Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00073544 (transcript) - C. hemisphaerica

Overview
NameTCONS_00073544
Unique NameTCONS_00073544
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1738

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00073544 ID=TCONS_00073544|Name=TCONS_00073544|organism=Clytia hemisphaerica|type=transcript|length=1738bp
aaaattttgaattctattgaTCGGTttttaataatcttttttttttgccg
tcaaATGATGAATATTCTTGATGAAAAAAGAAGAGGAAAAAGTCATGATA
AATAAGTGACAGGTTGACGCCTCTTGGAAAANTTTTGAATTCTATTGATC
GGTTCTTAATAATCTTTTTTTGCCGTCAAATGATGAATATTCTTGATGAA
AAAAGAAGAGGAAAAAGTCATGATAAATAAGTGACAGGTTGACGCctctt
ggaaaatatttttttgtgaatttatttgaaactttttcgATTGCCGCTTT
AAACATTAAAACTCTTTGATATATCTCTACGATTATTTATAAGACATGGA
ACTTCTGAGTTATTATGTTAGCATTTTGGTCATCGCAAAATCAGTTAAAA
GTCAGTCGGCAAACTCAATGACACCAAGAAGAGATCGGGCGCCATTGGGA
GATTGCTACCAGTGTGGTCAAGGAAGCGCATACAACAACAAAGAAGCTTG
TATCGGAAACCAACGATTACAACCATGTATCGGGCCAAACAAAGTTTGCA
GAACACTTCACATTTATAACGAACATAAATTCCCGAACGGTACAACAATC
ATGTATAGAGAACATTATAAGAAATCGTGCGAAACTGCTGACCCTAAGGG
ATGTGATTCAAAGtgttatttttacagaaaagaAGGAAGAGCTTGCAAGA
TGCAATGTTGTGCTTACCACGCGTGCAACCAAGACGTCCAGTTCGACAGA
CCGAAAGCACGAGTATCTGAAAGTGTGAGACCAGCTCTTCAGTACGACTC
ATCAGCATCAACTCTATCAGCAACTCTCATTTCTACCCTGATTATATTGC
TACACTTGATATAGATAATACTGTCCGATTGCTTTAAGAGCACCTTTCTT
TTGCTATCATgtagataaataaataaataaataatttacaTCGATAGCCG
AGTAATTTAAGATCtttaatcttttgatttttttgtcacgGGGTCCAGGA
CTTACCAGCTTGGCCATCAAGGAACTGAACggaatacacaggttgcaaaa
ttgaagtctgaagacaaatcacggtTATACTCGAAAGTTTTATGtacttg
ttacatgacatttatttttgattggtttgaaaatttattgacactaataa
agttatcagctgaaagttgtaaagcaagtaacatgggaataaaatcacgt
gaactttttcgagtaatcacatgttttgactgcactgaCATAATTTTTCA
AACCGTGAATTTAGGAATGAGTGGAGATTTGTACCAGGAACCCCTGGATT
CCCTCATTCTTCTCCCACATAGAAATATTTTCAGCGTTGTTAGAGAACGG
TTTTTACATGATAGCAAATGGGGCCCAAAGAGGACTGCATACCTAATAGC
ACACGAACTTTAAATTTGTAATTAATCATTTGCATGGAAATGACATATCA
GAGACTTTTATATCCATGATGACCGCAATGCTCTATCGGATGAACATTAA
ATGCATAGCGTACTGTTGtatggaaaaaaaacaaagtgacTACAAATTTA
CACGTGTCTTTACTTAAAATGACTATCGACGAACACGTGAACGCTTGAAC
ATTTGACACGTAATGGACAAAAGGTTGATATTTTCATTACTTTATGCCCC
AATGGGGCATGGCGAGCATTTTATAATGGTAGAAGCAGCATCAATAGCAT
GGGCAtattttttaactcgaataAATAATAGAATAGAA
Run BLAST on NCBI

protein sequence of TCONS_00073544-protein

>TCONS_00073544-protein ID=TCONS_00073544-protein|Name=TCONS_00073544-protein|organism=Clytia hemisphaerica|type=polypeptide|length=172bp
MELLSYYVSILVIAKSVKSQSANSMTPRRDRAPLGDCYQCGQGSAYNNKE
