagaaactggggaggcaattttaaATGAGAAATCAGCTG
CTTCTACGCCAGAACAAGAAAAGAAAAGTCCTAACATGCAAAGAAGAGAA
GATGATACAAAAATTCTAGAAAGTGGAAACAAACGAAGaGTCGATTTTGG
TTTCTCAAAGATGGTAGCAAATCTGAGGAATACAAATATGCCAGTGATTA
GCTCCCCTcaaccaaacaacaacaacataaaTCAATGCCGAGATTGTATG
GAGaaattgaatatggTCAAAACTCTCCAAGAAGCAATTTCAATGGCCGA
AAAGGAAATTACTACACGAGATGAGGTTATTGAAAGTATAAGCGAACAAC
TAAgaTTTGCATCAAGCTCCCCAACATTAGTGGAAAAAGCACCAGACATC
GAAGAAGCGGAAGAGCGGGAACTCTATATACTCAAGctCAGTCGAATGAT
AAAAAGCTTGAATGAAAAAGTTGACGAATTGACAACTACGATACGtgaaa
atgaaCGAACTCTTGAAGAGTACGAGCAAAAGGAGAGAGTCTTGAAAGAA
ATGATTCATGCTAAAGATAATTCAATCATCGCCTTGACGAACCAGGTATT
TTCTTTGGAAGAGAAAGAAACAACAGACGTCGCTCAAGATGTATTGATAG
CTTTTGAAGAGAAACCGTCAGAAATGACTGATAGCAATTCATCGCCTATT
GAACTAGACTACGACCAACTAAAGGAGGCTTGTTCAGCTTACCAagctca
aaacaattttttgaacaGTGAAATATTGGAGTTACACAAACTACGTACAT
TGGATGCTGAAAAGATATTGAATGCAAATGATAACCTTGAGATGAAAGAA
GCGGAGGTGATCAAAATCAGAAGTCGATATTTATGGTTACTTAAAGATTG
TGCTGGACCTAAACGAGaaacgAACATGGAGTCAGACGGAGTGCTGGAGA
AATTAATCGATGAAGCCATCAACGAAAAAGCTGACTCAACAACTGAAAAG
AAAAGCCCTACTGAGATAAGGTTTGCAGACAAGTATGGATTTTATGATCA
AATCGAGAAATCTGACGAGAACGCTTTAGAATCACTTGCTGACCATTTCG
AATcactcagtggggataaagagCTCGGTTCATTAGAAGTTTCACACGGT
GTGAAATGGGAAAATTATTTGGTAGCACAAGGTACCGCACCACTACAGAA
AACGGAGGAACTCAAAGCACTCGTCCGAAGTGGTATCCCACACGAATTCC
GTGCGCGCGTCTGGGGCGATCTCGTCCGCCTGCGTAGTGATCACGAGCGG
ACGATTGCTGGGCAAGGCTACTATGCTAACTTAttgaaagagaagaaagg
agcTTACTCCCCGTCTGCCAAACAGATTGAATTGGACTTGTTGAGAACGT
TACCGAACAACAAATATTATGATACGCTTGAATCTGAGGGGatttcaaaa
ctACGACGCATTTTGACAGCGTACAGTTGGCATAACCCAGCTGTTGGATA
CTGTCAAGGATTAAATCGTTTGGGAGCCATCGCACTGTTGTATTTAGATG
AAGAAACAGCTTTCTGgTGTCTTGTAGCGATCACTGAACATCTAATGCCA
ATTGATTATTACAGCAGAACACTGCTCGGTGCGCAAATCGATCAAAAAGT
ATTTCGTGACTTGTTGGACGAAAAATGTCCGAAACTGAGTGCTCATCTTG
TCTCCTTGCAGTTCGACATATCGTTGGTATCATTCAATTGGTTCCTGACT
GTTTTTGTTGATCTCTTTCCGATTGAGTTGACGTTAAGAGTGTGGGATAC
ATTTCTCTTCGAAGGTAGCAAGGTTTTATTCCGGTACGCATTGTCCGTCT
TCAAACTTTTCGAAGAAGAATTCCTACGCTTTAAAGATCCTGGACCGATG
TTCAACTTTTTCCGAAATCTACCCAAAAAGAAATTCAACATTCAAAAGAT
TTGTTACATAGCTTTCAACACGATGAACCCCTTTAGTCGTCGTAATGTGG
AATCGAAAAGGAAATTCTACAGACCTATTCTTCAAGCACAACTTGACGAG
TTTGAAATTATGCGTGAGGAATACAAGGAGAAACGGGAAGACAGTATTTC
TATTCACGATGAAGAACCAATCAGTGACGACGAGAACTAAATGACTTCAA
AAAAGGAAGTCCAAGATCCTTGGGAAATACTAGAGGTTCCAGCTGTGATA
AATTTCTCTTCAAAATCCAATGAAGATGAGGGAGAAGAGaatgatttttc
tcaaaacaacagcaaaacaaaaaaGGACAACAAAGAAAGGTTGTGTGGCT
ACTTGAATAAAATGGGAGcCGGTATCATCAAAGGTTGGAAGAAAAGATGG
TTTGTTTATGATCCACGTAGATGTCTACTTTTCTATTATCGTAGACCCCA
AGACACTGAACCATTAGGGACTATAGATATAGCAAGTGCCACATTTTCCT
ACAACCCAAATGTAAAGGCCTTGTTTTCAATAAGTTCTGGAGACAGATTG
TATCAACTTGAGGCACCTGACAACAACGCCATGATGTTTTGGTTACAAGA
ACTGCAAGCCAAAAGAcgagaattttcaaaacttgtAGAAGCAAATGCAG
GCAATAATAGACCAACAAGTGGTTTGCTTTCTGATCCGATAGATGCTCCA
CAAGGAGGTGATGATGAAGCTGATGGTTTCAATAAAATAATTGAAAGACC
TCACAATGTTGGTGAGAAGACTGCTCTCGATTCTAAAGGAAATTTTTCAT
TCACACACTTGaacaaagaattcaaaaattGGAGaaaatcaaccttttac
acagaaactggggaggcaattttaaATGAGAAATCAGCTGCTTCTACGCC
AGAACAAGAAAAGAAAAGTCCTAACATGCAAAGAAGAGAAGATGATACAA
AAATTCTAGAAAGTGGAAACAAACGAAGaGTCGATTTTGGTTTCTCAAAG
ATGGTAGCAAATCTGAGGAATACAAATATGCCAGTGATTAGCTCCCCTca
accaaacaacaacaacataaaTCAATGCCGAGATTGTATGGAGaaattga
atatggTCAAAACTCTCCAAGAAGCAATTTCAATGGCCGAAAAGGAAATT
ACTACACGAGATGAGGTTATTGAAAGTATAAGCGAACAACTAAgaTTTGC
ATCAAGCTCCCCAACATTAGTGGAAAAAGCACCAGACATCGAAGAAGCGG
AAGAGCGGGAACTCTATATACTCAAGctCAGTCGAATGATAAAAAGCTTG
AATGAAAAAGTTGACGAATTGACAACTACGATACGtgaaaatgaaCGAAC
TCTTGAAGAGTACGAGCAAAAGGAGAGAGTCTTGAAAGAAATGATTCATG
CTAAAGATAATTCAATCATCGCCTTGACGAACCAGGTATTTTCTTTGGAA
GAGAAAGAAACAACAGACGTCGCTCAAGATGTATTGATAGCTTTTGAAGA
GAAACCGTCAGAAATGACTGATAGCAATTCATCGCCTATTGAACTAGACT
ACGACCAACTAAAGGAGGCTTGTTCAGCTTACCAagctcaaaacaatttt
ttgaacaGTGAAATATTGGAGTTACACAAACTACGTACATTGGATGCTGA
AAAGATATTGAATGCAAATGATAACCTTGAGATGAAAGAAGCGGAGGTGA
TCAAAATCAGAAGTCGATATTTATGGTTACTTAAAGATTGTGCTGGACCT
AAACGAGaaacgAACATGGAGTCAGACGGAGTGCTGGAGAAATTAATCGA
TGAAGCCATCAACGAAAAAGCTGACTCAACAACTGAAAAGAAAAGCCCTA
CTGAGATAAGGTTTGCAGACAAGTATGGATTTTATGATCAAATCGAGAAA
TCTGACGAGAACGCTTTAGAATCACTTGCTGACCATTTCGAATcactcag
tggggataaagagCTCGGTTCATTAGAAGTTTCACACGGTGTGAAATGGG
AAAATTATTTGGTAGCACAAGGTACCGCACCACTACAGAAAACGGAGGAA
CTCAAAGCACTCGTCCGAAGTGGTATCCCACACGAATTCCGTGCGCGCGT
CTGGGGCGATCTCGTCCGCCTGCGTAGTGATCACGAGCGGACGATTGCTG
GGCAAGGCTACTATGCTAACTTAttgaaagagaagaaaggagcTTACTCC
CCGTCTGCCAAACAGATTGAATTGGACTTGTTGAGAACGTTACCGAACAA
CAAATATTATGATACGCTTGAATCTGAGGGGatttcaaaactACGACGCA
TTTTGACAGCGTACAGTTGGCATAACCCAGCTGTTGGATACTGTCAAGGA
TTAAATCGTTTGGGAGCCATCGCACTGTTGTATTTAGATGAAGAAACAGC
TTTCTGgTGTCTTGTAGCGATCACTGAACATCTAATGCCAATTGATTATT
ACAGCAGAACACTGCTCGGTGCGCAAATCGATCAAAAAGTATTTCGTGAC
TTGTTGGACGAAAAATGTCCGAAACTGAGTGCTCATCTTGTCTCCTTGCA
GTTCGACATATCGTTGGTATCATTCAATTGGTTCCTGACTGTTTTTGTTG
ATCTCTTTCCGATTGAGTTGACGTTAAGAGTGTGGGATACATTTCTCTTC
GAAGGTAGCAAGGTTTTATTCCGGTACGCATTGTCCGTCTTCAAACTTTT
CGAAGAAGAATTCCTACGCTTTAAAGATCCTGGACCGATGTTCAACTTTT
TCCGAAATCTACCCAAAAAGAAATTCAACATTCAAAAGATTTGTTACATA
GCTTTCAACACGATGAACCCCTTTAGTCGTCGTAATGTGGAATCGAAAAG
GAAATTCTACAGACCTATTCTTCAAGCACAACTTGACGAGTTTGAAATTA
TGCGTGAGGAATACAAGGAGAAACGGGAAGACAGTATTTCTATTCACGAT
GAAGAACCAATCAGTGACGACGAGAACTAAATGACTTCAAAAAAGGAAGT
CCAAGATCCTTGGGAAATACTAGAGGTTCCAGCTGTGATAAATTTCTCTT
CAAAATCCAATGAAGATGAGGGAGAAGAGaatgatttttctcaaaacaac
agcaaaacaaaaaaGGACAACAAAGAAAGGTTGTGTGGCTACTTGAATAA
AATGGGAGcCGGTATCATCAAAGGTTGGAAGAAAAGATGGTTTGTTTATG
ATCCACGTAGATGTCTACTTTTCTATTATCGTAGACCCCAAGACACTGAA
CCATTAGGGACTATAGATATAGCAAGTGCCACATTTTCCTACAACCCAAA
TGTAAAGGCCTTGTTTTCAATAAGTTCTGGAGACAGATTGTATCAACTTG
AGGCACCTGACAACAACGCCATGATGTTTTGGTTACAAGAACTGCAAGCC
AAAAGAcgagaattttcaaaacttgtAGAAGCAAATGCAGGCAATAATAG
ACCAACAAGTGGTTTGCTTTCTGATCCGATAGATGCTCCACAAGGAGGTG
ATGATGAAGCTGATGGTTTCAATAAAATAATTGAAAGACCTCACAATGTT
GGTGAGAAGACTGCTCTCGATTCTAAAGGAAATTTTTCATTCACACACTT
GaacaaagaattcaaaaattGGAGaaaatcaaccttttacacagaaactg
gggaggcaattttaaATGAGAAATCAGCTGCTTCTACGCCAGAACAAGAA
AAGAAAAGTCCTAACATGCAAAGAAGAGAAGATGATACAAAAATTCTAGA
AAGTGGAAACAAACGAAGaGTCGATTTTGGTTTCTCAAAGATGGTAGCAA
ATCTGAGGAATACAAATATGCCAGTGATTAGCTCCCCTcaaccaaacaac
aacaacataaaTCAATGCCGAGATTGTATGGAGaaattgaatatggTCAA
AACTCTCCAAGAAGCAATTTCAATGGCCGAAAAGGAAATTACTACACGAG
ATGAGGTTATTGAAAGTATAAGCGAACAACTAAgaTTTGCATCAAGCTCC
CCAACATTAGTGGAAAAAGCACCAGACATCGAAGAAGCGGAAGAGCGGGA
ACTCTATATACTCAAGctCAGTCGAATGATAAAAAGCTTGAATGAAAAAG
TTGACGAATTGACAACTACGATACGtgaaaatgaaCGAACTCTTGAAGAG
TACGAGCAAAAGGAGAGAGTCTTGAAAGAAATGATTCATGCTAAAGATAA
TTCAATCATCGCCTTGACGAACCAGGTATTTTCTTTGGAAGAGAAAGAAA
CAACAGACGTCGCTCAAGATGTATTGATAGCTTTTGAAGAGAAACCGTCA
GAAATGACTGATAGCAATTCATCGCCTATTGAACTAGACTACGACCAACT
AAAGGAGGCTTGTTCAGCTTACCAagctcaaaacaattttttgaacaGTG
AAATATTGGAGTTACACAAACTACGTACATTGGATGCTGAAAAGATATTG
AATGCAAATGATAACCTTGAGATGAAAGAAGCGGAGGTGATCAAAATCAG
AAGTCGATATTTATGGTTACTTAAAGATTGTGCTGGACCTAAACGAGaaa
cgAACATGGAGTCAGACGGAGTGCTGGAGAAATTAATCGATGAAGCCATC
AACGAAAAAGCTGACTCAACAACTGAAAAGAAAAGCCCTACTGAGATAAG
GTTTGCAGACAAGTATGGATTTTATGATCAAATCGAGAAATCTGACGAGA
ACGCTTTAGAATCACTTGCTGACCATTTCGAATcactcagtggggataaa
gagCTCGGTTCATTAGAAGTTTCACACGGTGTGAAATGGGAAAATTATTT
GGTAGCACAAGGTACCGCACCACTACAGAAAACGGAGGAACTCAAAGCAC
TCGTCCGAAGTGGTATCCCACACGAATTCCGTGCGCGCGTCTGGGGCGAT
CTCGTCCGCCTGCGTAGTGATCACGAGCGGACGATTGCTGGGCAAGGCTA
CTATGCTAACTTAttgaaagagaagaaaggagcTTACTCCCCGTCTGCCA
AACAGATTGAATTGGACTTGTTGAGAACGTTACCGAACAACAAATATTAT
GATACGCTTGAATCTGAGGGGatttcaaaactACGACGCATTTTGACAGC
GTACAGTTGGCATAACCCAGCTGTTGGATACTGTCAAGGATTAAATCGTT
TGGGAGCCATCGCACTGTTGTATTTAGATGAAGAAACAGCTTTCTGgTGT
CTTGTAGCGATCACTGAACATCTAATGCCAATTGATTATTACAGCAGAAC
ACTGCTCGGTGCGCAAATCGATCAAAAAGTATTTCGTGACTTGTTGGACG
AAAAATGTCCGAAACTGAGTGCTCATCTTGTCTCCTTGCAGTTCGACATA
TCGTTGGTATCATTCAATTGGTTCCTGACTGTTTTTGTTGATCTCTTTCC
GATTGAGTTGACGTTAAGAGTGTGGGATACATTTCTCTTCGAAGGTAGCA
AGGTTTTATTCCGGTACGCATTGTCCGTCTTCAAACTTTTCGAAGAAGAA
TTCCTACGCTTTAAAGATCCTGGACCGATGTTCAACTTTTTCCGAAATCT
ACCCAAAAAGAAATTCAACATTCAAAAGATTTGTTACATAGCTTTCAACA
CGATGAACCCCTTTAGTCGTCGTAATGTGGAATCGAAAAGGAAATTCTAC
AGACCTATTCTTCAAGCACAACTTGACGAGTTTGAAATTATGCGTGAGGA
ATACAAGGAGAAACGGGAAGACAGTATTTCTATTCACGATGAAGAACCAA
TCAGTGACGACGAGAACTAAATGACTTCAAAAAAGGAAGTCCAAGATCCT
TGGGAAATACTAGAGGTTCCAGCTGTGATAAATTTCTCTTCAAAATCCAA
TGAAGATGAGGGAGAAGAGaatgatttttctcaaaacaacagcaaaacaa
aaaaGGACAACAAAGAAAGGTTGTGTGGCTACTTGAATAAAATGGGAGcC
GGTATCATCAAAGGTTGGAAGAAAAGATGGTTTGTTTATGATCCACGTAG
ATGTCTACTTTTCTATTATCGTAGACCCCAAGACACTGAACCATTAGGGA
CTATAGATATAGCAAGTGCCACATTTTCCTACAACCCAAATGTAAAGGCC
TTGTTTTCAATAAGTTCTGGAGACAGATTGTATCAACTTGAGGCACCTGA
CAACAACGCCATGATGTTTTGGTTACAAGAACTGCAAGCCAAAAGAcgag
aattttcaaaacttgtAGAAGCAAATGCAGGCAATAATAGACCAACAAGT
GGTTTGCTTTCTGATCCGATAGATGCTCCACAAGGAGGTGATGATGAAGC
TGATGGTTTCAATAAAATAATTGAAAGACCTCACAATGTTGGTGAGAAGA
CTGCTCTCGATTCTAAAGGAAATTTTTCATTCACACACTTGaacaaagaa
ttcaaaaattGGAGaaaatcaaccttttacacagaaactggggaggcaat
tttaaATGAGAAATCAGCTGCTTCTACGCCAGAACAAGAAAAGAAAAGTC
CTAACATGCAAAGAAGAGAAGATGATACAAAAATTCTAGAAAGTGGAAAC
AAACGAAGaGTCGATTTTGGTTTCTCAAAGATGGTAGCAAATCTGAGGAA
TACAAATATGCCAGTGATTAGCTCCCCTcaaccaaacaacaacaacataa
aTCAATGCCGAGATTGTATGGAGaaattgaatatggTCAAAACTCTCCAA
GAAGCAATTTCAATGGCCGAAAAGGAAATTACTACACGAGATGAGGTTAT
TGAAAGTATAAGCGAACAACTAAgaTTTGCATCAAGCTCCCCAACATTAG
TGGAAAAAGCACCAGACATCGAAGAAGCGGAAGAGCGGGAACTCTATATA
