Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00073561 (transcript) - C. hemisphaerica

Overview
NameTCONS_00073561
Unique NameTCONS_00073561
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length970

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00073561 ID=TCONS_00073561|Name=TCONS_00073561|organism=Clytia hemisphaerica|type=transcript|length=970bp
TGTGCTAACTTCGCTTTAAGAAAGGCAGCTTCCGAAGGCGAATCAAAGTA
TGGTCAAGAAGCGTCCGACACCCTCAGAAAAAGCTTCTACGTCGACGACA
TGCTAAAATCAACAGAAGAACCCTCGGAAACGATAGAGCTCGTTCAGAAC
GTGCGTTCAATGTGTCAAGGTGGTGGTTTTATCTTAACAAAAGTCATCAG
CAACTCACGAGACGTCATCGAAGCCATCCCTGAAAACCACCGCGTCAAAG
AACTTCAATAATGCTTAGATGTCCTACCAAACGACCATGCACTTGGTGTT
CAATGGAACATCTCTGAAGATACTCTTAGCCTCTGAACGAAGACCTTCGA
CATACCATCAACCAAGCGTGGTTTGCTCTCCATTATCCACCAAGTCTATG
ATCCCTTAGGAATGGCTGCTCCAATCCTCCTCGAAAGCAAAAGGCTAATC
CAAAGTCTTTGTTCCGAAAACTTCGGATGGGATGAAAACTTCGCAAACGA
ACTGCAACAAAGAGTAAGTACAGCAACAGAAACGATTCTGTCGCTCCAAA
CCATTAACATTCCAAGATGCTTTCACCCAGTAGGCTTCCTTGTAGAAGAA
GCTAGCTTGCACCACTTTTCAGATGCTTCTGAAACTGGACATGGATATTG
CACCTTCATTCGCCTGTTAGACCCAGATGGCAACATCCACTGCTCCTTCG
TTCATGGACGGTCAAGAGTGAATCCGATCAAGAAAACGATCACAATGCCA
CGTCTCGAGCTTATGGCCGCTGCTCTTTCCGCAAAACTGGGTAGCAAACT
GTCCACAGAGCTCGAGATTCCCATTCAACGTGAAGTATATTGGACAGATA
GCAAGGTAGTGTTGGGCTACCTGAACAATGACACCAAGAAGTTCAAGATG
TTCGTTTCAAACAGAGTGACGTTCATCAAAGACCGAACGACATCAACCAG
TTGGAGATATGTAAAATCAG
Run BLAST on NCBI

protein sequence of TCONS_00073561-protein

>TCONS_00073561-protein ID=TCONS_00073561-protein|Name=TCONS_00073561-protein|organism=Clytia hemisphaerica|type=polypeptide|length=186bp
MAAPILLESKRLIQSLCSENFGWDENFANELQQRVSTATETILSLQTINI
PRCFHPVGFLVEEASLHHFSDASETGHGYCTFIRLLDPDGNIHCSFVHGR
SRVNPIKKTITMPRLELMAAALSAKLGSKLSTELEIPIQREVYWTDSKVV
LGYLNNDTKKFKMFVSNRVTFIKDRTTSTSWRYVKS
Run BLAST on NCBI