ACIGNQRLQPCIGPNKVCRTLHIYNEHKFPNGTTIMYREHYKKSCETADP
KGCDSKCYFYRKEGRACKMQCCAYHACNQDVQFDRPKARVSESVRPALQY
DSSASTLSATLISTLIILLHLI
Run BLAST on NCBI

transcript from alignment at scaffold_94:386272..391441-

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00073544 ID=TCONS_00073544|Name=TCONS_00073544|organism=Clytia hemisphaerica|type=transcript|length=5170bp|location=Sequence derived from alignment at scaffold_94:386272..391441- (Clytia hemisphaerica)
AAAATTTTGAATTCTATTGATCGGTTTTTAATAATCTTTTTTTTTTGCCG TCAAATGATGAATATTCTTGATGAAAAAAGAAGAGGAAAAAGTCATGATA AATAAGTGACAGGTTGACGCCTCTTGGAAAANTTTTGAATTCTATTGATC GGTTCTTAATAATCTTTTTTTGCCGTCAAATGATGAATATTCTTGATGAA AAAAGAAGAGGAAAAAGTCATGATAAATAAGTGACAGGTTGACGCCTCTT GGAAAATATTTTTTTGTGAATTTATTTGAAACTTTTTCGATTGCCGCTTT AAACATTAAAACTCTTTGATATATCTCTACGATTATTTATAAGACATGGA ACTTCTGAGTTATTATGTTAGCATTTTGGTCATCGCAAAATCAGGTATGT GTTGTCTTAATTATCAATGGCAATGAGCAGTATAGCGTTGTGGCAGGGAG GGCCGAAGAGCAAGGGGCGCCAAAAGAGATTTTTTTGTACGCCCAAATTT TAAAAATCATATTTTATGCGCCTTAAATTGCGCCCCAGGACCAATTTTAC TTAGATAATTTTAAATTTCCTCCAATTTTTTTCGCTCGCTTCGCTCGCAA TAAAGTTGATTGGTAACTTCTTTGCAATCTAGCTAATTTACAAGTTTTTT TGTGTACAATATAGCATTATTAAATAAAAATCTAACTGCGCCCCGAGACC AATTTGCTGACAACAATATTGAAATCATAAAACATCAATTGTTTCGCTCA CTTCGCTCGCTCTACACATTGCTTCTTTCTTTTCACTCTAGCAAGAGTCA AATTTGTCTATTTTTATTTAGTGATTTAGGGTATCTTGTCCATTTTCAAC ATTTTCAATATTTCCTTTCTCGTTATTCCCGCTAGGCAAATGAATTAGTA AAATTGGGTGGGTGGGAGTGCCACTTTGGAAAATTGGGGGCGCCATTTAA AAAAAAATTGACTTTGGCCCCTCCAGAAAAATTTTCCCACAACGCCACTG CCAATGAGCGGATGAAGATTGAAGGATTGATTGATTATCTTTGTTCATAT TGACCGGGAAATTATAATCTGGAAAATTGTTGTCACGGGTCCCTTTACTC TTACTAATTTAAAAAATAATTGCCGAAATTTAAATAAATCTGAACCTGGA TAATTCAGGGATATTGAAAATTATTAGTGAGCTACTAAAGCGAGACCAAT TTAATTTGTTGTTTTACGGGCAGATCGTTAGCAAAGTATGAGTCAGTCGG TCTGTAAAAAAAAAAATATATATTTTCATTAATCAACGAAGATAATTAGG CCTTAAGTAATATTTTTGTTGAGTTTTTTTTTGAAATAAAATCTTTCGTG CATAGAATTCATGATTCTAGATTCTAGAATCCACGATTCCAGATTCTTTT CAACTTTTTGTAAGTTAAATTTTTTAAATGACTAGTATTAGAAATTTGTG GCATAGGAAATTCAATATTATTATTTTTTCGTTTGCAGCAAATGCTAGGT CGGCCGCGCCCGTAGAACAACAAATTAAATTGGCCTCGCCTAAGAAAAGT ATTCTACATTGCAATAGATTTGCAATATACTCTACGACATCTGTGTCAGT ACCCCTGTCGTCATCGTTTAGGTAGTTGGATAAACTAATCTGGTATATTT GCAATGGGAATAAAGATATGTCGTTTAAAATGCTTGGGATTTCCCCAGCT GGCACACAACGTTATCTAACGCTCACAACGTCCATTTAACGTCAAATGAA CGTTGAAACATTGTTGTGTCAGCTGCTGGGTTTAAAATCTTTTGTTTCTA GCCAAATTTGAAGTAAATGTAAAGCCATATTAATTTCATTTCAGTTAAAA GTCAGTCGGCAAACTCAATGACACCAAGAAGAGATCGGGCGCCATTGGGA