CTCAAGctCAGTCGAATGATAAAAAGCTTGAATGAAAAAGTTGACGAATT
GACAACTACGATACGtgaaaatgaaCGAACTCTTGAAGAGTACGAGCAAA
AGGAGAGAGTCTTGAAAGAAATGATTCATGCTAAAGATAATTCAATCATC
GCCTTGACGAACCAGGTATTTTCTTTGGAAGAGAAAGAAACAACAGACGT
CGCTCAAGATGTATTGATAGCTTTTGAAGAGAAACCGTCAGAAATGACTG
ATAGCAATTCATCGCCTATTGAACTAGACTACGACCAACTAAAGGAGGCT
TGTTCAGCTTACCAagctcaaaacaattttttgaacaGTGAAATATTGGA
GTTACACAAACTACGTACATTGGATGCTGAAAAGATATTGAATGCAAATG
ATAACCTTGAGATGAAAGAAGCGGAGGTGATCAAAATCAGAAGTCGATAT
TTATGGTTACTTAAAGATTGTGCTGGACCTAAACGAGaaacgAACATGGA
GTCAGACGGAGTGCTGGAGAAATTAATCGATGAAGCCATCAACGAAAAAG
CTGACTCAACAACTGAAAAGAAAAGCCCTACTGAGATAAGGTTTGCAGAC
AAGTATGGATTTTATGATCAAATCGAGAAATCTGACGAGAACGCTTTAGA
ATCACTTGCTGACCATTTCGAATcactcagtggggataaagagCTCGGTT
CATTAGAAGTTTCACACGGTGTGAAATGGGAAAATTATTTGGTAGCACAA
GGTACCGCACCACTACAGAAAACGGAGGAACTCAAAGCACTCGTCCGAAG
TGGTATCCCACACGAATTCCGTGCGCGCGTCTGGGGCGATCTCGTCCGCC
TGCGTAGTGATCACGAGCGGACGATTGCTGGGCAAGGCTACTATGCTAAC
TTAttgaaagagaagaaaggagcTTACTCCCCGTCTGCCAAACAGATTGA
ATTGGACTTGTTGAGAACGTTACCGAACAACAAATATTATGATACGCTTG
AATCTGAGGGGatttcaaaactACGACGCATTTTGACAGCGTACAGTTGG
CATAACCCAGCTGTTGGATACTGTCAAGGATTAAATCGTTTGGGAGCCAT
CGCACTGTTGTATTTAGATGAAGAAACAGCTTTCTGgTGTCTTGTAGCGA
TCACTGAACATCTAATGCCAATTGATTATTACAGCAGAACACTGCTCGGT
GCGCAAATCGATCAAAAAGTATTTCGTGACTTGTTGGACGAAAAATGTCC
GAAACTGAGTGCTCATCTTGTCTCCTTGCAGTTCGACATATCGTTGGTAT
CATTCAATTGGTTCCTGACTGTTTTTGTTGATCTCTTTCCGATTGAGTTG
ACGTTAAGAGTGTGGGATACATTTCTCTTCGAAGGTAGCAAGGTTTTATT
CCGGTACGCATTGTCCGTCTTCAAACTTTTCGAAGAAGAATTCCTACGCT
TTAAAGATCCTGGACCGATGTTCAACTTTTTCCGAAATCTACCCAAAAAG
AAATTCAACATTCAAAAGATTTGTTACATAGCTTTCAACACGATGAACCC
CTTTAGTCGTCGTAATGTGGAATCGAAAAGGAAATTCTACAGACCTATTC
TTCAAGCACAACTTGACGAGTTTGAAATTATGCGTGAGGAATACAAGGAG
AAACGGGAAGACAGTATTTCTATTCACGATGAAGAACCAATCAGTGACGA
CGAGAACTAAATGACTTCAAAAAAGGAAGTCCAAGATCCTTGGGAAATAC
TAGAGGTTCCAGCTGTGATAAATTTCTCTTCAAAATCCAATGAAGATGAG
GGAGAAGAGaatgatttttctcaaaacaacagcaaaacaaaaaaGGACAA
CAAAGAAAGGTTGTGTGGCTACTTGAATAAAATGGGAGcCGGTATCATCA
AAGGTTGGAAGAAAAGATGGTTTGTTTATGATCCACGTAGATGTCTACTT
TTCTATTATCGTAGACCCCAAGACACTGAACCATTAGGGACTATAGATAT
AGCAAGTGCCACATTTTCCTACAACCCAAATGTAAAGGCCTTGTTTTCAA
TAAGTTCTGGAGACAGATTGTATCAACTTGAGGCACCTGACAACAACGCC
ATGATGTTTTGGTTACAAGAACTGCAAGCCAAAAGAcgagaattttcaaa
acttgtAGAAGCAAATGCAGGCAATAATAGACCAACAAGTGGTTTGCTTT
CTGATCCGATAGATGCTCCACAAGGAGGTGATGATGAAGCTGATGGTTTC
AATAAAATAATTGAAAGACCTCACAATGTTGGTGAGAAGACTGCTCTCGA
TTCTAAAGGAAATTTTTCATTCACACACTTGaacaaagaattcaaaaatt
GGAGaaaatcaaccttttacacagaaactggggaggcaattttaaATGAG
AAATCAGCTGCTTCTACGCCAGAACAAGAAAAGAAAAGTCCTAACATGCA
AAGAAGAGAAGATGATACAAAAATTCTAGAAAGTGGAAACAAACGAAGaG
TCGATTTTGGTTTCTCAAAGATGGTAGCAAATCTGAGGAATACAAATATG
CCAGTGATTAGCTCCCCTcaaccaaacaacaacaacataaaTCAATGCCG
AGATTGTATGGAGaaattgaatatggTCAAAACTCTCCAAGAAGCAATTT
CAATGGCCGAAAAGGAAATTACTACACGAGATGAGGTTATTGAAAGTATA
AGCGAACAACTAAgaTTTGCATCAAGCTCCCCAACATTAGTGGAAAAAGC
ACCAGACATCGAAGAAGCGGAAGAGCGGGAACTCTATATACTCAAGctCA
GTCGAATGATAAAAAGCTTGAATGAAAAAGTTGACGAATTGACAACTACG
ATACGtgaaaatgaaCGAACTCTTGAAGAGTACGAGCAAAAGGAGAGAGT
CTTGAAAGAAATGATTCATGCTAAAGATAATTCAATCATCGCCTTGACGA
ACCAGGTATTTTCTTTGGAAGAGAAAGAAACAACAGACGTCGCTCAAGAT
GTATTGATAGCTTTTGAAGAGAAACCGTCAGAAATGACTGATAGCAATTC
ATCGCCTATTGAACTAGACTACGACCAACTAAAGGAGGCTTGTTCAGCTT
ACCAagctcaaaacaattttttgaacaGTGAAATATTGGAGTTACACAAA
CTACGTACATTGGATGCTGAAAAGATATTGAATGCAAATGATAACCTTGA
GATGAAAGAAGCGGAGGTGATCAAAATCAGAAGTCGATATTTATGGTTAC
TTAAAGATTGTGCTGGACCTAAACGAGaaacgAACATGGAGTCAGACGGA
GTGCTGGAGAAATTAATCGATGAAGCCATCAACGAAAAAGCTGACTCAAC
AACTGAAAAGAAAAGCCCTACTGAGATAAGGTTTGCAGACAAGTATGGAT
TTTATGATCAAATCGAGAAATCTGACGAGAACGCTTTAGAATCACTTGCT
GACCATTTCGAATcactcagtggggataaagagCTCGGTTCATTAGAAGT
TTCACACGGTGTGAAATGGGAAAATTATTTGGTAGCACAAGGTACCGCAC
CACTACAGAAAACGGAGGAACTCAAAGCACTCGTCCGAAGTGGTATCCCA
CACGAATTCCGTGCGCGCGTCTGGGGCGATCTCGTCCGCCTGCGTAGTGA
TCACGAGCGGACGATTGCTGGGCAAGGCTACTATGCTAACTTAttgaaag
agaagaaaggagcTTACTCCCCGTCTGCCAAACAGATTGAATTGGACTTG
TTGAGAACGTTACCGAACAACAAATATTATGATACGCTTGAATCTGAGGG
GatttcaaaactACGACGCATTTTGACAGCGTACAGTTGGCATAACCCAG
CTGTTGGATACTGTCAAGGATTAAATCGTTTGGGAGCCATCGCACTGTTG
TATTTAGATGAAGAAACAGCTTTCTGgTGTCTTGTAGCGATCACTGAACA
TCTAATGCCAATTGATTATTACAGCAGAACACTGCTCGGTGCGCAAATCG
ATCAAAAAGTATTTCGTGACTTGTTGGACGAAAAATGTCCGAAACTGAGT
GCTCATCTTGTCTCCTTGCAGTTCGACATATCGTTGGTATCATTCAATTG
GTTCCTGACTGTTTTTGTTGATCTCTTTCCGATTGAGTTGACGTTAAGAG
TGTGGGATACATTTCTCTTCGAAGGTAGCAAGGTTTTATTCCGGTACGCA
TTGTCCGTCTTCAAACTTTTCGAAGAAGAATTCCTACGCTTTAAAGATCC
TGGACCGATGTTCAACTTTTTCCGAAATCTACCCAAAAAGAAATTCAACA
TTCAAAAGATTTGTTACATAGCTTTCAACACGATGAACCCCTTTAGTCGT
CGTAATGTGGAATCGAAAAGGAAATTCTACAGACCTATTCTTCAAGCACA
ACTTGACGAGTTTGAAATTATGCGTGAGGAATACAAGGAGAAACGGGAAG
ACAGTATTTCTATTCACGATGAAGAACCAATCAGTGACGACGAGAACTAA
ATGACTTCAAAAAAGGAAGTCCAAGATCCTTGGGAAATACTAGAGGTTCC
AGCTGTGATAAATTTCTCTTCAAAATCCAATGAAGATGAGGGAGAAGAGa
atgatttttctcaaaacaacagcaaaacaaaaaaGGACAACAAAGAAAGG
TTGTGTGGCTACTTGAATAAAATGGGAGcCGGTATCATCAAAGGTTGGAA
GAAAAGATGGTTTGTTTATGATCCACGTAGATGTCTACTTTTCTATTATC
GTAGACCCCAAGACACTGAACCATTAGGGACTATAGATATAGCAAGTGCC
ACATTTTCCTACAACCCAAATGTAAAGGCCTTGTTTTCAATAAGTTCTGG
AGACAGATTGTATCAACTTGAGGCACCTGACAACAACGCCATGATGTTTT
GGTTACAAGAACTGCAAGCCAAAAGAcgagaattttcaaaacttgtAGAA
GCAAATGCAGGCAATAATAGACCAACAAGTGGTTTGCTTTCTGATCCGAT
AGATGCTCCACAAGGAGGTGATGATGAAGCTGATGGTTTCAATAAAATAA
TTGAAAGACCTCACAATGTTGGTGAGAAGACTGCTCTCGATTCTAAAGGA
AATTTTTCATTCACACACTTGaacaaagaattcaaaaattGGAGaaaatc
aaccttttacacagaaactggggaggcaattttaaATGAGAAATCAGCTG
CTTCTACGCCAGAACAAGAAAAGAAAAGTCCTAACATGCAAAGAAGAGAA
GATGATACAAAAATTCTAGAAAGTGGAAACAAACGAAGaGTCGATTTTGG
TTTCTCAAAGATGGTAGCAAATCTGAGGAATACAAATATGCCAGTGATTA
GCTCCCCTcaaccaaacaacaacaacataaaTCAATGCCGAGATTGTATG
GAGaaattgaatatggTCAAAACTCTCCAAGAAGCAATTTCAATGGCCGA
AAAGGAAATTACTACACGAGATGAGGTTATTGAAAGTATAAGCGAACAAC
TAAgaTTTGCATCAAGCTCCCCAACATTAGTGGAAAAAGCACCAGACATC
GAAGAAGCGGAAGAGCGGGAACTCTATATACTCAAGctCAGTCGAATGAT
AAAAAGCTTGAATGAAAAAGTTGACGAATTGACAACTACGATACGtgaaa
atgaaCGAACTCTTGAAGAGTACGAGCAAAAGGAGAGAGTCTTGAAAGAA
ATGATTCATGCTAAAGATAATTCAATCATCGCCTTGACGAACCAGGTATT
TTCTTTGGAAGAGAAAGAAACAACAGACGTCGCTCAAGATGTATTGATAG
CTTTTGAAGAGAAACCGTCAGAAATGACTGATAGCAATTCATCGCCTATT
GAACTAGACTACGACCAACTAAAGGAGGCTTGTTCAGCTTACCAagctca
aaacaattttttgaacaGTGAAATATTGGAGTTACACAAACTACGTACAT
TGGATGCTGAAAAGATATTGAATGCAAATGATAACCTTGAGATGAAAGAA
GCGGAGGTGATCAAAATCAGAAGTCGATATTTATGGTTACTTAAAGATTG
TGCTGGACCTAAACGAGaaacgAACATGGAGTCAGACGGAGTGCTGGAGA
AATTAATCGATGAAGCCATCAACGAAAAAGCTGACTCAACAACTGAAAAG
AAAAGCCCTACTGAGATAAGGTTTGCAGACAAGTATGGATTTTATGATCA
AATCGAGAAATCTGACGAGAACGCTTTAGAATCACTTGCTGACCATTTCG
AATcactcagtggggataaagagCTCGGTTCATTAGAAGTTTCACACGGT
GTGAAATGGGAAAATTATTTGGTAGCACAAGGTACCGCACCACTACAGAA
AACGGAGGAACTCAAAGCACTCGTCCGAAGTGGTATCCCACACGAATTCC
GTGCGCGCGTCTGGGGCGATCTCGTCCGCCTGCGTAGTGATCACGAGCGG
ACGATTGCTGGGCAAGGCTACTATGCTAACTTAttgaaagagaagaaagg
agcTTACTCCCCGTCTGCCAAACAGATTGAATTGGACTTGTTGAGAACGT
TACCGAACAACAAATATTATGATACGCTTGAATCTGAGGGGatttcaaaa
ctACGACGCATTTTGACAGCGTACAGTTGGCATAACCCAGCTGTTGGATA
CTGTCAAGGATTAAATCGTTTGGGAGCCATCGCACTGTTGTATTTAGATG
AAGAAACAGCTTTCTGgTGTCTTGTAGCGATCACTGAACATCTAATGCCA
ATTGATTATTACAGCAGAACACTGCTCGGTGCGCAAATCGATCAAAAAGT
ATTTCGTGACTTGTTGGACGAAAAATGTCCGAAACTGAGTGCTCATCTTG
TCTCCTTGCAGTTCGACATATCGTTGGTATCATTCAATTGGTTCCTGACT
GTTTTTGTTGATCTCTTTCCGATTGAGTTGACGTTAAGAGTGTGGGATAC
ATTTCTCTTCGAAGGTAGCAAGGTTTTATTCCGGTACGCATTGTCCGTCT
TCAAACTTTTCGAAGAAGAATTCCTACGCTTTAAAGATCCTGGACCGATG
TTCAACTTTTTCCGAAATCTACCCAAAAAGAAATTCAACATTCAAAAGAT
TTGTTACATAGCTTTCAACACGATGAACCCCTTTAGTCGTCGTAATGTGG
AATCGAAAAGGAAATTCTACAGACCTATTCTTCAAGCACAACTTGACGAG
TTTGAAATTATGCGTGAGGAATACAAGGAGAAACGGGAAGACAGTATTTC
TATTCACGATGAAGAACCAATCAGTGACGACGAGAACTAAATGACTTCAA
AAAAGGAAGTCCAAGATCCTTGGGAAATACTAGAGGTTCCAGCTGTGATA
AATTTCTCTTCAAAATCCAATGAAGATGAGGGAGAAGAGaatgatttttc
tcaaaacaacagcaaaacaaaaaaGGACAACAAAGAAAGGTTGTGTGGCT
ACTTGAATAAAATGGGAGcCGGTATCATCAAAGGTTGGAAGAAAAGATGG
TTTGTTTATGATCCACGTAGATGTCTACTTTTCTATTATCGTAGACCCCA
AGACACTGAACCATTAGGGACTATAGATATAGCAAGTGCCACATTTTCCT
ACAACCCAAATGTAAAGGCCTTGTTTTCAATAAGTTCTGGAGACAGATTG
TATCAACTTGAGGCACCTGACAACAACGCCATGATGTTTTGGTTACAAGA
ACTGCAAGCCAAAAGAcgagaattttcaaaacttgtAGAAGCAAATGCAG
GCAATAATAGACCAACAAGTGGTTTGCTTTCTGATCCGATAGATGCTCCA
CAAGGAGGTGATGATGAAGCTGATGGTTTCAATAAAATAATTGAAAGACC
TCACAATGTTGGTGAGAAGACTGCTCTCGATTCTAAAGGAAATTTTTCAT
TCACACACTTGaacaaagaattcaaaaattGGAGaaaatcaaccttttac
acagaaactggggaggcaattttaaATGAGAAATCAGCTGCTTCTACGCC
AGAACAAGAAAAGAAAAGTCCTAACATGCAAAGAAGAGAAGATGATACAA
AAATTCTAGAAAGTGGAAACAAACGAAGaGTCGATTTTGGTTTCTCAAAG
ATGGTAGCAAATCTGAGGAATACAAATATGCCAGTGATTAGCTCCCCTca
accaaacaacaacaacataaaTCAATGCCGAGATTGTATGGAGaaattga
atatggTCAAAACTCTCCAAGAAGCAATTTCAATGGCCGAAAAGGAAATT
ACTACACGAGATGAGGTTATTGAAAGTATAAGCGAACAACTAAgaTTTGC
ATCAAGCTCCCCAACATTAGTGGAAAAAGCACCAGACATCGAAGAAGCGG
AAGAGCGGGAACTCTATATACTCAAGctCAGTCGAATGATAAAAAGCTTG
AATGAAAAAGTTGACGAATTGACAACTACGATACGtgaaaatgaaCGAAC
TCTTGAAGAGTACGAGCAAAAGGAGAGAGTCTTGAAAGAAATGATTCATG
CTAAAGATAATTCAATCATCGCCTTGACGAACCAGGTATTTTCTTTGGAA
GAGAAAGAAACAACAGACGTCGCTCAAGATGTATTGATAGCTTTTGAAGA
GAAACCGTCAGAAATGACTGATAGCAATTCATCGCCTATTGAACTAGACT
ACGACCAACTAAAGGAGGCTTGTTCAGCTTACCAagctcaaaacaatttt
ttgaacaGTGAAATATTGGAGTTACACAAACTACGTACATTGGATGCTGA
AAAGATATTGAATGCAAATGATAACCTTGAGATGAAAGAAGCGGAGGTGA
