Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00073531 (transcript) - C. hemisphaerica

Overview
NameTCONS_00073531
Unique NameTCONS_00073531
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length2042

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00073531 ID=TCONS_00073531|Name=TCONS_00073531|organism=Clytia hemisphaerica|type=transcript|length=2042bp
CAGTGGATTGACGCATTGAAAGCAGTTGCTCGAATGCCTGGTGGAATACC
TGCAGAGTGGAGAAAGAGGACTTGGTTATCACTGGCTGAATTCTTCTTGA
AAGACATTGAATGGGAGGGTATCAAGAAGACATGCTTCAACGATCGACGC
AACCCTGACGATGACGAACTGGACACTCAAATCGTCAAAGATTTGCATCG
TACAGGGTGCGGCTGGTTTTTCGAACATGATACGGCCGAAGACCGCGCCA
GTCTGAAGCGCGTTTTACTAGCGTACGCGCGTTGGAACAAACAGATCGGA
TATTGCCAAGGGTTCAACGTCATTGCAGCTCTGATCTTACAAGTCATGGA
AGGAAACGAAGAACACGCACTCAAGGTCATGATCTTTTTGGTGGATTATG
TGCTTCCTAGAAACTATTTCTCCAACAATCTACGCGCGCTCTCCGTCGAT
ATGGCCGTCCTGCGTGACTTGATGCAGATGAAACTTGGCTATCTCGCAAA
CAGGCTACAACAGTTGCAGAAAGAGGCTATGGATGGGTCAAAAAACACGT
CTGCAAGTTATGAACCACCTCTGATTAACATGTTTACAATGCAATGGTTT
CTGACCCTCTTTGCGACCTGTCTGCCAAGGAACACAGTATTGAGGATTTG
GGACGCGGTCTTGTTGGAAGGGTCCGAAGTACTTCTTCGAGTTGCACTCG
CTTTATGGGCCAAACTGGGGAGttttttcgATGAGGTGGAAACAGCAGCA
GATTTCTACATGACCATGGGGAAGTTGATCCAAGAGCTCATCACAGACGA
ATTCATACTTGTTCAAAAACTTATGCAGGCTGTATATCAGATGGCATCCT
TTCCATGGGTCGAACTGACGGAATTACGAGAAAAATACACGTACGATATC
CATCCATTTACGACGTTCAGAGAAGAAAAGAAACGCGAAAAACTGAAATT
GCAACGACAAATGAACAAACCTCCGAGCGATGAAGAAGAATATGATGACG
TCAACGACGATGACGTCATGGTAGGTTGTCTTGGTTTCGTTGCCGGTTCA
TCGGACACGCCACACCTCATGTTATCATCACCTAATAAACACAACAAAAA
CACAAACTCGAACTTGCATTCAGCACAATCAAACTCTTCTTCAAAGAACG
CCAAATCGTCCGCACAACACGTATCATCTAAGCAAAGGAGGTCACGTCAA
GATGTAGCTTCTAAAAACGATATTACAAAAGTCACACCAGGTGCCTACAT
CACAGACCAAGAAGCGAGAAACGCTTACAAAGAACAAATGAGAGCCAAAG
AGTTGATGAGAGAGACTGAAAAACTTGACGTCAATAAATTACGTAATCAG
TACGGGCGTATGAGGCGGTTACAACAAAAAGCAATGCTTGTTTTCAACGC
CGATGACTTTAAAGATGAATCTTATAAAGTGAAAAACCCGCCCTCCGCCA
TCAATCATTTATTCGTTGATGTTAATAACGTGGTCGCTCCGCCTAGAGCT
CGATATCGAAAGCCGAGTAATTTTCCCGCCCTCAAAACGCTTGGGAAGGG
TGGACCACCCGCACCTCCCCGTCCAATCAAAGAATCACCGAAAGTAGTTC
ACGAGTCGACCAGTTCCAAAGGTGAGGGTGAAACaaaaacttctttaaaa
aaacaggACAGTTTCTCTATCACCAACCCTTACGTCATGTTAGAAGTTCA
AGGGAATGGGGACGAGAGTGACGCAATCAACGACCCAGACGCGCATGCGC
ACATCATGAAAAAGACAGCACCGACCAATAAGATTCGGTCTGCaccaacc
aatcagctgtcagCTCCCACTAAAAAAGACTCGAATCTTTCAAGTGAGCT
TAACTCTGTTTCACCTTTGTATAAAGTGGACAAATCGGCTTTGTATCCGA
CTAATTTCAAACCTTTCCCGAAACGGAATATCGGGAAAAGATCAAATTTT
AGCAGCAAAACGTAATAATGATTAACAGGTGGAATGTACAGGGACGGCGG
TTAGTATTTTATACAAATTCTATTTTTATGAGGGGAGGGTGC
Run BLAST on NCBI