GATTGCTACCAGTGTGGTCAAGGAAGCGCATACAACAACAAAGAAGCTTG TATCGGAAACCAACGATTACAACCATGTATCGGGCCAAACAAAGTTTGCA GAACACTTCACATTTATAACGAACATAAATTCCCGAACGGTACAACAATC ATGTATAGAGAACATTATAAGAAATCGTGCGAAACTGCTGACCCTAAGGG ATGTGATTCAAAGTGTTATTTTTACAGAAAAGAAGGAAGAGCTTGCAAGG TAACTCTAACATTTCATCGAACAGTCAGTGAGGTGATTGTCGTTTAAGAA TTTCTTCACCAATTCTCAACAAATTATAGTTCAATATTTCAAAATATTTT GTAAACTTTTTACAATCAGTGCCGAAATATTTGGCGCAAAAGGGGAATTC CCTCAAAACTTTAAAAGCGCAAGTGCTTTAAAGTACGTTTGGAAAGCAGA GTCTTAACTCTGAGTTTCAACATTAGTCTTAAGACTTATGATCTCAGGAT ATAAAGCTAAAAAATATTCCAATATGGCTGAGAATATAGCCTGGAAGCCA ATTCACCCCTCCCAAACAGAAAAATCCAATGAAACAAAGTGAAAGTACTG AAACTGCAATTCTCGCCAAAGCTTTAAATTCTAAAATACGTTAAAATCTC AAAAATTGCCAATATATTTCGATGCTTGCCCCTTTTGAAGAGTGTTTTTT TTTACTTTTTAAGAAAAGGATATATAAGTGCCCTTAGCGCTCAGATCCGG GGGGAAGCTGACGGGAATGTACCGCCCGACTTTCGACCCTTGGACCCAAT TTTGACTAATTTGACCAATATTTCAATATTTTTGGGGCAAAACATGCCCT TAACCTTCAATTGCCCATTGTCTATTTTTCATAGTATCAAATGACGGTTT CTGAAACAAAAATAGTTTCAAAAAACTTTTCAACTGAGTTTCTGTCTAGA CAGAAACAGTCGCAGCAAACCTTTGAAAATTCTCATAGTAGTTATACGAC AGTGGCAAAAATTGTTTTGCTGAGATTTCTTTGAGGCGGGTAGGCCACTT AAAACAAAGTTTAGCGATTGACCTGCAGCTTGTTTATGTTTAATTTTGAT GAAAATTGTTTCAAGTGGTCCGAGACTTTCAGAAAACATTGGTCCGAGCC GAATTTGTTGAACCTACAGACCCCTGTGTCACAGACTCGCTGGGACCCCA GCACCACTGAAAATTTGGCAAAAATTTCGTCCCCGGTGGGAAAATACCCT GGAATTTCAGCCCCACTGGGAAATTTACCTTGATTTCATCCCCATTCAAA ATTCAATGTTTAAAAATGGCACTTCAAAACCATCCCCACTGGAATTTCAT TTTAACTTTAGAACAATAGAATTTCTATCCCCCATTGGAATTTCAATAGA AATTTTTATCCCCACCGAGGGAAAAAGTTCCACCGGGGCTGTGAGACAGG CGTGTATTTACAGAAAAGCTTCCAGATGTTTAACAAGTTTACTAGATTGC AAATACTCCTTCTTAGAACCTATTCTTTTTAACAAGTGGGTAGTCTAGAC GACCAGTGACTTAAGCAATAACATAAGCAAATGCAAGAAAAAATGGAATC AACAAATTGTATTGGCAAATCTTGTTATCATATAACAGTAAAATTACTGT ATTACATTGATTATAGATAACTCTAGACTAACATTTAGCGTTGTTGTAAT GGTGAACTGCATAGATCTAATAGTGATTTCTATGAATTTACTATCGCTAG AAAGGCGATTATGTCACGTGACATGCTTCTATATAAGCTCCCCAGATGGA TCAGTGAATCACACTTCATTAGAATTGATAGCCCACCCAATCGCGAGGAA ATTATCAAATCAGCAGTTGACGGAATATAGTTCTTTTTGCGTCATGTATA CAATTTATAAGCACTTATATTTACGTTTACACGCTCCGTCTTGCACCCAG CTGGCACACAACGTTGTTTTAACGTTCAAATAACGTTATTTGGACGTTAT GAATGTCACATGGACGTTGTTTTGACGTTGTGTGCCGTCTGGGTACNAAC GTTATTTGGACGTTATGAATGTCACATGGACGTTGTTTTGACGTTGTGTG CCGTCTGGGTACATTCTCTAGCTGACCCTACTACGTGAAAGAAATATATA CTGATTAAGATGATAAATAAAGTTACTTTCGTTTGAGTTTACGAATTAGA AAATAATACAATTTCCATTCTACCATTCTAGATGCAATGTTGTGCTTACC ACGCGTGCAACCAAGACGTCCAGTTCGACAGACCGAAAGCACGAGTATCT GAAAGTGTGAGACCAGCTCTTCAGTACGACTCATCAGCATCAACTCTATC