TCAAAATCAGAAGTCGATATTTATGGTTACTTAAAGATTGTGCTGGACCT
AAACGAGaaacgAACATGGAGTCAGACGGAGTGCTGGAGAAATTAATCGA
TGAAGCCATCAACGAAAAAGCTGACTCAACAACTGAAAAGAAAAGCCCTA
CTGAGATAAGGTTTGCAGACAAGTATGGATTTTATGATCAAATCGAGAAA
TCTGACGAGAACGCTTTAGAATCACTTGCTGACCATTTCGAATcactcag
tggggataaagagCTCGGTTCATTAGAAGTTTCACACGGTGTGAAATGGG
AAAATTATTTGGTAGCACAAGGTACCGCACCACTACAGAAAACGGAGGAA
CTCAAAGCACTCGTCCGAAGTGGTATCCCACACGAATTCCGTGCGCGCGT
CTGGGGCGATCTCGTCCGCCTGCGTAGTGATCACGAGCGGACGATTGCTG
GGCAAGGCTACTATGCTAACTTAttgaaagagaagaaaggagcTTACTCC
CCGTCTGCCAAACAGATTGAATTGGACTTGTTGAGAACGTTACCGAACAA
CAAATATTATGATACGCTTGAATCTGAGGGGatttcaaaactACGACGCA
TTTTGACAGCGTACAGTTGGCATAACCCAGCTGTTGGATACTGTCAAGGA
TTAAATCGTTTGGGAGCCATCGCACTGTTGTATTTAGATGAAGAAACAGC
TTTCTGgTGTCTTGTAGCGATCACTGAACATCTAATGCCAATTGATTATT
ACAGCAGAACACTGCTCGGTGCGCAAATCGATCAAAAAGTATTTCGTGAC
TTGTTGGACGAAAAATGTCCGAAACTGAGTGCTCATCTTGTCTCCTTGCA
GTTCGACATATCGTTGGTATCATTCAATTGGTTCCTGACTGTTTTTGTTG
ATCTCTTTCCGATTGAGTTGACGTTAAGAGTGTGGGATACATTTCTCTTC
GAAGGTAGCAAGGTTTTATTCCGGTACGCATTGTCCGTCTTCAAACTTTT
CGAAGAAGAATTCCTACGCTTTAAAGATCCTGGACCGATGTTCAACTTTT
TCCGAAATCTACCCAAAAAGAAATTCAACATTCAAAAGATTTGTTACATA
GCTTTCAACACGATGAACCCCTTTAGTCGTCGTAATGTGGAATCGAAAAG
GAAATTCTACAGACCTATTCTTCAAGCACAACTTGACGAGTTTGAAATTA
TGCGTGAGGAATACAAGGAGAAACGGGAAGACAGTATTTCTATTCACGAT
GAAGAACCAATCAGTGACGACGAGAACTAAATGACTTCAAAAAAGGAAGT
CCAAGATCCTTGGGAAATACTAGAGGTTCCAGCTGTGATAAATTTCTCTT
CAAAATCCAATGAAGATGAGGGAGAAGAGaatgatttttctcaaaacaac
agcaaaacaaaaaaGGACAACAAAGAAAGGTTGTGTGGCTACTTGAATAA
AATGGGAGcCGGTATCATCAAAGGTTGGAAGAAAAGATGGTTTGTTTATG
ATCCACGTAGATGTCTACTTTTCTATTATCGTAGACCCCAAGACACTGAA
CCATTAGGGACTATAGATATAGCAAGTGCCACATTTTCCTACAACCCAAA
TGTAAAGGCCTTGTTTTCAATAAGTTCTGGAGACAGATTGTATCAACTTG
AGGCACCTGACAACAACGCCATGATGTTTTGGTTACAAGAACTGCAAGCC
AAAAGAcgagaattttcaaaacttgtAGAAGCAAATGCAGGCAATAATAG
ACCAACAAGTGGTTTGCTTTCTGATCCGATAGATGCTCCACAAGGAGGTG
ATGATGAAGCTGATGGTTTCAATAAAATAATTGAAAGACCTCACAATGTT
GGTGAGAAGACTGCTCTCGATTCTAAAGGAAATTTTTCATTCACACACTT
GaacaaagaattcaaaaattGGAGaaaatcaaccttttacacagaaactg
gggaggcaattttaaATGAGAAATCAGCTGCTTCTACGCCAGAACAAGAA
AAGAAAAGTCCTAACATGCAAAGAAGAGAAGATGATACAAAAATTCTAGA
AAGTGGAAACAAACGAAGaGTCGATTTTGGTTTCTCAAAGATGGTAGCAA
ATCTGAGGAATACAAATATGCCAGTGATTAGCTCCCCTcaaccaaacaac
aacaacataaaTCAATGCCGAGATTGTATGGAGaaattgaatatggTCAA
AACTCTCCAAGAAGCAATTTCAATGGCCGAAAAGGAAATTACTACACGAG
ATGAGGTTATTGAAAGTATAAGCGAACAACTAAgaTTTGCATCAAGCTCC
CCAACATTAGTGGAAAAAGCACCAGACATCGAAGAAGCGGAAGAGCGGGA
ACTCTATATACTCAAGctCAGTCGAATGATAAAAAGCTTGAATGAAAAAG
TTGACGAATTGACAACTACGATACGtgaaaatgaaCGAACTCTTGAAGAG
TACGAGCAAAAGGAGAGAGTCTTGAAAGAAATGATTCATGCTAAAGATAA
TTCAATCATCGCCTTGACGAACCAGGTATTTTCTTTGGAAGAGAAAGAAA
CAACAGACGTCGCTCAAGATGTATTGATAGCTTTTGAAGAGAAACCGTCA
GAAATGACTGATAGCAATTCATCGCCTATTGAACTAGACTACGACCAACT
AAAGGAGGCTTGTTCAGCTTACCAagctcaaaacaattttttgaacaGTG
AAATATTGGAGTTACACAAACTACGTACATTGGATGCTGAAAAGATATTG
AATGCAAATGATAACCTTGAGATGAAAGAAGCGGAGGTGATCAAAATCAG
AAGTCGATATTTATGGTTACTTAAAGATTGTGCTGGACCTAAACGAGaaa
cgAACATGGAGTCAGACGGAGTGCTGGAGAAATTAATCGATGAAGCCATC
AACGAAAAAGCTGACTCAACAACTGAAAAGAAAAGCCCTACTGAGATAAG
GTTTGCAGACAAGTATGGATTTTATGATCAAATCGAGAAATCTGACGAGA
ACGCTTTAGAATCACTTGCTGACCATTTCGAATcactcagtggggataaa
gagCTCGGTTCATTAGAAGTTTCACACGGTGTGAAATGGGAAAATTATTT
GGTAGCACAAGGTACCGCACCACTACAGAAAACGGAGGAACTCAAAGCAC
TCGTCCGAAGTGGTATCCCACACGAATTCCGTGCGCGCGTCTGGGGCGAT
CTCGTCCGCCTGCGTAGTGATCACGAGCGGACGATTGCTGGGCAAGGCTA
CTATGCTAACTTAttgaaagagaagaaaggagcTTACTCCCCGTCTGCCA
AACAGATTGAATTGGACTTGTTGAGAACGTTACCGAACAACAAATATTAT
GATACGCTTGAATCTGAGGGGatttcaaaactACGACGCATTTTGACAGC
GTACAGTTGGCATAACCCAGCTGTTGGATACTGTCAAGGATTAAATCGTT
TGGGAGCCATCGCACTGTTGTATTTAGATGAAGAAACAGCTTTCTGgTGT
CTTGTAGCGATCACTGAACATCTAATGCCAATTGATTATTACAGCAGAAC
ACTGCTCGGTGCGCAAATCGATCAAAAAGTATTTCGTGACTTGTTGGACG
AAAAATGTCCGAAACTGAGTGCTCATCTTGTCTCCTTGCAGTTCGACATA
TCGTTGGTATCATTCAATTGGTTCCTGACTGTTTTTGTTGATCTCTTTCC
GATTGAGTTGACGTTAAGAGTGTGGGATACATTTCTCTTCGAAGGTAGCA
AGGTTTTATTCCGGTACGCATTGTCCGTCTTCAAACTTTTCGAAGAAGAA
TTCCTACGCTTTAAAGATCCTGGACCGATGTTCAACTTTTTCCGAAATCT
ACCCAAAAAGAAATTCAACATTCAAAAGATTTGTTACATAGCTTTCAACA
CGATGAACCCCTTTAGTCGTCGTAATGTGGAATCGAAAAGGAAATTCTAC
AGACCTATTCTTCAAGCACAACTTGACGAGTTTGAAATTATGCGTGAGGA
ATACAAGGAGAAACGGGAAGACAGTATTTCTATTCACGATGAAGAACCAA
TCAGTGACGACGAGAACTAAATGACTTCAAAAAAGGAAGTCCAAGATCCT
TGGGAAATACTAGAGGTTCCAGCTGTGATAAATTTCTCTTCAAAATCCAA
TGAAGATGAGGGAGAAGAGaatgatttttctcaaaacaacagcaaaacaa
aaaaGGACAACAAAGAAAGGTTGTGTGGCTACTTGAATAAAATGGGAGcC
GGTATCATCAAAGGTTGGAAGAAAAGATGGTTTGTTTATGATCCACGTAG
ATGTCTACTTTTCTATTATCGTAGACCCCAAGACACTGAACCATTAGGGA
CTATAGATATAGCAAGTGCCACATTTTCCTACAACCCAAATGTAAAGGCC
TTGTTTTCAATAAGTTCTGGAGACAGATTGTATCAACTTGAGGCACCTGA
CAACAACGCCATGATGTTTTGGTTACAAGAACTGCAAGCCAAAAGAcgag
aattttcaaaacttgtAGAAGCAAATGCAGGCAATAATAGACCAACAAGT
GGTTTGCTTTCTGATCCGATAGATGCTCCACAAGGAGGTGATGATGAAGC
TGATGGTTTCAATAAAATAATTGAAAGACCTCACAATGTTGGTGAGAAGA
CTGCTCTCGATTCTAAAGGAAATTTTTCATTCACACACTTGaacaaagaa
ttcaaaaattGGAGaaaatcaaccttttacacagaaactggggaggcaat
tttaaATGAGAAATCAGCTGCTTCTACGCCAGAACAAGAAAAGAAAAGTC
CTAACATGCAAAGAAGAGAAGATGATACAAAAATTCTAGAAAGTGGAAAC
AAACGAAGaGTCGATTTTGGTTTCTCAAAGATGGTAGCAAATCTGAGGAA
TACAAATATGCCAGTGATTAGCTCCCCTcaaccaaacaacaacaacataa
aTCAATGCCGAGATTGTATGGAGaaattgaatatggTCAAAACTCTCCAA
GAAGCAATTTCAATGGCCGAAAAGGAAATTACTACACGAGATGAGGTTAT
TGAAAGTATAAGCGAACAACTAAgaTTTGCATCAAGCTCCCCAACATTAG
TGGAAAAAGCACCAGACATCGAAGAAGCGGAAGAGCGGGAACTCTATATA
CTCAAGctCAGTCGAATGATAAAAAGCTTGAATGAAAAAGTTGACGAATT
GACAACTACGATACGtgaaaatgaaCGAACTCTTGAAGAGTACGAGCAAA
AGGAGAGAGTCTTGAAAGAAATGATTCATGCTAAAGATAATTCAATCATC
GCCTTGACGAACCAGGTATTTTCTTTGGAAGAGAAAGAAACAACAGACGT
CGCTCAAGATGTATTGATAGCTTTTGAAGAGAAACCGTCAGAAATGACTG
ATAGCAATTCATCGCCTATTGAACTAGACTACGACCAACTAAAGGAGGCT
TGTTCAGCTTACCAagctcaaaacaattttttgaacaGTGAAATATTGGA
GTTACACAAACTACGTACATTGGATGCTGAAAAGATATTGAATGCAAATG
ATAACCTTGAGATGAAAGAAGCGGAGGTGATCAAAATCAGAAGTCGATAT
TTATGGTTACTTAAAGATTGTGCTGGACCTAAACGAGaaacgAACATGGA
GTCAGACGGAGTGCTGGAGAAATTAATCGATGAAGCCATCAACGAAAAAG
CTGACTCAACAACTGAAAAGAAAAGCCCTACTGAGATAAGGTTTGCAGAC
AAGTATGGATTTTATGATCAAATCGAGAAATCTGACGAGAACGCTTTAGA
ATCACTTGCTGACCATTTCGAATcactcagtggggataaagagCTCGGTT
CATTAGAAGTTTCACACGGTGTGAAATGGGAAAATTATTTGGTAGCACAA
GGTACCGCACCACTACAGAAAACGGAGGAACTCAAAGCACTCGTCCGAAG
TGGTATCCCACACGAATTCCGTGCGCGCGTCTGGGGCGATCTCGTCCGCC
TGCGTAGTGATCACGAGCGGACGATTGCTGGGCAAGGCTACTATGCTAAC
TTAttgaaagagaagaaaggagcTTACTCCCCGTCTGCCAAACAGATTGA
ATTGGACTTGTTGAGAACGTTACCGAACAACAAATATTATGATACGCTTG
AATCTGAGGGGatttcaaaactACGACGCATTTTGACAGCGTACAGTTGG
CATAACCCAGCTGTTGGATACTGTCAAGGATTAAATCGTTTGGGAGCCAT
CGCACTGTTGTATTTAGATGAAGAAACAGCTTTCTGgTGTCTTGTAGCGA
TCACTGAACATCTAATGCCAATTGATTATTACAGCAGAACACTGCTCGGT
GCGCAAATCGATCAAAAAGTATTTCGTGACTTGTTGGACGAAAAATGTCC
GAAACTGAGTGCTCATCTTGTCTCCTTGCAGTTCGACATATCGTTGGTAT
CATTCAATTGGTTCCTGACTGTTTTTGTTGATCTCTTTCCGATTGAGTTG
ACGTTAAGAGTGTGGGATACATTTCTCTTCGAAGGTAGCAAGGTTTTATT
CCGGTACGCATTGTCCGTCTTCAAACTTTTCGAAGAAGAATTCCTACGCT
TTAAAGATCCTGGACCGATGTTCAACTTTTTCCGAAATCTACCCAAAAAG
AAATTCAACATTCAAAAGATTTGTTACATAGCTTTCAACACGATGAACCC
CTTTAGTCGTCGTAATGTGGAATCGAAAAGGAAATTCTACAGACCTATTC
TTCAAGCACAACTTGACGAGTTTGAAATTATGCGTGAGGAATACAAGGAG
AAACGGGAAGACAGTATTTCTATTCACGATGAAGAACCAATCAGTGACGA
CGAGAACTAAATGACTTCAAAAAAGGAAGTCCAAGATCCTTGGGAAATAC
TAGAGGTTCCAGCTGTGATAAATTTCTCTTCAAAATCCAATGAAGATGAG
GGAGAAGAGaatgatttttctcaaaacaacagcaaaacaaaaaaGGACAA
CAAAGAAAGGTTGTGTGGCTACTTGAATAAAATGGGAGcCGGTATCATCA
AAGGTTGGAAGAAAAGATGGTTTGTTTATGATCCACGTAGATGTCTACTT
TTCTATTATCGTAGACCCCAAGACACTGAACCATTAGGGACTATAGATAT
AGCAAGTGCCACATTTTCCTACAACCCAAATGTAAAGGCCTTGTTTTCAA
TAAGTTCTGGAGACAGATTGTATCAACTTGAGGCACCTGACAACAACGCC
ATGATGTTTTGGTTACAAGAACTGCAAGCCAAAAGAcgagaattttcaaa
acttgtAGAAGCAAATGCAGGCAATAATAGACCAACAAGTGGTTTGCTTT
CTGATCCGATAGATGCTCCACAAGGAGGTGATGATGAAGCTGATGGTTTC
AATAAAATAATTGAAAGACCTCACAATGTTGGTGAGAAGACTGCTCTCGA
TTCTAAAGGAAATTTTTCATTCACACACTTGaacaaagaattcaaaaatt
GGAGaaaatcaaccttttacacagaaactggggaggcaattttaaATGAG
AAATCAGCTGCTTCTACGCCAGAACAAGAAAAGAAAAGTCCTAACATGCA
AAGAAGAGAAGATGATACAAAAATTCTAGAAAGTGGAAACAAACGAAGaG
TCGATTTTGGTTTCTCAAAGATGGTAGCAAATCTGAGGAATACAAATATG
CCAGTGATTAGCTCCCCTcaaccaaacaacaacaacataaaTCAATGCCG
AGATTGTATGGAGaaattgaatatggTCAAAACTCTCCAAGAAGCAATTT
CAATGGCCGAAAAGGAAATTACTACACGAGATGAGGTTATTGAAAGTATA
AGCGAACAACTAAgaTTTGCATCAAGCTCCCCAACATTAGTGGAAAAAGC
ACCAGACATCGAAGAAGCGGAAGAGCGGGAACTCTATATACTCAAGctCA
GTCGAATGATAAAAAGCTTGAATGAAAAAGTTGACGAATTGACAACTACG
ATACGtgaaaatgaaCGAACTCTTGAAGAGTACGAGCAAAAGGAGAGAGT
CTTGAAAGAAATGATTCATGCTAAAGATAATTCAATCATCGCCTTGACGA
ACCAGGTATTTTCTTTGGAAGAGAAAGAAACAACAGACGTCGCTCAAGAT
GTATTGATAGCTTTTGAAGAGAAACCGTCAGAAATGACTGATAGCAATTC
ATCGCCTATTGAACTAGACTACGACCAACTAAAGGAGGCTTGTTCAGCTT
ACCAagctcaaaacaattttttgaacaGTGAAATATTGGAGTTACACAAA
CTACGTACATTGGATGCTGAAAAGATATTGAATGCAAATGATAACCTTGA
GATGAAAGAAGCGGAGGTGATCAAAATCAGAAGTCGATATTTATGGTTAC
TTAAAGATTGTGCTGGACCTAAACGAGaaacgAACATGGAGTCAGACGGA
GTGCTGGAGAAATTAATCGATGAAGCCATCAACGAAAAAGCTGACTCAAC
AACTGAAAAGAAAAGCCCTACTGAGATAAGGTTTGCAGACAAGTATGGAT
TTTATGATCAAATCGAGAAATCTGACGAGAACGCTTTAGAATCACTTGCT
GACCATTTCGAATcactcagtggggataaagagCTCGGTTCATTAGAAGT
TTCACACGGTGTGAAATGGGAAAATTATTTGGTAGCACAAGGTACCGCAC
CACTACAGAAAACGGAGGAACTCAAAGCACTCGTCCGAAGTGGTATCCCA
CACGAATTCCGTGCGCGCGTCTGGGGCGATCTCGTCCGCCTGCGTAGTGA
