Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00073552 (transcript) - C. hemisphaerica

Overview
NameTCONS_00073552
Unique NameTCONS_00073552
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length337

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00073552 ID=TCONS_00073552|Name=TCONS_00073552|organism=Clytia hemisphaerica|type=transcript|length=337bp
CTTGGTTCTTATTCCTTTCTTTTCGATAACCAAATCAATGCGTTTAGGCA
TAGAGTCAATAGTGCGATCGATGACTTCTGGGCTGTATTCTAAGATTGTC
TTGCGAACTCGTCTACAGAACTGCTCAAAGGTTTCATGTTCCAACTTTCC
CTCCAAAGCGTCTTCGTTAAGCTTCCTGCGTATGTTGTGAAACGCGTTCT
CTATGGGGTTGAGATCCGGACTGCGTGCCGGTATCTTGAAGAGACGGCAT
CCTACAGCATCCATGGCCAACTGTGCAGCTGCAGAGTTTTGGCTAGGGTC
TCCATCTTGTAAAAATAACTTTCCTTTTGGATTGGCC
Run BLAST on NCBI

protein sequence of TCONS_00073552-protein

>TCONS_00073552-protein ID=TCONS_00073552-protein|Name=TCONS_00073552-protein|organism=Clytia hemisphaerica|type=polypeptide|length=112bp
ANPKGKLFLQDGDPSQNSAAAQLAMDAVGCRLFKIPARSPDLNPIENAFH
NIRRKLNEDALEGKLEHETFEQFCRRVRKTILEYSPEVIDRTIDSMPKRI
DLVIEKKGIRTK
Run BLAST on NCBI

transcript from alignment at scaffold_94:9196..9532

Legend: exonfive_prime_UTRCDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00073552 ID=TCONS_00073552|Name=TCONS_00073552|organism=Clytia hemisphaerica|type=transcript|length=337bp|location=Sequence derived from alignment at scaffold_94:9196..9532 (Clytia hemisphaerica)
GGCCAATCCAAAAGGAAAGTTATTTTTACAAGATGGAGACCCTAGCCAAA ACTCTGCAGCTGCACAGTTGGCCATGGATGCTGTAGGATGCCGTCTCTTC AAGATACCGGCACGCAGTCCGGATCTCAACCCCATAGAGAACGCGTTTCA CAACATACGCAGGAAGCTTAACGAAGACGCTTTGGAGGGAAAGTTGGAAC ATGAAACCTTTGAGCAGTTCTGTAGACGAGTTCGCAAGACAATCTTAGAA TACAGCCCAGAAGTCATCGATCGCACTATTGACTCTATGCCTAAACGCAT TGATTTGGTTATCGAAAAGAAAGGAATAAGAACCAAG

Coding sequence (CDS) from alignment at scaffold_94:9196..9532

>TCONS_00073552 ID=TCONS_00073552|Name=TCONS_00073552|organism=Clytia hemisphaerica|type=CDS|length=336bp|location=Sequence derived from alignment at scaffold_94:9196..9532 (Clytia hemisphaerica)
GCCAATCCAAAAGGAAAGTTATTTTTACAAGATGGAGACCCTAGCCAAAA
CTCTGCAGCTGCACAGTTGGCCATGGATGCTGTAGGATGCCGTCTCTTCA
AGATACCGGCACGCAGTCCGGATCTCAACCCCATAGAGAACGCGTTTCAC
AACATACGCAGGAAGCTTAACGAAGACGCTTTGGAGGGAAAGTTGGAACA
TGAAACCTTTGAGCAGTTCTGTAGACGAGTTCGCAAGACAATCTTAGAAT
ACAGCCCAGAAGTCATCGATCGCACTATTGACTCTATGCCTAAACGCATT
GATTTGGTTATCGAAAAGAAAGGAATAAGAACCAAG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_045654XLOC_045654Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073552-exon-scaffold_94-1491911889:9196..9532TCONS_00073552-exon-scaffold_94-1491911889:9196..9532Clytia hemisphaericaexon
TCONS_00073552-exon-scaffold_94-1510915933:9196..9532TCONS_00073552-exon-scaffold_94-1510915933:9196..9532Clytia hemisphaericaexon
TCONS_00073552-exon-scaffold_94-1575043694:9196..9532TCONS_00073552-exon-scaffold_94-1575043694:9196..9532Clytia hemisphaericaexon
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073552-proteinTCONS_00073552-proteinClytia hemisphaericapolypeptide
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_94supercontigscaffold_94:9196..9532 .
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0.554334 0.540563 0.313822 0 0 0.295362 0.712683 0 0.467126 0.289306 0 0 0.184335 0 0.314769 0.321872 0 0 0 0 0 0 0 0 0.595163 0 0 0 0 0.94029
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR012337RNaseH-like_dom
Vocabulary: Molecular Function
TermDefinition
GO:0003676nucleic acid binding
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
molecular_function GO:0003676 nucleic acid binding
Blast
The following BLAST results are available for this feature:
BLAST of TCONS_00073552 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 0
Match NameE-valueIdentityDescription
back to top