AGCAACTCTCATTTCTACCCTGATTATATTGCTACACTTGATATAGATAA TACTGTCCGATTGCTTTAAGAGCACCTTTCTTTTGCTATCATGTAGATAA ATAAATAAATAAATAATTTACATCGATAGCCGAGTAATTTAAGATCTTTA ATCTTTTGATTTTTTTGTCACGGGGTCCAGGACTTACCAGCTTGGCCATC AAGGAACTGAACGGAATACACAGGTTGCAAAATTGAAGTCTGAAGACAAA TCACGGTTATACTCGAAAGTTTTATGTACTTGTTACATGACATTTATTTT TGATTGGTTTGAAAATTTATTGACACTAATAAAGTTATCAGCTGAAAGTT GTAAAGCAAGTAACATGGGAATAAAATCACGTGAACTTTTTCGAGTAATC ACATGTTTTGACTGCACTGACATAATTTTTCAAACCGTGAATTTAGGAAT GAGTGGAGATTTGTACCAGGAACCCCTGGATTCCCTCATTCTTCTCCCAC ATAGAAATATTTTCAGCGTTGTTAGAGAACGGTTTTTACATGATAGCAAA TGGGGCCCAAAGAGGACTGCATACCTAATAGCACACGAACTTTAAATTTG TAATTAATCATTTGCATGGAAATGACATATCAGAGACTTTTATATCCATG ATGACCGCAATGCTCTATCGGATGAACATTAAATGCATAGCGTACTGTTG TATGGAAAAAAAACAAAGTGACTACAAATTTACACGTGTCTTTACTTAAA ATGACTATCGACGAACACGTGAACGCTTGAACATTTGACACGTAATGGAC AAAAGGTTGATATTTTCATTACTTTATGCCCCAATGGGGCATGGCGAGCA TTTTATAATGGTAGAAGCAGCATCAATAGCATGGGCATATTTTTTAACTC GAATAAATAATAGAATAGAA

Coding sequence (CDS) from alignment at scaffold_94:386272..391441-

>TCONS_00073544 ID=TCONS_00073544|Name=TCONS_00073544|organism=Clytia hemisphaerica|type=CDS|length=1557bp|location=Sequence derived from alignment at scaffold_94:386272..391441- (Clytia hemisphaerica)
ATGCAATGTTGTGCTTACCACGCGTGCAACCAAGACGTCCAGTTCGACAG
ACCGAAAGCACGAGTATCTGAAAGTGTGAGACCAGCTCTTCAGTACGACT
CATCAGCATCAACTCTATCAGCAACTCTCATTTCTACCCTGATTATATTG
CTACACTTGATATAGTTAAAAGTCAGTCGGCAAACTCAATGACACCAAGA
AGAGATCGGGCGCCATTGGGAGATTGCTACCAGTGTGGTCAAGGAAGCGC
ATACAACAACAAAGAAGCTTGTATCGGAAACCAACGATTACAACCATGTA
TCGGGCCAAACAAAGTTTGCAGAACACTTCACATTTATAACGAACATAAA
TTCCCGAACGGTACAACAATCATGTATAGAGAACATTATAAGAAATCGTG
CGAAACTGCTGACCCTAAGGGATGTGATTCAAAGTGTTATTTTTACAGAA
AAGAAGGAAGAGCTTGCAAGATGGAACTTCTGAGTTATTATGTTAGCATT
TTGGTCATCGCAAAATCAGATGCAATGTTGTGCTTACCACGCGTGCAACC
AAGACGTCCAGTTCGACAGACCGAAAGCACGAGTATCTGAAAGTGTGAGA
CCAGCTCTTCAGTACGACTCATCAGCATCAACTCTATCAGCAACTCTCAT
TTCTACCCTGATTATATTGCTACACTTGATATAGTTAAAAGTCAGTCGGC
AAACTCAATGACACCAAGAAGAGATCGGGCGCCATTGGGAGATTGCTACC
AGTGTGGTCAAGGAAGCGCATACAACAACAAAGAAGCTTGTATCGGAAAC
CAACGATTACAACCATGTATCGGGCCAAACAAAGTTTGCAGAACACTTCA
CATTTATAACGAACATAAATTCCCGAACGGTACAACAATCATGTATAGAG
AACATTATAAGAAATCGTGCGAAACTGCTGACCCTAAGGGATGTGATTCA
AAGTGTTATTTTTACAGAAAAGAAGGAAGAGCTTGCAAGATGGAACTTCT
GAGTTATTATGTTAGCATTTTGGTCATCGCAAAATCAGATGCAATGTTGT
GCTTACCACGCGTGCAACCAAGACGTCCAGTTCGACAGACCGAAAGCACG
AGTATCTGAAAGTGTGAGACCAGCTCTTCAGTACGACTCATCAGCATCAA