TCACGAGCGGACGATTGCTGGGCAAGGCTACTATGCTAACTTAttgaaag
agaagaaaggagcTTACTCCCCGTCTGCCAAACAGATTGAATTGGACTTG
TTGAGAACGTTACCGAACAACAAATATTATGATACGCTTGAATCTGAGGG
GatttcaaaactACGACGCATTTTGACAGCGTACAGTTGGCATAACCCAG
CTGTTGGATACTGTCAAGGATTAAATCGTTTGGGAGCCATCGCACTGTTG
TATTTAGATGAAGAAACAGCTTTCTGgTGTCTTGTAGCGATCACTGAACA
TCTAATGCCAATTGATTATTACAGCAGAACACTGCTCGGTGCGCAAATCG
ATCAAAAAGTATTTCGTGACTTGTTGGACGAAAAATGTCCGAAACTGAGT
GCTCATCTTGTCTCCTTGCAGTTCGACATATCGTTGGTATCATTCAATTG
GTTCCTGACTGTTTTTGTTGATCTCTTTCCGATTGAGTTGACGTTAAGAG
TGTGGGATACATTTCTCTTCGAAGGTAGCAAGGTTTTATTCCGGTACGCA
TTGTCCGTCTTCAAACTTTTCGAAGAAGAATTCCTACGCTTTAAAGATCC
TGGACCGATGTTCAACTTTTTCCGAAATCTACCCAAAAAGAAATTCAACA
TTCAAAAGATTTGTTACATAGCTTTCAACACGATGAACCCCTTTAGTCGT
CGTAATGTGGAATCGAAAAGGAAATTCTACAGACCTATTCTTCAAGCACA
ACTTGACGAGTTTGAAATTATGCGTGAGGAATACAAGGAGAAACGGGAAG
ACAGTATTTCTATTCACGATGAAGAACCAATCAGTGACGACGAGAACTAA
ATGACTTCAAAAAAGGAAGTCCAAGATCCTTGGGAAATACTAGAGGTTCC
AGCTGTGATAAATTTCTCTTCAAAATCCAATGAAGATGAGGGAGAAGAGa
atgatttttctcaaaacaacagcaaaacaaaaaaGGACAACAAAGAAAGG
TTGTGTGGCTACTTGAATAAAATGGGAGcCGGTATCATCAAAGGTTGGAA
GAAAAGATGGTTTGTTTATGATCCACGTAGATGTCTACTTTTCTATTATC
GTAGACCCCAAGACACTGAACCATTAGGGACTATAGATATAGCAAGTGCC
ACATTTTCCTACAACCCAAATGTAAAGGCCTTGTTTTCAATAAGTTCTGG
AGACAGATTGTATCAACTTGAGGCACCTGACAACAACGCCATGATGTTTT
GGTTACAAGAACTGCAAGCCAAAAGAcgagaattttcaaaacttgtAGAA
GCAAATGCAGGCAATAATAGACCAACAAGTGGTTTGCTTTCTGATCCGAT
AGATGCTCCACAAGGAGGTGATGATGAAGCTGATGGTTTCAATAAAATAA
TTGAAAGACCTCACAATGTTGGTGAGAAGACTGCTCTCGATTCTAAAGGA
AATTTTTCATTCACACACTTGaacaaagaattcaaaaattGGAGaaaatc
aaccttttacacagaaactggggaggcaattttaaATGAGAAATCAGCTG
CTTCTACGCCAGAACAAGAAAAGAAAAGTCCTAACATGCAAAGAAGAGAA
GATGATACAAAAATTCTAGAAAGTGGAAACAAACGAAGaGTCGATTTTGG
TTTCTCAAAGATGGTAGCAAATCTGAGGAATACAAATATGCCAGTGATTA
GCTCCCCTcaaccaaacaacaacaacataaaTCAATGCCGAGATTGTATG
GAGaaattgaatatggTCAAAACTCTCCAAGAAGCAATTTCAATGGCCGA
AAAGGAAATTACTACACGAGATGAGGTTATTGAAAGTATAAGCGAACAAC
TAAgaTTTGCATCAAGCTCCCCAACATTAGTGGAAAAAGCACCAGACATC
GAAGAAGCGGAAGAGCGGGAACTCTATATACTCAAGctCAGTCGAATGAT
AAAAAGCTTGAATGAAAAAGTTGACGAATTGACAACTACGATACGtgaaa
atgaaCGAACTCTTGAAGAGTACGAGCAAAAGGAGAGAGTCTTGAAAGAA
ATGATTCATGCTAAAGATAATTCAATCATCGCCTTGACGAACCAGGTATT
TTCTTTGGAAGAGAAAGAAACAACAGACGTCGCTCAAGATGTATTGATAG
CTTTTGAAGAGAAACCGTCAGAAATGACTGATAGCAATTCATCGCCTATT
GAACTAGACTACGACCAACTAAAGGAGGCTTGTTCAGCTTACCAagctca
aaacaattttttgaacaGTGAAATATTGGAGTTACACAAACTACGTACAT
TGGATGCTGAAAAGATATTGAATGCAAATGATAACCTTGAGATGAAAGAA
GCGGAGGTGATCAAAATCAGAAGTCGATATTTATGGTTACTTAAAGATTG
TGCTGGACCTAAACGAGaaacgAACATGGAGTCAGACGGAGTGCTGGAGA
AATTAATCGATGAAGCCATCAACGAAAAAGCTGACTCAACAACTGAAAAG
AAAAGCCCTACTGAGATAAGGTTTGCAGACAAGTATGGATTTTATGATCA
AATCGAGAAATCTGACGAGAACGCTTTAGAATCACTTGCTGACCATTTCG
AATcactcagtggggataaagagCTCGGTTCATTAGAAGTTTCACACGGT
GTGAAATGGGAAAATTATTTGGTAGCACAAGGTACCGCACCACTACAGAA
AACGGAGGAACTCAAAGCACTCGTCCGAAGTGGTATCCCACACGAATTCC
GTGCGCGCGTCTGGGGCGATCTCGTCCGCCTGCGTAGTGATCACGAGCGG
ACGATTGCTGGGCAAGGCTACTATGCTAACTTAttgaaagagaagaaagg
agcTTACTCCCCGTCTGCCAAACAGATTGAATTGGACTTGTTGAGAACGT
TACCGAACAACAAATATTATGATACGCTTGAATCTGAGGGGatttcaaaa
ctACGACGCATTTTGACAGCGTACAGTTGGCATAACCCAGCTGTTGGATA
CTGTCAAGGATTAAATCGTTTGGGAGCCATCGCACTGTTGTATTTAGATG
AAGAAACAGCTTTCTGgTGTCTTGTAGCGATCACTGAACATCTAATGCCA
ATTGATTATTACAGCAGAACACTGCTCGGTGCGCAAATCGATCAAAAAGT
ATTTCGTGACTTGTTGGACGAAAAATGTCCGAAACTGAGTGCTCATCTTG
TCTCCTTGCAGTTCGACATATCGTTGGTATCATTCAATTGGTTCCTGACT
GTTTTTGTTGATCTCTTTCCGATTGAGTTGACGTTAAGAGTGTGGGATAC
ATTTCTCTTCGAAGGTAGCAAGGTTTTATTCCGGTACGCATTGTCCGTCT
TCAAACTTTTCGAAGAAGAATTCCTACGCTTTAAAGATCCTGGACCGATG
TTCAACTTTTTCCGAAATCTACCCAAAAAGAAATTCAACATTCAAAAGAT
TTGTTACATAGCTTTCAACACGATGAACCCCTTTAGTCGTCGTAATGTGG
AATCGAAAAGGAAATTCTACAGACCTATTCTTCAAGCACAACTTGACGAG
TTTGAAATTATGCGTGAGGAATACAAGGAGAAACGGGAAGACAGTATTTC
TATTCACGATGAAGAACCAATCAGTGACGACGAGAACTAAATGACTTCAA
AAAAGGAAGTCCAAGATCCTTGGGAAATACTAGAGGTTCCAGCTGTGATA
AATTTCTCTTCAAAATCCAATGAAGATGAGGGAGAAGAGaatgatttttc
tcaaaacaacagcaaaacaaaaaaGGACAACAAAGAAAGGTTGTGTGGCT
ACTTGAATAAAATGGGAGcCGGTATCATCAAAGGTTGGAAGAAAAGATGG
TTTGTTTATGATCCACGTAGATGTCTACTTTTCTATTATCGTAGACCCCA
AGACACTGAACCATTAGGGACTATAGATATAGCAAGTGCCACATTTTCCT
ACAACCCAAATGTAAAGGCCTTGTTTTCAATAAGTTCTGGAGACAGATTG
TATCAACTTGAGGCACCTGACAACAACGCCATGATGTTTTGGTTACAAGA
ACTGCAAGCCAAAAGAcgagaattttcaaaacttgtAGAAGCAAATGCAG
GCAATAATAGACCAACAAGTGGTTTGCTTTCTGATCCGATAGATGCTCCA
CAAGGAGGTGATGATGAAGCTGATGGTTTCAATAAAATAATTGAAAGACC
TCACAATGTTGGTGAGAAGACTGCTCTCGATTCTAAAGGAAATTTTTCAT
TCACACACTTGaacaaagaattcaaaaattGGAGaaaatcaaccttttac
acagaaactggggaggcaattttaaATGAGAAATCAGCTGCTTCTACGCC
AGAACAAGAAAAGAAAAGTCCTAACATGCAAAGAAGAGAAGATGATACAA
AAATTCTAGAAAGTGGAAACAAACGAAGaGTCGATTTTGGTTTCTCAAAG
ATGGTAGCAAATCTGAGGAATACAAATATGCCAGTGATTAGCTCCCCTca
accaaacaacaacaacataaaTCAATGCCGAGATTGTATGGAGaaattga
atatggTCAAAACTCTCCAAGAAGCAATTTCAATGGCCGAAAAGGAAATT
ACTACACGAGATGAGGTTATTGAAAGTATAAGCGAACAACTAAgaTTTGC
ATCAAGCTCCCCAACATTAGTGGAAAAAGCACCAGACATCGAAGAAGCGG
AAGAGCGGGAACTCTATATACTCAAGctCAGTCGAATGATAAAAAGCTTG
AATGAAAAAGTTGACGAATTGACAACTACGATACGtgaaaatgaaCGAAC
TCTTGAAGAGTACGAGCAAAAGGAGAGAGTCTTGAAAGAAATGATTCATG
CTAAAGATAATTCAATCATCGCCTTGACGAACCAGGTATTTTCTTTGGAA
GAGAAAGAAACAACAGACGTCGCTCAAGATGTATTGATAGCTTTTGAAGA
GAAACCGTCAGAAATGACTGATAGCAATTCATCGCCTATTGAACTAGACT
ACGACCAACTAAAGGAGGCTTGTTCAGCTTACCAagctcaaaacaatttt
ttgaacaGTGAAATATTGGAGTTACACAAACTACGTACATTGGATGCTGA
AAAGATATTGAATGCAAATGATAACCTTGAGATGAAAGAAGCGGAGGTGA
TCAAAATCAGAAGTCGATATTTATGGTTACTTAAAGATTGTGCTGGACCT
AAACGAGaaacgAACATGGAGTCAGACGGAGTGCTGGAGAAATTAATCGA
TGAAGCCATCAACGAAAAAGCTGACTCAACAACTGAAAAGAAAAGCCCTA
CTGAGATAAGGTTTGCAGACAAGTATGGATTTTATGATCAAATCGAGAAA
TCTGACGAGAACGCTTTAGAATCACTTGCTGACCATTTCGAATcactcag
tggggataaagagCTCGGTTCATTAGAAGTTTCACACGGTGTGAAATGGG
AAAATTATTTGGTAGCACAAGGTACCGCACCACTACAGAAAACGGAGGAA
CTCAAAGCACTCGTCCGAAGTGGTATCCCACACGAATTCCGTGCGCGCGT
CTGGGGCGATCTCGTCCGCCTGCGTAGTGATCACGAGCGGACGATTGCTG
GGCAAGGCTACTATGCTAACTTAttgaaagagaagaaaggagcTTACTCC
CCGTCTGCCAAACAGATTGAATTGGACTTGTTGAGAACGTTACCGAACAA
CAAATATTATGATACGCTTGAATCTGAGGGGatttcaaaactACGACGCA
TTTTGACAGCGTACAGTTGGCATAACCCAGCTGTTGGATACTGTCAAGGA
TTAAATCGTTTGGGAGCCATCGCACTGTTGTATTTAGATGAAGAAACAGC
TTTCTGgTGTCTTGTAGCGATCACTGAACATCTAATGCCAATTGATTATT
ACAGCAGAACACTGCTCGGTGCGCAAATCGATCAAAAAGTATTTCGTGAC
TTGTTGGACGAAAAATGTCCGAAACTGAGTGCTCATCTTGTCTCCTTGCA
GTTCGACATATCGTTGGTATCATTCAATTGGTTCCTGACTGTTTTTGTTG
ATCTCTTTCCGATTGAGTTGACGTTAAGAGTGTGGGATACATTTCTCTTC
GAAGGTAGCAAGGTTTTATTCCGGTACGCATTGTCCGTCTTCAAACTTTT
CGAAGAAGAATTCCTACGCTTTAAAGATCCTGGACCGATGTTCAACTTTT
TCCGAAATCTACCCAAAAAGAAATTCAACATTCAAAAGATTTGTTACATA
GCTTTCAACACGATGAACCCCTTTAGTCGTCGTAATGTGGAATCGAAAAG
GAAATTCTACAGACCTATTCTTCAAGCACAACTTGACGAGTTTGAAATTA
TGCGTGAGGAATACAAGGAGAAACGGGAAGACAGTATTTCTATTCACGAT
GAAGAACCAATCAGTGACGACGAGAACTAAATGACTTCAAAAAAGGAAGT
CCAAGATCCTTGGGAAATACTAGAGGTTCCAGCTGTGATAAATTTCTCTT
CAAAATCCAATGAAGATGAGGGAGAAGAGaatgatttttctcaaaacaac
agcaaaacaaaaaaGGACAACAAAGAAAGGTTGTGTGGCTACTTGAATAA
AATGGGAGcCGGTATCATCAAAGGTTGGAAGAAAAGATGGTTTGTTTATG
ATCCACGTAGATGTCTACTTTTCTATTATCGTAGACCCCAAGACACTGAA
CCATTAGGGACTATAGATATAGCAAGTGCCACATTTTCCTACAACCCAAA
TGTAAAGGCCTTGTTTTCAATAAGTTCTGGAGACAGATTGTATCAACTTG
AGGCACCTGACAACAACGCCATGATGTTTTGGTTACAAGAACTGCAAGCC
AAAAGAcgagaattttcaaaacttgtAGAAGCAAATGCAGGCAATAATAG
ACCAACAAGTGGTTTGCTTTCTGATCCGATAGATGCTCCACAAGGAGGTG
ATGATGAAGCTGATGGTTTCAATAAAATAATTGAAAGACCTCACAATGTT
GGTGAGAAGACTGCTCTCGATTCTAAAGGAAATTTTTCATTCACACACTT
GaacaaagaattcaaaaattGGAGaaaatcaaccttttacacagaaactg
gggaggcaattttaaATGAGAAATCAGCTGCTTCTACGCCAGAACAAGAA
AAGAAAAGTCCTAACATGCAAAGAAGAGAAGATGATACAAAAATTCTAGA
AAGTGGAAACAAACGAAGaGTCGATTTTGGTTTCTCAAAGATGGTAGCAA
ATCTGAGGAATACAAATATGCCAGTGATTAGCTCCCCTcaaccaaacaac
aacaacataaaTCAATGCCGAGATTGTATGGAGaaattgaatatggTCAA
AACTCTCCAAGAAGCAATTTCAATGGCCGAAAAGGAAATTACTACACGAG
ATGAGGTTATTGAAAGTATAAGCGAACAACTAAgaTTTGCATCAAGCTCC
CCAACATTAGTGGAAAAAGCACCAGACATCGAAGAAGCGGAAGAGCGGGA
ACTCTATATACTCAAGctCAGTCGAATGATAAAAAGCTTGAATGAAAAAG
TTGACGAATTGACAACTACGATACGtgaaaatgaaCGAACTCTTGAAGAG
TACGAGCAAAAGGAGAGAGTCTTGAAAGAAATGATTCATGCTAAAGATAA
TTCAATCATCGCCTTGACGAACCAGGTATTTTCTTTGGAAGAGAAAGAAA
CAACAGACGTCGCTCAAGATGTATTGATAGCTTTTGAAGAGAAACCGTCA
GAAATGACTGATAGCAATTCATCGCCTATTGAACTAGACTACGACCAACT
AAAGGAGGCTTGTTCAGCTTACCAagctcaaaacaattttttgaacaGTG
AAATATTGGAGTTACACAAACTACGTACATTGGATGCTGAAAAGATATTG
AATGCAAATGATAACCTTGAGATGAAAGAAGCGGAGGTGATCAAAATCAG
AAGTCGATATTTATGGTTACTTAAAGATTGTGCTGGACCTAAACGAGaaa
cgAACATGGAGTCAGACGGAGTGCTGGAGAAATTAATCGATGAAGCCATC
AACGAAAAAGCTGACTCAACAACTGAAAAGAAAAGCCCTACTGAGATAAG
GTTTGCAGACAAGTATGGATTTTATGATCAAATCGAGAAATCTGACGAGA
ACGCTTTAGAATCACTTGCTGACCATTTCGAATcactcagtggggataaa
gagCTCGGTTCATTAGAAGTTTCACACGGTGTGAAATGGGAAAATTATTT
GGTAGCACAAGGTACCGCACCACTACAGAAAACGGAGGAACTCAAAGCAC
TCGTCCGAAGTGGTATCCCACACGAATTCCGTGCGCGCGTCTGGGGCGAT
CTCGTCCGCCTGCGTAGTGATCACGAGCGGACGATTGCTGGGCAAGGCTA
CTATGCTAACTTAttgaaagagaagaaaggagcTTACTCCCCGTCTGCCA
AACAGATTGAATTGGACTTGTTGAGAACGTTACCGAACAACAAATATTAT
GATACGCTTGAATCTGAGGGGatttcaaaactACGACGCATTTTGACAGC
GTACAGTTGGCATAACCCAGCTGTTGGATACTGTCAAGGATTAAATCGTT
TGGGAGCCATCGCACTGTTGTATTTAGATGAAGAAACAGCTTTCTGgTGT
CTTGTAGCGATCACTGAACATCTAATGCCAATTGATTATTACAGCAGAAC
ACTGCTCGGTGCGCAAATCGATCAAAAAGTATTTCGTGACTTGTTGGACG
AAAAATGTCCGAAACTGAGTGCTCATCTTGTCTCCTTGCAGTTCGACATA
