Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00073570 (transcript) - C. hemisphaerica

Overview
NameTCONS_00073570
Unique NameTCONS_00073570
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length739

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00073570 ID=TCONS_00073570|Name=TCONS_00073570|organism=Clytia hemisphaerica|type=transcript|length=739bp
CAAGCGCTGCGACAGAGGCATGTGGAGGTACAGATAGATAGCATCTGATT
TCCAGTCACCCATCACTGCAATCGTGTCAAGTGGGATCCCAGCCTCTAAT
GCAAAAGAGGCTCCTCCACGCCGAAAGGAATGTGAGCCGTACTGAGACGA
GGAAAGGCCAATGTTGGAGAGATGGTTGCGGAGAGAAAGCATGAAGTCTC
TGTAGGTGAAAATCCTATTTGAGCCATAAAACGAGTCCCTCCAACAAAAG
GCCTGAGCTTGGGGTCTCGCCCCAGGGGTCAACTGAAAAGCGTGGTTTAC
AGCCGAAACAGGAGAAAGGGGAGAAGACATGGTAACCAAGGGTATAGTAA
CAGTGCGTTGACCCAGCTGCATAGTCTTGCTCCACCTGACCCTGATGTAA
ACTGTAGAAGGATCCAGGGTGAAGTCAGACCTGACAAGAAAGGTAGCTGG
GGAAAAATCCTGATGGGAGAGAGGGAGGAGGTGACTCTTcctaaacaaac
caaaaaagGAAACAAGGCAAATAGCCCAAAAAGAAGCGTGCTTGCTGTCA
GAAAGTTCCAAATGCTGCCGGATACGGTAAAGAATATCAGTCATAATAGG
AAGTCTAGGCACTGGAGGGGATCCATTGGTGCGTTTGATACCTTTGAGAA
CCGAGCTCAAAAACCAATTATCTGCCAAGGGATTAACCAAACCATAGTCC
TTGTGGAGTAGGCCAACATAACTAATGTAGACGCAAANN
Run BLAST on NCBI

protein sequence of TCONS_00073570-protein

>TCONS_00073570-protein ID=TCONS_00073570-protein|Name=TCONS_00073570-protein|organism=Clytia hemisphaerica|type=polypeptide|length=246bp
XCVYISYVGLLHKDYGLVNPLADNWFLSSVLKGIKRTNGSPPVPRLPIMT
DILYRIRQHLELSDSKHASFWAICLVSFFGLFRKSHLLPLSHQDFSPATF
LVRSDFTLDPSTVYIRVRWSKTMQLGQRTVTIPLVTMSSPLSPVSAVNHA
FQLTPGARPQAQAFCWRDSFYGSNRIFTYRDFMLSLRNHLSNIGLSSSQY
GSHSFRRGGASFALEAGIPLDTIAVMGDWKSDAIYLYLHMPLSQRL
Run BLAST on NCBI

transcript from alignment at scaffold_94:298437..299175

Legend: exonfive_prime_UTRCDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00073570 ID=TCONS_00073570|Name=TCONS_00073570|organism=Clytia hemisphaerica|type=transcript|length=739bp|location=Sequence derived from alignment at scaffold_94:298437..299175 (Clytia hemisphaerica)
NNTTTGCGTCTACATTAGTTATGTTGGCCTACTCCACAAGGACTATGGTT TGGTTAATCCCTTGGCAGATAATTGGTTTTTGAGCTCGGTTCTCAAAGGT ATCAAACGCACCAATGGATCCCCTCCAGTGCCTAGACTTCCTATTATGAC TGATATTCTTTACCGTATCCGGCAGCATTTGGAACTTTCTGACAGCAAGC ACGCTTCTTTTTGGGCTATTTGCCTTGTTTCcttttttggtttgtttagg AAGAGTCACCTCCTCCCTCTCTCCCATCAGGATTTTTCCCCAGCTACCTT TCTTGTCAGGTCTGACTTCACCCTGGATCCTTCTACAGTTTACATCAGGG TCAGGTGGAGCAAGACTATGCAGCTGGGTCAACGCACTGTTACTATACCC TTGGTTACCATGTCTTCTCCCCTTTCTCCTGTTTCGGCTGTAAACCACGC TTTTCAGTTGACCCCTGGGGCGAGACCCCAAGCTCAGGCCTTTTGTTGGA GGGACTCGTTTTATGGCTCAAATAGGATTTTCACCTACAGAGACTTCATG CTTTCTCTCCGCAACCATCTCTCCAACATTGGCCTTTCCTCGTCTCAGTA CGGCTCACATTCCTTTCGGCGTGGAGGAGCCTCTTTTGCATTAGAGGCTG GGATCCCACTTGACACGATTGCAGTGATGGGTGACTGGAAATCAGATGCT ATCTATCTGTACCTCCACATGCCTCTGTCGCAGCGCTTG