CTCTATCAGCAACTCTCATTTCTACCCTGATTATATTGCTACACTTGATA
TAGTTAAAAGTCAGTCGGCAAACTCAATGACACCAAGAAGAGATCGGGCG
CCATTGGGAGATTGCTACCAGTGTGGTCAAGGAAGCGCATACAACAACAA
AGAAGCTTGTATCGGAAACCAACGATTACAACCATGTATCGGGCCAAACA
AAGTTTGCAGAACACTTCACATTTATAACGAACATAAATTCCCGAACGGT
ACAACAATCATGTATAGAGAACATTATAAGAAATCGTGCGAAACTGCTGA
CCCTAAGGGATGTGATTCAAAGTGTTATTTTTACAGAAAAGAAGGAAGAG
CTTGCAAGATGGAACTTCTGAGTTATTATGTTAGCATTTTGGTCATCGCA
AAATCAG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_045650XLOC_045650Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073544-proteinTCONS_00073544-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073544-exon-scaffold_94-1575043694:391048..391441TCONS_00073544-exon-scaffold_94-1575043694:391048..391441Clytia hemisphaericaexon
TCONS_00073544-exon-scaffold_94-1575043694:389293..389597TCONS_00073544-exon-scaffold_94-1575043694:389293..389597Clytia hemisphaericaexon
TCONS_00073544-exon-scaffold_94-1575043694:386272..387310TCONS_00073544-exon-scaffold_94-1575043694:386272..387310Clytia hemisphaericaexon
TCONS_00073544-exon-scaffold_94-1510915933:391048..391441TCONS_00073544-exon-scaffold_94-1510915933:391048..391441Clytia hemisphaericaexon
TCONS_00073544-exon-scaffold_94-1510915933:389293..389597TCONS_00073544-exon-scaffold_94-1510915933:389293..389597Clytia hemisphaericaexon
TCONS_00073544-exon-scaffold_94-1510915933:386272..387310TCONS_00073544-exon-scaffold_94-1510915933:386272..387310Clytia hemisphaericaexon
TCONS_00073544-exon-scaffold_94-1491911889:391048..391441TCONS_00073544-exon-scaffold_94-1491911889:391048..391441Clytia hemisphaericaexon
TCONS_00073544-exon-scaffold_94-1491911889:389293..389597TCONS_00073544-exon-scaffold_94-1491911889:389293..389597Clytia hemisphaericaexon
TCONS_00073544-exon-scaffold_94-1491911889:386272..387310TCONS_00073544-exon-scaffold_94-1491911889:386272..387310Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_94supercontigscaffold_94:386272..391441 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0.0233781 0.118826 0.293753 0.306405 0.125509 0 0.299263 0.191765 0.0520913 0 0 0.0185732 1.00412 0.711471 0.0529404 0.15589 0.958202 1.33002 2.13799 2.96867 2.58814 2.87106 1.28134 1.57587 2.75025 3.18543 7.74859 7.32153 2.23678 1.97553
Blast
The following BLAST results are available for this feature:
BLAST of TCONS_00073544 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 0
Match NameE-valueIdentityDescription
back to top