TCGTTGGTATCATTCAATTGGTTCCTGACTGTTTTTGTTGATCTCTTTCC
GATTGAGTTGACGTTAAGAGTGTGGGATACATTTCTCTTCGAAGGTAGCA
AGGTTTTATTCCGGTACGCATTGTCCGTCTTCAAACTTTTCGAAGAAGAA
TTCCTACGCTTTAAAGATCCTGGACCGATGTTCAACTTTTTCCGAAATCT
ACCCAAAAAGAAATTCAACATTCAAAAGATTTGTTACATAGCTTTCAACA
CGATGAACCCCTTTAGTCGTCGTAATGTGGAATCGAAAAGGAAATTCTAC
AGACCTATTCTTCAAGCACAACTTGACGAGTTTGAAATTATGCGTGAGGA
ATACAAGGAGAAACGGGAAGACAGTATTTCTATTCACGATGAAGAACCAA
TCAGTGACGACGAGAACTAAATGACTTCAAAAAAGGAAGTCCAAGATCCT
TGGGAAATACTAGAGGTTCCAGCTGTGATAAATTTCTCTTCAAAATCCAA
TGAAGATGAGGGAGAAGAGaatgatttttctcaaaacaacagcaaaacaa
aaaaGGACAACAAAGAAAGGTTGTGTGGCTACTTGAATAAAATGGGAGcC
GGTATCATCAAAGGTTGGAAGAAAAGATGGTTTGTTTATGATCCACGTAG
ATGTCTACTTTTCTATTATCGTAGACCCCAAGACACTGAACCATTAGGGA
CTATAGATATAGCAAGTGCCACATTTTCCTACAACCCAAATGTAAAGGCC
TTGTTTTCAATAAGTTCTGGAGACAGATTGTATCAACTTGAGGCACCTGA
CAACAACGCCATGATGTTTTGGTTACAAGAACTGCAAGCCAAAAGAcgag
aattttcaaaacttgtAGAAGCAAATGCAGGCAATAATAGACCAACAAGT
GGTTTGCTTTCTGATCCGATAGATGCTCCACAAGGAGGTGATGATGAAGC
TGATGGTTTCAATAAAATAATTGAAAGACCTCACAATGTTGGTGAGAAGA
CTGCTCTCGATTCTAAAGGAAATTTTTCATTCACACACTTGaacaaagaa
ttcaaaaattGGAGaaaatcaaccttttacacagaaactggggaggcaat
tttaaATGAGAAATCAGCTGCTTCTACGCCAGAACAAGAAAAGAAAAGTC
CTAACATGCAAAGAAGAGAAGATGATACAAAAATTCTAGAAAGTGGAAAC
AAACGAAGaGTCGATTTTGGTTTCTCAAAGATGGTAGCAAATCTGAGGAA
TACAAATATGCCAGTGATTAGCTCCCCTcaaccaaacaacaacaacataa
aTCAATGCCGAGATTGTATGGAGaaattgaatatggTCAAAACTCTCCAA
GAAGCAATTTCAATGGCCGAAAAGGAAATTACTACACGAGATGAGGTTAT
TGAAAGTATAAGCGAACAACTAAgaTTTGCATCAAGCTCCCCAACATTAG
TGGAAAAAGCACCAGACATCGAAGAAGCGGAAGAGCGGGAACTCTATATA
CTCAAGctCAGTCGAATGATAAAAAGCTTGAATGAAAAAGTTGACGAATT
GACAACTACGATACGtgaaaatgaaCGAACTCTTGAAGAGTACGAGCAAA
AGGAGAGAGTCTTGAAAGAAATGATTCATGCTAAAGATAATTCAATCATC
GCCTTGACGAACCAGGTATTTTCTTTGGAAGAGAAAGAAACAACAGACGT
CGCTCAAGATGTATTGATAGCTTTTGAAGAGAAACCGTCAGAAATGACTG
ATAGCAATTCATCGCCTATTGAACTAGACTACGACCAACTAAAGGAGGCT
TGTTCAGCTTACCAagctcaaaacaattttttgaacaGTGAAATATTGGA
GTTACACAAACTACGTACATTGGATGCTGAAAAGATATTGAATGCAAATG
ATAACCTTGAGATGAAAGAAGCGGAGGTGATCAAAATCAGAAGTCGATAT
TTATGGTTACTTAAAGATTGTGCTGGACCTAAACGAGaaacgAACATGGA
GTCAGACGGAGTGCTGGAGAAATTAATCGATGAAGCCATCAACGAAAAAG
CTGACTCAACAACTGAAAAGAAAAGCCCTACTGAGATAAGGTTTGCAGAC
AAGTATGGATTTTATGATCAAATCGAGAAATCTGACGAGAACGCTTTAGA
ATCACTTGCTGACCATTTCGAATcactcagtggggataaagagCTCGGTT
CATTAGAAGTTTCACACGGTGTGAAATGGGAAAATTATTTGGTAGCACAA
GGTACCGCACCACTACAGAAAACGGAGGAACTCAAAGCACTCGTCCGAAG
TGGTATCCCACACGAATTCCGTGCGCGCGTCTGGGGCGATCTCGTCCGCC
TGCGTAGTGATCACGAGCGGACGATTGCTGGGCAAGGCTACTATGCTAAC
TTAttgaaagagaagaaaggagcTTACTCCCCGTCTGCCAAACAGATTGA
ATTGGACTTGTTGAGAACGTTACCGAACAACAAATATTATGATACGCTTG
AATCTGAGGGGatttcaaaactACGACGCATTTTGACAGCGTACAGTTGG
CATAACCCAGCTGTTGGATACTGTCAAGGATTAAATCGTTTGGGAGCCAT
CGCACTGTTGTATTTAGATGAAGAAACAGCTTTCTGgTGTCTTGTAGCGA
TCACTGAACATCTAATGCCAATTGATTATTACAGCAGAACACTGCTCGGT
GCGCAAATCGATCAAAAAGTATTTCGTGACTTGTTGGACGAAAAATGTCC
GAAACTGAGTGCTCATCTTGTCTCCTTGCAGTTCGACATATCGTTGGTAT
CATTCAATTGGTTCCTGACTGTTTTTGTTGATCTCTTTCCGATTGAGTTG
ACGTTAAGAGTGTGGGATACATTTCTCTTCGAAGGTAGCAAGGTTTTATT
CCGGTACGCATTGTCCGTCTTCAAACTTTTCGAAGAAGAATTCCTACGCT
TTAAAGATCCTGGACCGATGTTCAACTTTTTCCGAAATCTACCCAAAAAG
AAATTCAACATTCAAAAGATTTGTTACATAGCTTTCAACACGATGAACCC
CTTTAGTCGTCGTAATGTGGAATCGAAAAGGAAATTCTACAGACCTATTC
TTCAAGCACAACTTGACGAGTTTGAAATTATGCGTGAGGAATACAAGGAG
AAACGGGAAGACAGTATTTCTATTCACGATGAAGAACCAATCAGTGACGA
CGAGAACTAAATGACTTCAAAAAAGGAAGTCCAAGATCCTTGGGAAATAC
TAGAGGTTCCAGCTGTGATAAATTTCTCTTCAAAATCCAATGAAGATGAG
GGAGAAGAGaatgatttttctcaaaacaacagcaaaacaaaaaaGGACAA
CAAAGAAAGGTTGTGTGGCTACTTGAATAAAATGGGAGcCGGTATCATCA
AAGGTTGGAAGAAAAGATGGTTTGTTTATGATCCACGTAGATGTCTACTT
TTCTATTATCGTAGACCCCAAGACACTGAACCATTAGGGACTATAGATAT
AGCAAGTGCCACATTTTCCTACAACCCAAATGTAAAGGCCTTGTTTTCAA
TAAGTTCTGGAGACAGATTGTATCAACTTGAGGCACCTGACAACAACGCC
ATGATGTTTTGGTTACAAGAACTGCAAGCCAAAAGAcgagaattttcaaa
acttgtAGAAGCAAATGCAGGCAATAATAGACCAACAAGTGGTTTGCTTT
CTGATCCGATAGATGCTCCACAAGGAGGTGATGATGAAGCTGATGGTTTC
AATAAAATAATTGAAAGACCTCACAATGTTGGTGAGAAGACTGCTCTCGA
TTCTAAAGGAAATTTTTCATTCACACACTTGaacaaagaattcaaaaatt
GGAGaaaatcaaccttttacacagaaactggggaggcaattttaaATGAG
AAATCAGCTGCTTCTACGCCAGAACAAGAAAAGAAAAGTCCTAACATGCA
AAGAAGAGAAGATGATACAAAAATTCTAGAAAGTGGAAACAAACGAAGaG
TCGATTTTGGTTTCTCAAAGATGGTAGCAAATCTGAGGAATACAAATATG
CCAGTGATTAGCTCCCCTcaaccaaacaacaacaacataaaTCAATGCCG
AGATTGTATGGAGaaattgaatatggTCAAAACTCTCCAAGAAGCAATTT
CAATGGCCGAAAAGGAAATTACTACACGAGATGAGGTTATTGAAAGTATA
AGCGAACAACTAAgaTTTGCATCAAGCTCCCCAACATTAGTGGAAAAAGC
ACCAGACATCGAAGAAGCGGAAGAGCGGGAACTCTATATACTCAAGctCA
GTCGAATGATAAAAAGCTTGAATGAAAAAGTTGACGAATTGACAACTACG
ATACGtgaaaatgaaCGAACTCTTGAAGAGTACGAGCAAAAGGAGAGAGT
CTTGAAAGAAATGATTCATGCTAAAGATAATTCAATCATCGCCTTGACGA
ACCAGGTATTTTCTTTGGAAGAGAAAGAAACAACAGACGTCGCTCAAGAT
GTATTGATAGCTTTTGAAGAGAAACCGTCAGAAATGACTGATAGCAATTC
ATCGCCTATTGAACTAGACTACGACCAACTAAAGGAGGCTTGTTCAGCTT
ACCAagctcaaaacaattttttgaacaGTGAAATATTGGAGTTACACAAA
CTACGTACATTGGATGCTGAAAAGATATTGAATGCAAATGATAACCTTGA
GATGAAAGAAGCGGAGGTGATCAAAATCAGAAGTCGATATTTATGGTTAC
TTAAAGATTGTGCTGGACCTAAACGAGaaacgAACATGGAGTCAGACGGA
GTGCTGGAGAAATTAATCGATGAAGCCATCAACGAAAAAGCTGACTCAAC
AACTGAAAAGAAAAGCCCTACTGAGATAAGGTTTGCAGACAAGTATGGAT
TTTATGATCAAATCGAGAAATCTGACGAGAACGCTTTAGAATCACTTGCT
GACCATTTCGAATcactcagtggggataaagagCTCGGTTCATTAGAAGT
TTCACACGGTGTGAAATGGGAAAATTATTTGGTAGCACAAGGTACCGCAC
CACTACAGAAAACGGAGGAACTCAAAGCACTCGTCCGAAGTGGTATCCCA
CACGAATTCCGTGCGCGCGTCTGGGGCGATCTCGTCCGCCTGCGTAGTGA
TCACGAGCGGACGATTGCTGGGCAAGGCTACTATGCTAACTTAttgaaag
agaagaaaggagcTTACTCCCCGTCTGCCAAACAGATTGAATTGGACTTG
TTGAGAACGTTACCGAACAACAAATATTATGATACGCTTGAATCTGAGGG
GatttcaaaactACGACGCATTTTGACAGCGTACAGTTGGCATAACCCAG
CTGTTGGATACTGTCAAGGATTAAATCGTTTGGGAGCCATCGCACTGTTG
TATTTAGATGAAGAAACAGCTTTCTGgTGTCTTGTAGCGATCACTGAACA
TCTAATGCCAATTGATTATTACAGCAGAACACTGCTCGGTGCGCAAATCG
ATCAAAAAGTATTTCGTGACTTGTTGGACGAAAAATGTCCGAAACTGAGT
GCTCATCTTGTCTCCTTGCAGTTCGACATATCGTTGGTATCATTCAATTG
GTTCCTGACTGTTTTTGTTGATCTCTTTCCGATTGAGTTGACGTTAAGAG
TGTGGGATACATTTCTCTTCGAAGGTAGCAAGGTTTTATTCCGGTACGCA
TTGTCCGTCTTCAAACTTTTCGAAGAAGAATTCCTACGCTTTAAAGATCC
TGGACCGATGTTCAACTTTTTCCGAAATCTACCCAAAAAGAAATTCAACA
TTCAAAAGATTTGTTACATAGCTTTCAACACGATGAACCCCTTTAGTCGT
CGTAATGTGGAATCGAAAAGGAAATTCTACAGACCTATTCTTCAAGCACA
ACTTGACGAGTTTGAAATTATGCGTGAGGAATACAAGGAGAAACGGGAAG
ACAGTATTTCTATTCACGATGAAGAACCAATCAGTGACGACGAGAACTAA
ATGACTTCAAAAAAGGAAGTCCAAGATCCTTGGGAAATACTAGAGGTTCC
AGCTGTGATAAATTTCTCTTCAAAATCCAATGAAGATGAGGGAGAAGAGa
atgatttttctcaaaacaacagcaaaacaaaaaaGGACAACAAAGAAAGG
TTGTGTGGCTACTTGAATAAAATGGGAGcCGGTATCATCAAAGGTTGGAA
GAAAAGATGGTTTGTTTATGATCCACGTAGATGTCTACTTTTCTATTATC
GTAGACCCCAAGACACTGAACCATTAGGGACTATAGATATAGCAAGTGCC
ACATTTTCCTACAACCCAAATGTAAAGGCCTTGTTTTCAATAAGTTCTGG
AGACAGATTGTATCAACTTGAGGCACCTGACAACAACGCCATGATGTTTT
GGTTACAAGAACTGCAAGCCAAAAGAcgagaattttcaaaacttgtAGAA
GCAAATGCAGGCAATAATAGACCAACAAGTGGTTTGCTTTCTGATCCGAT
AGATGCTCCACAAGGAGGTGATGATGAAGCTGATGGTTTCAATAAAATAA
TTGAAAGACCTCACAATGTTGGTGAGAAGACTGCTCTCGATTCTAAAGGA
AATTTTTCATTCACACACTTGaacaaagaattcaaaaattGGAGaaaatc
aaccttttacacagaaactggggaggcaattttaaATGAGAAATCAGCTG
CTTCTACGCCAGAACAAGAAAAGAAAAGTCCTAACATGCAAAGAAGAGAA
GATGATACAAAAATTCTAGAAAGTGGAAACAAACGAAGaGTCGATTTTGG
TTTCTCAAAGATGGTAGCAAATCTGAGGAATACAAATATGCCAGTGATTA
GCTCCCCTcaaccaaacaacaacaacataaaTCAATGCCGAGATTGTATG
GAGaaattgaatatggTCAAAACTCTCCAAGAAGCAATTTCAATGGCCGA
AAAGGAAATTACTACACGAGATGAGGTTATTGAAAGTATAAGCGAACAAC
TAAgaTTTGCATCAAGCTCCCCAACATTAGTGGAAAAAGCACCAGACATC
GAAGAAGCGGAAGAGCGGGAACTCTATATACTCAAGctCAGTCGAATGAT
AAAAAGCTTGAATGAAAAAGTTGACGAATTGACAACTACGATACGtgaaa
atgaaCGAACTCTTGAAGAGTACGAGCAAAAGGAGAGAGTCTTGAAAGAA
ATGATTCATGCTAAAGATAATTCAATCATCGCCTTGACGAACCAGGTATT
TTCTTTGGAAGAGAAAGAAACAACAGACGTCGCTCAAGATGTATTGATAG
CTTTTGAAGAGAAACCGTCAGAAATGACTGATAGCAATTCATCGCCTATT
GAACTAGACTACGACCAACTAAAGGAGGCTTGTTCAGCTTACCAagctca
aaacaattttttgaacaGTGAAATATTGGAGTTACACAAACTACGTACAT
TGGATGCTGAAAAGATATTGAATGCAAATGATAACCTTGAGATGAAAGAA
GCGGAGGTGATCAAAATCAGAAGTCGATATTTATGGTTACTTAAAGATTG
TGCTGGACCTAAACGAGaaacgAACATGGAGTCAGACGGAGTGCTGGAGA
AATTAATCGATGAAGCCATCAACGAAAAAGCTGACTCAACAACTGAAAAG
AAAAGCCCTACTGAGATAAGGTTTGCAGACAAGTATGGATTTTATGATCA
AATCGAGAAATCTGACGAGAACGCTTTAGAATCACTTGCTGACCATTTCG
AATcactcagtggggataaagagCTCGGTTCATTAGAAGTTTCACACGGT
GTGAAATGGGAAAATTATTTGGTAGCACAAGGTACCGCACCACTACAGAA
AACGGAGGAACTCAAAGCACTCGTCCGAAGTGGTATCCCACACGAATTCC
GTGCGCGCGTCTGGGGCGATCTCGTCCGCCTGCGTAGTGATCACGAGCGG
ACGATTGCTGGGCAAGGCTACTATGCTAACTTAttgaaagagaagaaagg
agcTTACTCCCCGTCTGCCAAACAGATTGAATTGGACTTGTTGAGAACGT
TACCGAACAACAAATATTATGATACGCTTGAATCTGAGGGGatttcaaaa
ctACGACGCATTTTGACAGCGTACAGTTGGCATAACCCAGCTGTTGGATA
CTGTCAAGGATTAAATCGTTTGGGAGCCATCGCACTGTTGTATTTAGATG
AAGAAACAGCTTTCTGgTGTCTTGTAGCGATCACTGAACATCTAATGCCA
ATTGATTATTACAGCAGAACACTGCTCGGTGCGCAAATCGATCAAAAAGT
ATTTCGTGACTTGTTGGACGAAAAATGTCCGAAACTGAGTGCTCATCTTG
TCTCCTTGCAGTTCGACATATCGTTGGTATCATTCAATTGGTTCCTGACT
GTTTTTGTTGATCTCTTTCCGATTGAGTTGACGTTAAGAGTGTGGGATAC
ATTTCTCTTCGAAGGTAGCAAGGTTTTATTCCGGTACGCATTGTCCGTCT
TCAAACTTTTCGAAGAAGAATTCCTACGCTTTAAAGATCCTGGACCGATG
TTCAACTTTTTCCGAAATCTACCCAAAAAGAAATTCAACATTCAAAAGAT
TTGTTACATAGCTTTCAACACGATGAACCCCTTTAGTCGTCGTAATGTGG
AATCGAAAAGGAAATTCTACAGACCTATTCTTCAAGCACAACTTGACGAG
TTTGAAATTATGCGTGAGGAATACAAGGAGAAACGGGAAGACAGTATTTC
TATTCACGATGAAGAACCAATCAGTGACGACGAGAACTAAATGACTTCAA