Coding sequence (CDS) from alignment at scaffold_94:298437..299175

>TCONS_00073570 ID=TCONS_00073570|Name=TCONS_00073570|organism=Clytia hemisphaerica|type=CDS|length=738bp|location=Sequence derived from alignment at scaffold_94:298437..299175 (Clytia hemisphaerica)
NTTTGCGTCTACATTAGTTATGTTGGCCTACTCCACAAGGACTATGGTTT
GGTTAATCCCTTGGCAGATAATTGGTTTTTGAGCTCGGTTCTCAAAGGTA
TCAAACGCACCAATGGATCCCCTCCAGTGCCTAGACTTCCTATTATGACT
GATATTCTTTACCGTATCCGGCAGCATTTGGAACTTTCTGACAGCAAGCA
CGCTTCTTTTTGGGCTATTTGCCTTGTTTCcttttttggtttgtttaggA
AGAGTCACCTCCTCCCTCTCTCCCATCAGGATTTTTCCCCAGCTACCTTT
CTTGTCAGGTCTGACTTCACCCTGGATCCTTCTACAGTTTACATCAGGGT
CAGGTGGAGCAAGACTATGCAGCTGGGTCAACGCACTGTTACTATACCCT
TGGTTACCATGTCTTCTCCCCTTTCTCCTGTTTCGGCTGTAAACCACGCT
TTTCAGTTGACCCCTGGGGCGAGACCCCAAGCTCAGGCCTTTTGTTGGAG
GGACTCGTTTTATGGCTCAAATAGGATTTTCACCTACAGAGACTTCATGC
TTTCTCTCCGCAACCATCTCTCCAACATTGGCCTTTCCTCGTCTCAGTAC
GGCTCACATTCCTTTCGGCGTGGAGGAGCCTCTTTTGCATTAGAGGCTGG
GATCCCACTTGACACGATTGCAGTGATGGGTGACTGGAAATCAGATGCTA
TCTATCTGTACCTCCACATGCCTCTGTCGCAGCGCTTG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_045672XLOC_045672Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073570-exon-scaffold_94-1491911889:298437..299175TCONS_00073570-exon-scaffold_94-1491911889:298437..299175Clytia hemisphaericaexon
TCONS_00073570-exon-scaffold_94-1510915933:298437..299175TCONS_00073570-exon-scaffold_94-1510915933:298437..299175Clytia hemisphaericaexon
TCONS_00073570-exon-scaffold_94-1575043694:298437..299175TCONS_00073570-exon-scaffold_94-1575043694:298437..299175Clytia hemisphaericaexon
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073570-proteinTCONS_00073570-proteinClytia hemisphaericapolypeptide
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_94supercontigscaffold_94:298437..299175 .
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0.189299 0.565677 0.101235 0.32775 13.8688 15.3161 8.53612 12.5655 6.3498 5.19795 5.2979 5.54307 3.193 4.3559 3.13453 3.02478 2.94218 2.91761 0.982567 1.47408 1.21063 2.50614 0.600639 0.528444 1.55328 3.77922 0.28336 0.195915 0.261186 0.436738
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR013762Integrase-like_cat
IPR011010DNA_brk_join_enz
Vocabulary: Molecular Function
TermDefinition
GO:0003677DNA binding
Vocabulary: Biological Process
TermDefinition
GO:0006310DNA recombination
GO:0015074DNA integration
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0015074 DNA integration
biological_process GO:0006310 DNA recombination
molecular_function GO:0003677 DNA binding
Blast
The following BLAST results are available for this feature:
BLAST of TCONS_00073570 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 0
Match NameE-valueIdentityDescription
back to top