Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00073553 (transcript) - C. hemisphaerica

Overview
NameTCONS_00073553
Unique NameTCONS_00073553
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length686

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00073553 ID=TCONS_00073553|Name=TCONS_00073553|organism=Clytia hemisphaerica|type=transcript|length=686bp
GATGGAAATATTAAGAGAGGCAAGGAACATGGAGTGTGTTTGTAATGACA
GATTTAAGTTGTGCGCTGTAGAGGTGTTAGAAAGAAACGACATTAACGTT
CAGAATTTTAAAGCGGTAGTTTTGAAGGCTTTGGAATTTGGGCGCGACAA
AATGAACAATGTCTGTTTGTACGGCCTGTCGAATTGTGGTAAAACGTTTC
TTTTGCAGCCACTCCTAAAAATTTATGATACCTTTTCTTCACCCGCAACG
GGTACTTTTGCATGGGTTGGGgcagaaaaaaaagaagtcgTTCTCCTTAA
CGACTTCCGTTTGTCTGAAAAAGTCATCCCATGGTCAGACTTGCTAAATT
TGCTAGAGGGGTGGCCTATCCACATTCCCATGCCCAAAACCTCAAACCCC
GAAGACGTTGTCTGGGAGGCTAAGACGCCCATATTCGCGACCATGGATGC
AATGTTAGTCAAAACGGATGGTAAGACAATCGACAAGAGCAATACCAAGA
TGATGGATAATCGTTGGaactattttgaattttatcgaCCCTTGCGAGTG
ATTCAGAAAATGGAACCCTGTGGTAGATGTTTCGCAAGATTTATGCTTTC
CTAGGTTGATTGCTATATATATAATGTTGTTTATATTATAATGCTTTCAG
agtttgaattatttttcaaatttttcatgtgaGAAC
Run BLAST on NCBI

protein sequence of TCONS_00073553-protein

>TCONS_00073553-protein ID=TCONS_00073553-protein|Name=TCONS_00073553-protein|organism=Clytia hemisphaerica|type=polypeptide|length=200bp
MEILREARNMECVCNDRFKLCAVEVLERNDINVQNFKAVVLKALEFGRDK
MNNVCLYGLSNCGKTFLLQPLLKIYDTFSSPATGTFAWVGAEKKEVVLLN
DFRLSEKVIPWSDLLNLLEGWPIHIPMPKTSNPEDVVWEAKTPIFATMDA
MLVKTDGKTIDKSNTKMMDNRWNYFEFYRPLRVIQKMEPCGRCFARFMLS
Run BLAST on NCBI

transcript from alignment at scaffold_94:9791..10476

Legend: exonthree_prime_UTRCDSfive_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00073553 ID=TCONS_00073553|Name=TCONS_00073553|organism=Clytia hemisphaerica|type=transcript|length=686bp|location=Sequence derived from alignment at scaffold_94:9791..10476 (Clytia hemisphaerica)
GTTCtcacatgaaaaatttgaaaaataattcaaactCTGAAAGCATTATA ATATAAACAACATTATATATATAGCAATCAACCTAGGAAAGCATAAATCT TGCGAAACATCTACCACAGGGTTCCATTTTCTGAATCACTCGCAAGGGtc gataaaattcaaaatagttCCAACGATTATCCATCATCTTGGTATTGCTC TTGTCGATTGTCTTACCATCCGTTTTGACTAACATTGCATCCATGGTCGC GAATATGGGCGTCTTAGCCTCCCAGACAACGTCTTCGGGGTTTGAGGTTT TGGGCATGGGAATGTGGATAGGCCACCCCTCTAGCAAATTTAGCAAGTCT GACCATGGGATGACTTTTTCAGACAAACGGAAGTCGTTAAGGAGAAcgac ttcttttttttctgcCCCAACCCATGCAAAAGTACCCGTTGCGGGTGAAG AAAAGGTATCATAAATTTTTAGGAGTGGCTGCAAAAGAAACGTTTTACCA CAATTCGACAGGCCGTACAAACAGACATTGTTCATTTTGTCGCGCCCAAA TTCCAAAGCCTTCAAAACTACCGCTTTAAAATTCTGAACGTTAATGTCGT TTCTTTCTAACACCTCTACAGCGCACAACTTAAATCTGTCATTACAAACA CACTCCATGTTCCTTGCCTCTCTTAATATTTCCATC

Coding sequence (CDS) from alignment at scaffold_94:9791..10476

>TCONS_00073553 ID=TCONS_00073553|Name=TCONS_00073553|organism=Clytia hemisphaerica|type=CDS|length=603bp|location=Sequence derived from alignment at scaffold_94:9791..10476 (Clytia hemisphaerica)
CTAGGAAAGCATAAATCTTGCGAAACATCTACCACAGGGTTCCATTTTCT
GAATCACTCGCAAGGGtcgataaaattcaaaatagttCCAACGATTATCC
ATCATCTTGGTATTGCTCTTGTCGATTGTCTTACCATCCGTTTTGACTAA
CATTGCATCCATGGTCGCGAATATGGGCGTCTTAGCCTCCCAGACAACGT
CTTCGGGGTTTGAGGTTTTGGGCATGGGAATGTGGATAGGCCACCCCTCT
AGCAAATTTAGCAAGTCTGACCATGGGATGACTTTTTCAGACAAACGGAA
GTCGTTAAGGAGAAcgacttcttttttttctgcCCCAACCCATGCAAAAG
TACCCGTTGCGGGTGAAGAAAAGGTATCATAAATTTTTAGGAGTGGCTGC
AAAAGAAACGTTTTACCACAATTCGACAGGCCGTACAAACAGACATTGTT
CATTTTGTCGCGCCCAAATTCCAAAGCCTTCAAAACTACCGCTTTAAAAT
TCTGAACGTTAATGTCGTTTCTTTCTAACACCTCTACAGCGCACAACTTA
AATCTGTCATTACAAACACACTCCATGTTCCTTGCCTCTCTTAATATTTC
CAT
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_045655XLOC_045655Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073553-proteinTCONS_00073553-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073553-exon-scaffold_94-1491911889:9791..10476TCONS_00073553-exon-scaffold_94-1491911889:9791..10476Clytia hemisphaericaexon
TCONS_00073553-exon-scaffold_94-1510915933:9791..10476TCONS_00073553-exon-scaffold_94-1510915933:9791..10476Clytia hemisphaericaexon
TCONS_00073553-exon-scaffold_94-1575043694:9791..10476TCONS_00073553-exon-scaffold_94-1575043694:9791..10476Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_94supercontigscaffold_94:9791..10476 .
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
1.41316 1.08794 0.421066 0.164779 0.401205 0.634075 0.382493 0.358085 0.125352 0.232903 0 0.0495345 0.395725 0.565077 0.633504 0.0906463 0.725847 0.343371 0.0790642 0.16547 0.143823 0.105228 0.767511 0.077531 1.51725 1.56791 0 0 0.0825525 0.252324
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR027417P-loop_NTPase
Blast
The following BLAST results are available for this feature:
BLAST of TCONS_00073553 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 0
Match NameE-valueIdentityDescription
back to top