AAAAGGAAGTCCAAGATCCTTGGGAAATACTAGAGGTTCCAGCTGTGATA
AATTTCTCTTCAAAATCCAATGAAGATGAGGGAGAAGAGaatgatttttc
tcaaaacaacagcaaaacaaaaaaGGACAACAAAGAAAGGTTGTGTGGCT
ACTTGAATAAAATGGGAGcCGGTATCATCAAAGGTTGGAAGAAAAGATGG
TTTGTTTATGATCCACGTAGATGTCTACTTTTCTATTATCGTAGACCCCA
AGACACTGAACCATTAGGGACTATAGATATAGCAAGTGCCACATTTTCCT
ACAACCCAAATGTAAAGGCCTTGTTTTCAATAAGTTCTGGAGACAGATTG
TATCAACTTGAGGCACCTGACAACAACGCCATGATGTTTTGGTTACAAGA
ACTGCAAGCCAAAAGAcgagaattttcaaaacttgtAGAAGCAAATGCAG
GCAATAATAGACCAACAAGTGGTTTGCTTTCTGATCCGATAGATGCTCCA
CAAGGAGGTGATGATGAAGCTGATGGTTTCAATAAAATAATTGAAAGACC
TCACAATGTTGGTGAGAAGACTGCTCTCGATTCTAAAGGAAATTTTTCAT
TCACACACTTGaacaaagaattcaaaaattGGAGaaaatcaaccttttac
acagaaactggggaggcaattttaaATGAGAAATCAGCTGCTTCTACGCC
AGAACAAGAAAAGAAAAGTCCTAACATGCAAAGAAGAGAAGATGATACAA
AAATTCTAGAAAGTGGAAACAAACGAAGaGTCGATTTTGGTTTCTCAAAG
ATGGTAGCAAATCTGAGGAATACAAATATGCCAGTGATTAGCTCCCCTca
accaaacaacaacaacataaaTCAATGCCGAGATTGTATGGAGaaattga
atatggTCAAAACTCTCCAAGAAGCAATTTCAATGGCCGAAAAGGAAATT
ACTACACGAGATGAGGTTATTGAAAGTATAAGCGAACAACTAAgaTTTGC
ATCAAGCTCCCCAACATTAGTGGAAAAAGCACCAGACATCGAAGAAGCGG
AAGAGCGGGAACTCTATATACTCAAGctCAGTCGAATGATAAAAAGCTTG
AATGAAAAAGTTGACGAATTGACAACTACGATACGtgaaaatgaaCGAAC
TCTTGAAGAGTACGAGCAAAAGGAGAGAGTCTTGAAAGAAATGATTCATG
CTAAAGATAATTCAATCATCGCCTTGACGAACCAGGTATTTTCTTTGGAA
GAGAAAGAAACAACAGACGTCGCTCAAGATGTATTGATAGCTTTTGAAGA
GAAACCGTCAGAAATGACTGATAGCAATTCATCGCCTATTGAACTAGACT
ACGACCAACTAAAGGAGGCTTGTTCAGCTTACCAagctcaaaacaatttt
ttgaacaGTGAAATATTGGAGTTACACAAACTACGTACATTGGATGCTGA
AAAGATATTGAATGCAAATGATAACCTTGAGATGAAAGAAGCGGAGGTGA
TCAAAATCAGAAGTCGATATTTATGGTTACTTAAAGATTGTGCTGGACCT
AAACGAGaaacgAACATGGAGTCAGACGGAGTGCTGGAGAAATTAATCGA
TGAAGCCATCAACGAAAAAGCTGACTCAACAACTGAAAAGAAAAGCCCTA
CTGAGATAAGGTTTGCAGACAAGTATGGATTTTATGATCAAATCGAGAAA
TCTGACGAGAACGCTTTAGAATCACTTGCTGACCATTTCGAATcactcag
tggggataaagagCTCGGTTCATTAGAAGTTTCACACGGTGTGAAATGGG
AAAATTATTTGGTAGCACAAGGTACCGCACCACTACAGAAAACGGAGGAA
CTCAAAGCACTCGTCCGAAGTGGTATCCCACACGAATTCCGTGCGCGCGT
CTGGGGCGATCTCGTCCGCCTGCGTAGTGATCACGAGCGGACGATTGCTG
GGCAAGGCTACTATGCTAACTTAttgaaagagaagaaaggagcTTACTCC
CCGTCTGCCAAACAGATTGAATTGGACTTGTTGAGAACGTTACCGAACAA
CAAATATTATGATACGCTTGAATCTGAGGGGatttcaaaactACGACGCA
TTTTGACAGCGTACAGTTGGCATAACCCAGCTGTTGGATACTGTCAAGGA
TTAAATCGTTTGGGAGCCATCGCACTGTTGTATTTAGATGAAGAAACAGC
TTTCTGgTGTCTTGTAGCGATCACTGAACATCTAATGCCAATTGATTATT
ACAGCAGAACACTGCTCGGTGCGCAAATCGATCAAAAAGTATTTCGTGAC
TTGTTGGACGAAAAATGTCCGAAACTGAGTGCTCATCTTGTCTCCTTGCA
GTTCGACATATCGTTGGTATCATTCAATTGGTTCCTGACTGTTTTTGTTG
ATCTCTTTCCGATTGAGTTGACGTTAAGAGTGTGGGATACATTTCTCTTC
GAAGGTAGCAAGGTTTTATTCCGGTACGCATTGTCCGTCTTCAAACTTTT
CGAAGAAGAATTCCTACGCTTTAAAGATCCTGGACCGATGTTCAACTTTT
TCCGAAATCTACCCAAAAAGAAATTCAACATTCAAAAGATTTGTTACATA
GCTTTCAACACGATGAACCCCTTTAGTCGTCGTAATGTGGAATCGAAAAG
GAAATTCTACAGACCTATTCTTCAAGCACAACTTGACGAGTTTGAAATTA
TGCGTGAGGAATACAAGGAGAAACGGGAAGACAGTATTTCTATTCACGAT
GAAGAACCAATCAGTGACGACGAGAACTAAATGACTTCAAAAAAGGAAGT
CCAAGATCCTTGGGAAATACTAGAGGTTCCAGCTGTGATAAATTTCTCTT
CAAAATCCAATGAAGATGAGGGAGAAGAGaatgatttttctcaaaacaac
agcaaaacaaaaaaGGACAACAAAGAAAGGTTGTGTGGCTACTTGAATAA
AATGGGAGcCGGTATCATCAAAGGTTGGAAGAAAAGATGGTTTGTTTATG
ATCCACGTAGATGTCTACTTTTCTATTATCGTAGACCCCAAGACACTGAA
CCATTAGGGACTATAGATATAGCAAGTGCCACATTTTCCTACAACCCAAA
TGTAAAGGCCTTGTTTTCAATAAGTTCTGGAGACAGATTGTATCAACTTG
AGGCACCTGACAACAACGCCATGATGTTTTGGTTACAAGAACTGCAAGCC
AAAAGAcgagaattttcaaaacttgtAGAAGCAAATGCAGGCAATAATAG
ACCAACAAGTGGTTTGCTTTCTGATCCGATAGATGCTCCACAAGGAGGTG
ATGATGAAGCTGATGGTTTCAATAAAATAATTGAAAGACCTCACAATGTT
GGTGAGAAGACTGCTCTCGATTCTAAAGGAAATTTTTCATTCACACACTT
GaacaaagaattcaaaaattGGAGaaaatcaaccttttacacagaaactg
gggaggcaattttaaATGAGAAATCAGCTGCTTCTACGCCAGAACAAGAA
AAGAAAAGTCCTAACATGCAAAGAAGAGAAGATGATACAAAAATTCTAGA
AAGTGGAAACAAACGAAGaGTCGATTTTGGTTTCTCAAAGATGGTAGCAA
ATCTGAGGAATACAAATATGCCAGTGATTAGCTCCCCTcaaccaaacaac
aacaacataaaTCAATGCCGAGATTGTATGGAGaaattgaatatggTCAA
AACTCTCCAAGAAGCAATTTCAATGGCCGAAAAGGAAATTACTACACGAG
ATGAGGTTATTGAAAGTATAAGCGAACAACTAAgaTTTGCATCAAGCTCC
CCAACATTAGTGGAAAAAGCACCAGACATCGAAGAAGCGGAAGAGCGGGA
ACTCTATATACTCAAGctCAGTCGAATGATAAAAAGCTTGAATGAAAAAG
TTGACGAATTGACAACTACGATACGtgaaaatgaaCGAACTCTTGAAGAG
TACGAGCAAAAGGAGAGAGTCTTGAAAGAAATGATTCATGCTAAAGATAA
TTCAATCATCGCCTTGACGAACCAGGTATTTTCTTTGGAAGAGAAAGAAA
CAACAGACGTCGCTCAAGATGTATTGATAGCTTTTGAAGAGAAACCGTCA
GAAATGACTGATAGCAATTCATCGCCTATTGAACTAGACTACGACCAACT
AAAGGAGGCTTGTTCAGCTTACCAagctcaaaacaattttttgaacaGTG
AAATATTGGAGTTACACAAACTACGTACATTGGATGCTGAAAAGATATTG
AATGCAAATGATAACCTTGAGATGAAAGAAGCGGAGGTGATCAAAATCAG
AAGTCGATATTTATGGTTACTTAAAGATTGTGCTGGACCTAAACGAGaaa
cgAACATGGAGTCAGACGGAGTGCTGGAGAAATTAATCGATGAAGCCATC
AACGAAAAAGCTGACTCAACAACTGAAAAGAAAAGCCCTACTGAGATAAG
GTTTGCAGACAAGTATGGATTTTATGATCAAATCGAGAAATCTGACGAGA
ACGCTTTAGAATCACTTGCTGACCATTTCGAATcactcagtggggataaa
gagCTCGGTTCATTAGAAGTTTCACACGGTGTGAAATGGGAAAATTATTT
GGTAGCACAAGGTACCGCACCACTACAGAAAACGGAGGAACTCAAAGCAC
TCGTCCGAAGTGGTATCCCACACGAATTCCGTGCGCGCGTCTGGGGCGAT
CTCGTCCGCCTGCGTAGTGATCACGAGCGGACGATTGCTGGGCAAGGCTA
CTATGCTAACTTAttgaaagagaagaaaggagcTTACTCCCCGTCTGCCA
AACAGATTGAATTGGACTTGTTGAGAACGTTACCGAACAACAAATATTAT
GATACGCTTGAATCTGAGGGGatttcaaaactACGACGCATTTTGACAGC
GTACAGTTGGCATAACCCAGCTGTTGGATACTGTCAAGGATTAAATCGTT
TGGGAGCCATCGCACTGTTGTATTTAGATGAAGAAACAGCTTTCTGgTGT
CTTGTAGCGATCACTGAACATCTAATGCCAATTGATTATTACAGCAGAAC
ACTGCTCGGTGCGCAAATCGATCAAAAAGTATTTCGTGACTTGTTGGACG
AAAAATGTCCGAAACTGAGTGCTCATCTTGTCTCCTTGCAGTTCGACATA
TCGTTGGTATCATTCAATTGGTTCCTGACTGTTTTTGTTGATCTCTTTCC
GATTGAGTTGACGTTAAGAGTGTGGGATACATTTCTCTTCGAAGGTAGCA
AGGTTTTATTCCGGTACGCATTGTCCGTCTTCAAACTTTTCGAAGAAGAA
TTCCTACGCTTTAAAGATCCTGGACCGATGTTCAACTTTTTCCGAAATCT
ACCCAAAAAGAAATTCAACATTCAAAAGATTTGTTACATAGCTTTCAACA
CGATGAACCCCTTTAGTCGTCGTAATGTGGAATCGAAAAGGAAATTCTAC
AGACCTATTCTTCAAGCACAACTTGACGAGTTTGAAATTATGCGTGAGGA
ATACAAGGAGAAACGGGAAGACAGTATTTCTATTCACGATGAAGAACCAA
TCAGTGACGACGAGAACTAAATGACTTCAAAAAAGGAAGTCCAAGATCCT
TGGGAAATACTAGAGGTTCCAGCTGTGATAAATTTCTCTTCAAAATCCAA
TGAAGATGAGGGAGAAGAGaatgatttttctcaaaacaacagcaaaacaa
aaaaGGACAACAAAGAAAGGTTGTGTGGCTACTTGAATAAAATGGGAGcC
GGTATCATCAAAGGTTGGAAGAAAAGATGGTTTGTTTATGATCCACGTAG
ATGTCTACTTTTCTATTATCGTAGACCCCAAGACACTGAACCATTAGGGA
CTATAGATATAGCAAGTGCCACATTTTCCTACAACCCAAATGTAAAGGCC
TTGTTTTCAATAAGTTCTGGAGACAGATTGTATCAACTTGAGGCACCTGA
CAACAACGCCATGATGTTTTGGTTACAAGAACTGCAAGCCAAAAGAcgag
aattttcaaaacttgtAGAAGCAAATGCAGGCAATAATAGACCAACAAGT
GGTTTGCTTTCTGATCCGATAGATGCTCCACAAGGAGGTGATGATGAAGC
TGATGGTTTCAATAAAATAATTGAAAGACCTCACAATGTTGGTGAGAAGA
CTGCTCTCGATTCTAAAGGAAATTTTTCATTCACACACTTGaacaaagaa
ttcaaaaattGGAGaaaatcaaccttttacacagaaactggggaggcaat
tttaaATGAGAAATCAGCTGCTTCTACGCCAGAACAAGAAAAGAAAAGTC
CTAACATGCAAAGAAGAGAAGATGATACAAAAATTCTAGAAAGTGGAAAC
AAACGAAGaGTCGATTTTGGTTTCTCAAAGATGGTAGCAAATCTGAGGAA
TACAAATATGCCAGTGATTAGCTCCCCTcaaccaaacaacaacaacataa
aTCAATGCCGAGATTGTATGGAGaaattgaatatggTCAAAACTCTCCAA
GAAGCAATTTCAATGGCCGAAAAGGAAATTACTACACGAGATGAGGTTAT
TGAAAGTATAAGCGAACAACTAAgaTTTGCATCAAGCTCCCCAACATTAG
TGGAAAAAGCACCAGACATCGAAGAAGCGGAAGAGCGGGAACTCTATATA
CTCAAGctCAGTCGAATGATAAAAAGCTTGAATGAAAAAGTTGACGAATT
GACAACTACGATACGtgaaaatgaaCGAACTCTTGAAGAGTACGAGCAAA
AGGAGAGAGTCTTGAAAGAAATGATTCATGCTAAAGATAATTCAATCATC
GCCTTGACGAACCAGGTATTTTCTTTGGAAGAGAAAGAAACAACAGACGT
CGCTCAAGATGTATTGATAGCTTTTGAAGAGAAACCGTCAGAAATGACTG
ATAGCAATTCATCGCCTATTGAACTAGACTACGACCAACTAAAGGAGGCT
TGTTCAGCTTACCAagctcaaaacaattttttgaacaGTGAAATATTGGA
GTTACACAAACTACGTACATTGGATGCTGAAAAGATATTGAATGCAAATG
ATAACCTTGAGATGAAAGAAGCGGAGGTGATCAAAATCAGAAGTCGATAT
TTATGGTTACTTAAAGATTGTGCTGGACCTAAACGAGaaacgAACATGGA
GTCAGACGGAGTGCTGGAGAAATTAATCGATGAAGCCATCAACGAAAAAG
CTGACTCAACAACTGAAAAGAAAAGCCCTACTGAGATAAGGTTTGCAGAC
AAGTATGGATTTTATGATCAAATCGAGAAATCTGACGAGAACGCTTTAGA
ATCACTTGCTGACCATTTCGAATcactcagtggggataaagagCTCGGTT
CATTAGAAGTTTCACACGGTGTGAAATGGGAAAATTATTTGGTAGCACAA
GGTACCGCACCACTACAGAAAACGGAGGAACTCAAAGCACTCGTCCGAAG
TGGTATCCCACACGAATTCCGTGCGCGCGTCTGGGGCGATCTCGTCCGCC
TGCGTAGTGATCACGAGCGGACGATTGCTGGGCAAGGCTACTATGCTAAC
TTAttgaaagagaagaaaggagcTTACTCCCCGTCTGCCAAACAGATTGA
ATTGGACTTGTTGAGAACGTTACCGAACAACAAATATTATGATACGCTTG
AATCTGAGGGGatttcaaaactACGACGCATTTTGACAGCGTACAGTTGG
CATAACCCAGCTGTTGGATACTGTCAAGGATTAAATCGTTTGGGAGCCAT
CGCACTGTTGTATTTAGATGAAGAAACAGCTTTCTGgTGTCTTGTAGCGA
TCACTGAACATCTAATGCCAATTGATTATTACAGCAGAACACTGCTCGGT
GCGCAAATCGATCAAAAAGTATTTCGTGACTTGTTGGACGAAAAATGTCC
GAAACTGAGTGCTCATCTTGTCTCCTTGCAGTTCGACATATCGTTGGTAT
CATTCAATTGGTTCCTGACTGTTTTTGTTGATCTCTTTCCGATTGAGTTG
ACGTTAAGAGTGTGGGATACATTTCTCTTCGAAGGTAGCAAGGTTTTATT
CCGGTACGCATTGTCCGTCTTCAAACTTTTCGAAGAAGAATTCCTACGCT
TTAAAGATCCTGGACCGATGTTCAACTTTTTCCGAAATCTACCCAAAAAG
AAATTCAACATTCAAAAGATTTGTTACATAGCTTTCAACACGATGAACCC
CTTTAGTCGTCGTAATGTGGAATCGAAAAGGAAATTCTACAGACCTATTC
TTCAAGCACAACTTGACGAGTTTGAAATTATGCGTGAGGAATACAAGGAG
AAACGGGAAGACAGTATTTCTATTCACGATGAAGAACCAATCAGTGACGA
CGAGAACTAA
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_045740XLOC_045740Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073659-exon-scaffold_97-1491911889:393681..393906TCONS_00073659-exon-scaffold_97-1491911889:393681..393906Clytia hemisphaericaexon
TCONS_00073659-exon-scaffold_97-1510915933:393681..393906TCONS_00073659-exon-scaffold_97-1510915933:393681..393906Clytia hemisphaericaexon