transcript from alignment at scaffold_94:168598..169567

Legend: exonthree_prime_UTRCDSfive_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00073561 ID=TCONS_00073561|Name=TCONS_00073561|organism=Clytia hemisphaerica|type=transcript|length=970bp|location=Sequence derived from alignment at scaffold_94:168598..169567 (Clytia hemisphaerica)
CTGATTTTACATATCTCCAACTGGTTGATGTCGTTCGGTCTTTGATGAAC GTCACTCTGTTTGAAACGAACATCTTGAACTTCTTGGTGTCATTGTTCAG GTAGCCCAACACTACCTTGCTATCTGTCCAATATACTTCACGTTGAATGG GAATCTCGAGCTCTGTGGACAGTTTGCTACCCAGTTTTGCGGAAAGAGCA GCGGCCATAAGCTCGAGACGTGGCATTGTGATCGTTTTCTTGATCGGATT CACTCTTGACCGTCCATGAACGAAGGAGCAGTGGATGTTGCCATCTGGGT CTAACAGGCGAATGAAGGTGCAATATCCATGTCCAGTTTCAGAAGCATCT GAAAAGTGGTGCAAGCTAGCTTCTTCTACAAGGAAGCCTACTGGGTGAAA GCATCTTGGAATGTTAATGGTTTGGAGCGACAGAATCGTTTCTGTTGCTG TACTTACTCTTTGTTGCAGTTCGTTTGCGAAGTTTTCATCCCATCCGAAG TTTTCGGAACAAAGACTTTGGATTAGCCTTTTGCTTTCGAGGAGGATTGG AGCAGCCATTCCTAAGGGATCATAGACTTGGTGGATAATGGAGAGCAAAC CACGCTTGGTTGATGGTATGTCGAAGGTCTTCGTTCAGAGGCTAAGAGTA TCTTCAGAGATGTTCCATTGAACACCAAGTGCATGGTCGTTTGGTAGGAC ATCTAAGCATTATTGAAGTTCTTTGACGCGGTGGTTTTCAGGGATGGCTT CGATGACGTCTCGTGAGTTGCTGATGACTTTTGTTAAGATAAAACCACCA CCTTGACACATTGAACGCACGTTCTGAACGAGCTCTATCGTTTCCGAGGG TTCTTCTGTTGATTTTAGCATGTCGTCGACGTAGAAGCTTTTTCTGAGGG TGTCGGACGCTTCTTGACCATACTTTGATTCGCCTTCGGAAGCTGCCTTT CTTAAAGCGAAGTTAGCACA

Coding sequence (CDS) from alignment at scaffold_94:168598..169567

>TCONS_00073561 ID=TCONS_00073561|Name=TCONS_00073561|organism=Clytia hemisphaerica|type=CDS|length=558bp|location=Sequence derived from alignment at scaffold_94:168598..169567 (Clytia hemisphaerica)
TGATTTTACATATCTCCAACTGGTTGATGTCGTTCGGTCTTTGATGAACG
TCACTCTGTTTGAAACGAACATCTTGAACTTCTTGGTGTCATTGTTCAGG
TAGCCCAACACTACCTTGCTATCTGTCCAATATACTTCACGTTGAATGGG
AATCTCGAGCTCTGTGGACAGTTTGCTACCCAGTTTTGCGGAAAGAGCAG
CGGCCATAAGCTCGAGACGTGGCATTGTGATCGTTTTCTTGATCGGATTC
ACTCTTGACCGTCCATGAACGAAGGAGCAGTGGATGTTGCCATCTGGGTC
TAACAGGCGAATGAAGGTGCAATATCCATGTCCAGTTTCAGAAGCATCTG
AAAAGTGGTGCAAGCTAGCTTCTTCTACAAGGAAGCCTACTGGGTGAAAG
CATCTTGGAATGTTAATGGTTTGGAGCGACAGAATCGTTTCTGTTGCTGT
ACTTACTCTTTGTTGCAGTTCGTTTGCGAAGTTTTCATCCCATCCGAAGT
TTTCGGAACAAAGACTTTGGATTAGCCTTTTGCTTTCGAGGAGGATTGGA
GCAGCCAT
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_045663XLOC_045663Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073561-proteinTCONS_00073561-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073561-exon-scaffold_94-1491911889:168598..169567TCONS_00073561-exon-scaffold_94-1491911889:168598..169567Clytia hemisphaericaexon
TCONS_00073561-exon-scaffold_94-1510915933:168598..169567TCONS_00073561-exon-scaffold_94-1510915933:168598..169567Clytia hemisphaericaexon
TCONS_00073561-exon-scaffold_94-1575043694:168598..169567TCONS_00073561-exon-scaffold_94-1575043694:168598..169567Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_94supercontigscaffold_94:168598..169567 .
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0.326339 0.0909235 0.263927 0.154927 0.188609 0.248402 0.539435 1.01003 0.471428 0.924572 0.614019 0.310486 0.0930163 0.289795 0.079417 0.284089 0.454966 0.215227 0.099116 0.0518589 0 0 0.0534535 0 0.550591 0.670076 0.191775 0 0 0.0527194
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR008042Retrotrans_Pao
Blast
The following BLAST results are available for this feature:
BLAST of TCONS_00073561 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 0
Match NameE-valueIdentityDescription
back to top