TCONS_00073659-exon-scaffold_97-1575043694:393681..393906TCONS_00073659-exon-scaffold_97-1575043694:393681..393906Clytia hemisphaericaexon
TCONS_00073659-exon-scaffold_97-1491911889:397915..397957TCONS_00073659-exon-scaffold_97-1491911889:397915..397957Clytia hemisphaericaexon
TCONS_00073659-exon-scaffold_97-1510915933:397915..397957TCONS_00073659-exon-scaffold_97-1510915933:397915..397957Clytia hemisphaericaexon
TCONS_00073659-exon-scaffold_97-1575043694:397915..397957TCONS_00073659-exon-scaffold_97-1575043694:397915..397957Clytia hemisphaericaexon
TCONS_00073659-exon-scaffold_97-1491911889:399187..399217TCONS_00073659-exon-scaffold_97-1491911889:399187..399217Clytia hemisphaericaexon
TCONS_00073659-exon-scaffold_97-1510915933:399187..399217TCONS_00073659-exon-scaffold_97-1510915933:399187..399217Clytia hemisphaericaexon
TCONS_00073659-exon-scaffold_97-1575043694:399187..399217TCONS_00073659-exon-scaffold_97-1575043694:399187..399217Clytia hemisphaericaexon
TCONS_00073659-exon-scaffold_97-1491911889:399496..399564TCONS_00073659-exon-scaffold_97-1491911889:399496..399564Clytia hemisphaericaexon
TCONS_00073659-exon-scaffold_97-1510915933:399496..399564TCONS_00073659-exon-scaffold_97-1510915933:399496..399564Clytia hemisphaericaexon
TCONS_00073659-exon-scaffold_97-1575043694:399496..399564TCONS_00073659-exon-scaffold_97-1575043694:399496..399564Clytia hemisphaericaexon
TCONS_00073659-exon-scaffold_97-1491911889:402614..402679TCONS_00073659-exon-scaffold_97-1491911889:402614..402679Clytia hemisphaericaexon
TCONS_00073659-exon-scaffold_97-1510915933:402614..402679TCONS_00073659-exon-scaffold_97-1510915933:402614..402679Clytia hemisphaericaexon
TCONS_00073659-exon-scaffold_97-1575043694:402614..402679TCONS_00073659-exon-scaffold_97-1575043694:402614..402679Clytia hemisphaericaexon
TCONS_00073659-exon-scaffold_97-1491911889:403685..403808TCONS_00073659-exon-scaffold_97-1491911889:403685..403808Clytia hemisphaericaexon
TCONS_00073659-exon-scaffold_97-1510915933:403685..403808TCONS_00073659-exon-scaffold_97-1510915933:403685..403808Clytia hemisphaericaexon
TCONS_00073659-exon-scaffold_97-1575043694:403685..403808TCONS_00073659-exon-scaffold_97-1575043694:403685..403808Clytia hemisphaericaexon
TCONS_00073659-exon-scaffold_97-1491911889:406052..406106TCONS_00073659-exon-scaffold_97-1491911889:406052..406106Clytia hemisphaericaexon
TCONS_00073659-exon-scaffold_97-1510915933:406052..406106TCONS_00073659-exon-scaffold_97-1510915933:406052..406106Clytia hemisphaericaexon
TCONS_00073659-exon-scaffold_97-1575043694:406052..406106TCONS_00073659-exon-scaffold_97-1575043694:406052..406106Clytia hemisphaericaexon
TCONS_00073659-exon-scaffold_97-1491911889:407100..407220TCONS_00073659-exon-scaffold_97-1491911889:407100..407220Clytia hemisphaericaexon
TCONS_00073659-exon-scaffold_97-1510915933:407100..407220TCONS_00073659-exon-scaffold_97-1510915933:407100..407220Clytia hemisphaericaexon
TCONS_00073659-exon-scaffold_97-1575043694:407100..407220TCONS_00073659-exon-scaffold_97-1575043694:407100..407220Clytia hemisphaericaexon
TCONS_00073659-exon-scaffold_97-1491911889:407494..407562TCONS_00073659-exon-scaffold_97-1491911889:407494..407562Clytia hemisphaericaexon
TCONS_00073659-exon-scaffold_97-1510915933:407494..407562TCONS_00073659-exon-scaffold_97-1510915933:407494..407562Clytia hemisphaericaexon
TCONS_00073659-exon-scaffold_97-1575043694:407494..407562TCONS_00073659-exon-scaffold_97-1575043694:407494..407562Clytia hemisphaericaexon
TCONS_00073659-exon-scaffold_97-1491911889:408756..408793TCONS_00073659-exon-scaffold_97-1491911889:408756..408793Clytia hemisphaericaexon
TCONS_00073659-exon-scaffold_97-1510915933:408756..408793TCONS_00073659-exon-scaffold_97-1510915933:408756..408793Clytia hemisphaericaexon
TCONS_00073659-exon-scaffold_97-1575043694:408756..408793TCONS_00073659-exon-scaffold_97-1575043694:408756..408793Clytia hemisphaericaexon
TCONS_00073659-exon-scaffold_97-1491911889:409232..409268TCONS_00073659-exon-scaffold_97-1491911889:409232..409268Clytia hemisphaericaexon
TCONS_00073659-exon-scaffold_97-1510915933:409232..409268TCONS_00073659-exon-scaffold_97-1510915933:409232..409268Clytia hemisphaericaexon
TCONS_00073659-exon-scaffold_97-1575043694:409232..409268TCONS_00073659-exon-scaffold_97-1575043694:409232..409268Clytia hemisphaericaexon
TCONS_00073659-exon-scaffold_97-1491911889:409677..409715TCONS_00073659-exon-scaffold_97-1491911889:409677..409715Clytia hemisphaericaexon
TCONS_00073659-exon-scaffold_97-1510915933:409677..409715TCONS_00073659-exon-scaffold_97-1510915933:409677..409715Clytia hemisphaericaexon
TCONS_00073659-exon-scaffold_97-1575043694:409677..409715TCONS_00073659-exon-scaffold_97-1575043694:409677..409715Clytia hemisphaericaexon
TCONS_00073659-exon-scaffold_97-1491911889:410254..410329TCONS_00073659-exon-scaffold_97-1491911889:410254..410329Clytia hemisphaericaexon
TCONS_00073659-exon-scaffold_97-1510915933:410254..410329TCONS_00073659-exon-scaffold_97-1510915933:410254..410329Clytia hemisphaericaexon
TCONS_00073659-exon-scaffold_97-1575043694:410254..410329TCONS_00073659-exon-scaffold_97-1575043694:410254..410329Clytia hemisphaericaexon
TCONS_00073659-exon-scaffold_97-1491911889:410953..411002TCONS_00073659-exon-scaffold_97-1491911889:410953..411002Clytia hemisphaericaexon
TCONS_00073659-exon-scaffold_97-1510915933:410953..411002TCONS_00073659-exon-scaffold_97-1510915933:410953..411002Clytia hemisphaericaexon
TCONS_00073659-exon-scaffold_97-1575043694:410953..411002TCONS_00073659-exon-scaffold_97-1575043694:410953..411002Clytia hemisphaericaexon
TCONS_00073659-exon-scaffold_97-1491911889:411782..411832TCONS_00073659-exon-scaffold_97-1491911889:411782..411832Clytia hemisphaericaexon
TCONS_00073659-exon-scaffold_97-1510915933:411782..411832TCONS_00073659-exon-scaffold_97-1510915933:411782..411832Clytia hemisphaericaexon
TCONS_00073659-exon-scaffold_97-1575043694:411782..411832TCONS_00073659-exon-scaffold_97-1575043694:411782..411832Clytia hemisphaericaexon
TCONS_00073659-exon-scaffold_97-1491911889:412149..412184TCONS_00073659-exon-scaffold_97-1491911889:412149..412184Clytia hemisphaericaexon
TCONS_00073659-exon-scaffold_97-1510915933:412149..412184TCONS_00073659-exon-scaffold_97-1510915933:412149..412184Clytia hemisphaericaexon
TCONS_00073659-exon-scaffold_97-1575043694:412149..412184TCONS_00073659-exon-scaffold_97-1575043694:412149..412184Clytia hemisphaericaexon
TCONS_00073659-exon-scaffold_97-1491911889:415830..415875TCONS_00073659-exon-scaffold_97-1491911889:415830..415875Clytia hemisphaericaexon
TCONS_00073659-exon-scaffold_97-1510915933:415830..415875TCONS_00073659-exon-scaffold_97-1510915933:415830..415875Clytia hemisphaericaexon
TCONS_00073659-exon-scaffold_97-1575043694:415830..415875TCONS_00073659-exon-scaffold_97-1575043694:415830..415875Clytia hemisphaericaexon
TCONS_00073659-exon-scaffold_97-1491911889:417031..417089TCONS_00073659-exon-scaffold_97-1491911889:417031..417089Clytia hemisphaericaexon
TCONS_00073659-exon-scaffold_97-1510915933:417031..417089TCONS_00073659-exon-scaffold_97-1510915933:417031..417089Clytia hemisphaericaexon
TCONS_00073659-exon-scaffold_97-1575043694:417031..417089TCONS_00073659-exon-scaffold_97-1575043694:417031..417089Clytia hemisphaericaexon
TCONS_00073659-exon-scaffold_97-1491911889:417656..417755TCONS_00073659-exon-scaffold_97-1491911889:417656..417755Clytia hemisphaericaexon
TCONS_00073659-exon-scaffold_97-1510915933:417656..417755TCONS_00073659-exon-scaffold_97-1510915933:417656..417755Clytia hemisphaericaexon
TCONS_00073659-exon-scaffold_97-1575043694:417656..417755TCONS_00073659-exon-scaffold_97-1575043694:417656..417755Clytia hemisphaericaexon
TCONS_00073659-exon-scaffold_97-1491911889:422376..422452TCONS_00073659-exon-scaffold_97-1491911889:422376..422452Clytia hemisphaericaexon
TCONS_00073659-exon-scaffold_97-1510915933:422376..422452TCONS_00073659-exon-scaffold_97-1510915933:422376..422452Clytia hemisphaericaexon
TCONS_00073659-exon-scaffold_97-1575043694:422376..422452TCONS_00073659-exon-scaffold_97-1575043694:422376..422452Clytia hemisphaericaexon
TCONS_00073659-exon-scaffold_97-1491911889:422920..422971TCONS_00073659-exon-scaffold_97-1491911889:422920..422971Clytia hemisphaericaexon
TCONS_00073659-exon-scaffold_97-1510915933:422920..422971TCONS_00073659-exon-scaffold_97-1510915933:422920..422971Clytia hemisphaericaexon
TCONS_00073659-exon-scaffold_97-1575043694:422920..422971TCONS_00073659-exon-scaffold_97-1575043694:422920..422971Clytia hemisphaericaexon
TCONS_00073659-exon-scaffold_97-1491911889:425038..425144TCONS_00073659-exon-scaffold_97-1491911889:425038..425144Clytia hemisphaericaexon
TCONS_00073659-exon-scaffold_97-1510915933:425038..425144TCONS_00073659-exon-scaffold_97-1510915933:425038..425144Clytia hemisphaericaexon
TCONS_00073659-exon-scaffold_97-1575043694:425038..425144TCONS_00073659-exon-scaffold_97-1575043694:425038..425144Clytia hemisphaericaexon
TCONS_00073659-exon-scaffold_97-1491911889:427744..427829TCONS_00073659-exon-scaffold_97-1491911889:427744..427829Clytia hemisphaericaexon
TCONS_00073659-exon-scaffold_97-1510915933:427744..427829TCONS_00073659-exon-scaffold_97-1510915933:427744..427829Clytia hemisphaericaexon
TCONS_00073659-exon-scaffold_97-1575043694:427744..427829TCONS_00073659-exon-scaffold_97-1575043694:427744..427829Clytia hemisphaericaexon
TCONS_00073659-exon-scaffold_97-1491911889:449516..449618TCONS_00073659-exon-scaffold_97-1491911889:449516..449618Clytia hemisphaericaexon
TCONS_00073659-exon-scaffold_97-1510915933:449516..449618TCONS_00073659-exon-scaffold_97-1510915933:449516..449618Clytia hemisphaericaexon
TCONS_00073659-exon-scaffold_97-1575043694:449516..449618TCONS_00073659-exon-scaffold_97-1575043694:449516..449618Clytia hemisphaericaexon
TCONS_00073659-exon-scaffold_97-1491911889:463136..463238TCONS_00073659-exon-scaffold_97-1491911889:463136..463238Clytia hemisphaericaexon
TCONS_00073659-exon-scaffold_97-1510915933:463136..463238TCONS_00073659-exon-scaffold_97-1510915933:463136..463238Clytia hemisphaericaexon
TCONS_00073659-exon-scaffold_97-1575043694:463136..463238TCONS_00073659-exon-scaffold_97-1575043694:463136..463238Clytia hemisphaericaexon
TCONS_00073659-exon-scaffold_97-1491911889:463784..463864TCONS_00073659-exon-scaffold_97-1491911889:463784..463864Clytia hemisphaericaexon
TCONS_00073659-exon-scaffold_97-1510915933:463784..463864TCONS_00073659-exon-scaffold_97-1510915933:463784..463864Clytia hemisphaericaexon
TCONS_00073659-exon-scaffold_97-1575043694:463784..463864TCONS_00073659-exon-scaffold_97-1575043694:463784..463864Clytia hemisphaericaexon
TCONS_00073659-exon-scaffold_97-1491911889:465482..465718TCONS_00073659-exon-scaffold_97-1491911889:465482..465718Clytia hemisphaericaexon
TCONS_00073659-exon-scaffold_97-1510915933:465482..465718TCONS_00073659-exon-scaffold_97-1510915933:465482..465718Clytia hemisphaericaexon
TCONS_00073659-exon-scaffold_97-1575043694:465482..465718TCONS_00073659-exon-scaffold_97-1575043694:465482..465718Clytia hemisphaericaexon
TCONS_00073659-exon-scaffold_97-1491911889:466073..466197TCONS_00073659-exon-scaffold_97-1491911889:466073..466197Clytia hemisphaericaexon
TCONS_00073659-exon-scaffold_97-1510915933:466073..466197TCONS_00073659-exon-scaffold_97-1510915933:466073..466197Clytia hemisphaericaexon
TCONS_00073659-exon-scaffold_97-1575043694:466073..466197TCONS_00073659-exon-scaffold_97-1575043694:466073..466197Clytia hemisphaericaexon
TCONS_00073659-exon-scaffold_97-1491911889:466708..466786TCONS_00073659-exon-scaffold_97-1491911889:466708..466786Clytia hemisphaericaexon
TCONS_00073659-exon-scaffold_97-1510915933:466708..466786TCONS_00073659-exon-scaffold_97-1510915933:466708..466786Clytia hemisphaericaexon
TCONS_00073659-exon-scaffold_97-1575043694:466708..466786TCONS_00073659-exon-scaffold_97-1575043694:466708..466786Clytia hemisphaericaexon
TCONS_00073659-exon-scaffold_97-1491911889:467087..467151TCONS_00073659-exon-scaffold_97-1491911889:467087..467151Clytia hemisphaericaexon
TCONS_00073659-exon-scaffold_97-1510915933:467087..467151TCONS_00073659-exon-scaffold_97-1510915933:467087..467151Clytia hemisphaericaexon
TCONS_00073659-exon-scaffold_97-1575043694:467087..467151TCONS_00073659-exon-scaffold_97-1575043694:467087..467151Clytia hemisphaericaexon
TCONS_00073659-exon-scaffold_97-1491911889:467953..468019TCONS_00073659-exon-scaffold_97-1491911889:467953..468019Clytia hemisphaericaexon
TCONS_00073659-exon-scaffold_97-1510915933:467953..468019TCONS_00073659-exon-scaffold_97-1510915933:467953..468019Clytia hemisphaericaexon
TCONS_00073659-exon-scaffold_97-1575043694:467953..468019TCONS_00073659-exon-scaffold_97-1575043694:467953..468019Clytia hemisphaericaexon
TCONS_00073659-exon-scaffold_97-1491911889:470156..470200TCONS_00073659-exon-scaffold_97-1491911889:470156..470200Clytia hemisphaericaexon
TCONS_00073659-exon-scaffold_97-1510915933:470156..470200TCONS_00073659-exon-scaffold_97-1510915933:470156..470200Clytia hemisphaericaexon
TCONS_00073659-exon-scaffold_97-1575043694:470156..470200TCONS_00073659-exon-scaffold_97-1575043694:470156..470200Clytia hemisphaericaexon
TCONS_00073659-exon-scaffold_97-1491911889:471362..471574TCONS_00073659-exon-scaffold_97-1491911889:471362..471574Clytia hemisphaericaexon
TCONS_00073659-exon-scaffold_97-1510915933:471362..471574TCONS_00073659-exon-scaffold_97-1510915933:471362..471574Clytia hemisphaericaexon
TCONS_00073659-exon-scaffold_97-1575043694:471362..471574TCONS_00073659-exon-scaffold_97-1575043694:471362..471574Clytia hemisphaericaexon
TCONS_00073659-exon-scaffold_97-1491911889:472084..474055TCONS_00073659-exon-scaffold_97-1491911889:472084..474055Clytia hemisphaericaexon
TCONS_00073659-exon-scaffold_97-1510915933:472084..474055TCONS_00073659-exon-scaffold_97-1510915933:472084..474055Clytia hemisphaericaexon
TCONS_00073659-exon-scaffold_97-1575043694:472084..474055TCONS_00073659-exon-scaffold_97-1575043694:472084..474055Clytia hemisphaericaexon
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073659-proteinTCONS_00073659-proteinClytia hemisphaericapolypeptide
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_97supercontigscaffold_97:393681..474055 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
1.12734 0 1.29524 0.889745 3.1519 1.67739 3.5808 3.45032 3.36389 1.91289 1.54778 2.8886 4.10737 3.17478 3.77684 3.85945 1.75049 2.68643 3.74104 4.65864 2.95913 3.31751 2.7603 3.12581 4.28715 2.69078 1.07291 1.51566 1.67762 1.74272
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR000195Rab-GTPase-TBC_dom
IPR001849PH_domain
IPR011993PH_dom-like
Blast
BLAST of TCONS_00073659 vs. Swiss-Prot (Human)
Match: TBD2B (TBC1 domain family member 2B OS=Homo sapiens GN=TBC1D2B PE=1 SV=2)

HSP 1 Score: 430.254 bits (1105), Expect = 3.442e-129
Identity = 319/968 (32.95%), Postives = 493/968 (50.93%), Query Frame = 2
Query:  239 RLCGYLNKM-GAGIIKGWKKRWFVYDPRRCLLFYYRRPQDTEPLGTIDIASATFSYN-------PNVK--ALFSISSGDRLYQLEAPDNNAMMFWLQELQAKRREFSKLVEANAGNNR--PTSGLLSDPIDAPQGGDDEADGFNKIIERPHNV-----------GEKTA-------LDSKGNFSFTHLNKEFKNW-------------RKSTFYT------------ETGEAILNEKSAASTPEQEKKSPNMQRREDDTKILESGNKRRVDFG---------FSKMVANLRNTNMPV-XXXXXXXXXXXXXCRDCMEKLNM-VKTLQEAISMAEKEITTRDEVIESISEQLRFAS-----SSPTLVEKAPD--IEEAEERELYILKLSRMIKSLNEKVDELTTTIRENERTLEEYEQKERVLKEMIHAKDNSIIALTNQVFSLEEKETTDVAQDVLIAFEEKPSEMTDSNSSPIELDYDQLKEACSAYQAQNNFLNSEILELHKLRTLDAEKILNANDNLEMKEAEVIKIRSRYLWLLKD-----CA---GPKRETNMESDGVLEKLIDEAINEKADSTTEKK--SPTEIRFADKYGFYDQIEKSDENALESLADHFESLSGDKELGSL------EVSHGVKWENYLVAQGTAPLQKTEELKALVRSGIPHEFRARVWGDLVRLRSDHERTIAGQGYYANLLKEKKGAYSPSAKQIELDLLRTLPNNKYYDTLESEGISKLRRILTAYSWHNPAVGYCQGLNRLGAIALLYLDEETAFWCLVAITEHLMPIDYYSRTLLGAQIDQKVFRDLLDEKCPKLSAHLVSLQFDISLVSFNWFLTVFVDLFPIELTLRVWDTFLFEGSKVLFRYALSVXXXXXXXXXXXXDPGPMFNFFRNLPKKKFNIQKICYIAFNTMNPFSRRNVESKRKFYRPILQAQLDEFEIMREEYKEKREDSISIHDEEPISDDE 2875
            RLCGYL K+ G G ++G++ RWFV+D RRC L+Y++ PQD  PLG +DIA A FSY        P  +  A F + S   +  L+AP+   M +WLQELQ KR E+   ++    ++R  PT G     + A    D      N   E+  NV           GE+ A        +S   +S      E KN              R++ FYT            +  E+I+ E+    TPE  K                +G+    DFG            ++ + +N +     SS   + +     R    ++ + V++ QE +   +K+++++ E++  + + +R +      +S  L E  P   +E   +++  IL L+  ++  + + + L   +R  +  + E  ++  +L E I AKD  II L+       E E       V       PS  +    +  +L+ D+LK+    Y+ QN FLN EILEL  LR     +  +        EA++ +I S+YL LL++     C+   GP RE       V+ +L+++A+  ++    E+    P  +   D YGF    E  +E   E L     +L    +L +L      EVS GVKWENY  +     +  + ELK L+R+GIPHE R++VW   V   +   +     G++  LL++     +P++KQIELDLLRTLPNNK+Y    SEGI KLR +L A+SW NP +GYCQGLNRL A+ALLYL++E AFWCLV I E  MP DYY++TLLG+Q+DQ+VFRDL+ EK P+L  H    + D +L++FNWFL VFVD    ++  ++WD+FL+EG KV+FR+AL++FK  EEE L+ +D   +F + R   +   + +K+  I+F  +NPF  R + ++R ++   ++ +L E E +RE++   RE   S    E +SD+E
Sbjct:   36 RLCGYLQKLSGKGPLRGYRSRWFVFDARRCYLYYFKSPQDALPLGHLDIADACFSYQGPDEAAEPGTEPPAHFQVHSAGAVTVLKAPNRQLMTYWLQELQQKRWEYCNSLDMVKWDSRTSPTPGDFPKGLVARDNTDLIYPHPNASAEKARNVLAVETVPGELVGEQAANQPAPGHPNSINFYSLKQWGNELKNSMSSFRPGRGHNDSRRTVFYTNEEWELLDPTPKDLEESIVQEEKKKLTPEGNKGV--------------TGSGFPFDFGRNPYKGKRPLKDIIGSYKNRHSSGDPSSEGTSGSGSVSIRKPASEMQLQVQSQQEELEQLKKDLSSQKELVRLLQQTVRSSQYDKYFTSSRLCEGVPKDTLELLHQKDDQILGLTSQLERFSLEKESLQQEVRTLKSKVGELNEQLGMLMETIQAKDEVIIKLS-------EGEGNGPPPTV------APSSPSVVPVARDQLELDRLKDNLQGYKTQNKFLNKEILELSALRRNAERRERDLMAKYSSLEAKLCQIESKYLILLQEMKTPVCSEDQGPTRE-------VIAQLLEDALQVESQEQPEQAFVKPHLVSEYDIYGFRTVPEDDEE---EKLVAKVRAL----DLKTLYLTENQEVSTGVKWENYFASTVNREMMCSPELKNLIRAGIPHEHRSKVWKWCVDRHTRKFKDNTEPGHFQTLLQKALEKQNPASKQIELDLLRTLPNNKHYSCPTSEGIQKLRNVLLAFSWRNPDIGYCQGLNRLVAVALLYLEQEDAFWCLVTIVEVFMPRDYYTKTLLGSQVDQRVFRDLMSEKLPRLHGHFEQYKVDYTLITFNWFLVVFVDSVVSDILFKIWDSFLYEGPKVIFRFALALFKYKEEEILKLQDSMSIFKYLRYFTRTILDARKLISISFGDLNPFPLRQIRNRRAYHLEKVRLELTELEAIREDF--LRERDTSPDKGELVSDEE 960          
The following BLAST results are available for this feature:
BLAST of TCONS_00073659 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
TBD2B3.442e-12932.95TBC1 domain family member 2B OS=Homo sapiens GN=TB... [more]
back to top