transcript from alignment at scaffold_94:305363..348752+

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00073531 ID=TCONS_00073531|Name=TCONS_00073531|organism=Clytia hemisphaerica|type=transcript|length=43390bp|location=Sequence derived from alignment at scaffold_94:305363..348752+ (Clytia hemisphaerica)
CAGTGGATTGACGCATTGAAAGCAGTTGCTCGAATGCCTGGTGGAATACC TGCAGAGTGGAGAAAGAGGGTAAgaactgtttttcttttcttgtttcgct tgaaaatattttgttggtTTCCTTTCCGCTTTAACGTGCCTTCGTATTCT TCATTTTCCATCggttatctgtttttttttggctTTCTGGAAAATGTATT GATTTGTTATCAATCGTACTACCCGAGCCAGGGGTTATCTTTTATCTCAA CTTAAGTCACGGTACCCTGAAGCCCTACCTCTCTCCCCATATATCTATAG AGGAACAACTAGGGCTTCGGTAAAAGCAAAATGATCTGTTctactttatt ttgtttttgggACCTAGGAGCGAGTTTTGTGCCAAAGCGAGGTTCATTAA GGAGTGGAAGTTTGGTTGTGTAATAATTCGTAGTCAGATGGTTCGCTTAA AGAAATTCATTTGAAGCCGATCTTTAATCGTTATTGTTTTCAATTCAGAA TCTGTTGTTCTTATCCCTTATTGAATCATATCGAATTATAACTGTCTCAA AGGAGTACTAAATCTTGCATGGACTGAAcatttatttctaaaaaaaattc aatatgaAAATAGATTTAGGCTcacatttttaaatatttcattcCCATAG CCGCAAGAAGAGATACTCTTGTATTTCCAGAATAAAATTACCGAATATTG TATAAAATTTTGATGTGATGTATCTCAATGCATCTAAATGTTAAATGAGG CAGTGTCTCCGTTATTCATACATTGTTTACAGACTTTTGAATTCATCTTT CAAGTATGAATCATGTAtattgagaaaatcaaaaatatctcAACAATGTC AAAATAGAAAACGGcctttttgaaaactgaatcaaatttttcttcaacgt tttgagagttttgaaattttttaatctagTATAATTTTCAAGTCGATTGT TGACACAAAATCGTATACTTGAAACTTGTGTCTGCAGTTTTTGGCCGGTC AATCGAATCTTCTTCTGTTGGGATCGAGCTTGTGAAAAGCTGTGTGAGGA CCATCAGGTGTACGATTTCTAACCCACATTCCCTAAAGCTGAACCAACGA TGAATCTACAGATTTTCACAAAACTCCTTCTCTCGCTCACAATATTCAta aagacattgcaatgttCTTTTGTTCTGGATAAGCCAATCAACAAGAAGCT ACACAGAGAACTTTTCAACAAAATGTTTCCGAATTCTTTTTCATCGAAAC ATGGAATACCTGAACTCTACTCCTGCTTATCTAAAACCGAACCGCGCTGT TGCTCTTGTGACCGCCCAACGTGCCATCTGAGAAAGGATTGTTgctttga tgttgatttcataGACAACCCTATGCCATGGAATGTTTACATCGAACATT TAGTTTCTCAAAGAAAAGCTTCTTTTGATAACGGAAAATGTCTTCCACTA TCCGGAAAACTCTCCTCAAGAAGCAGAAAAGTGCAGCATATTTATGTTAC CAATAGATGTTTAGATGGCTTGCCATGTAACCAGAATCACGGGCAGAAAG TTGTTGGTATTTCAGGCAAGTTCTATACCAATCAACTGTGTGCACTTTGT AATGATGAACCCGGCTTTAGATTCCCGGAACTTCGAGTTCAATTTTCGAA CAAAATACAATCAATTCCAGTACTGTCGAACCTCAGTGATGTATACTTTT ACACAGCTGAACCTTCAGCTATTAATTGCCCACACGGAGAACTAACCAGA CCTGAAAAACGATATTCAAAGTGTATCAAATTCGAATACGATCTTTGCTT ATCTTACGTGGCGGTTGTGGGTGACGCTCGTGGTGGTTTTGCCGCTAACC CACACTGCATCAAATGTCTACCTTACTTCGCCAAACCAAAGGTTAATATC TCGGAGTGTGATTCTCTTAGACATAATCGATGGAGTAAAGATCCAGCAAA AACTCAACTGCTTATCAAGACAAATTCAAGTACTGCTACACTCACAGACA CTCAAAACGTGGAAAGCAACGTCCAAATTTGCGCTGAAGGCCTATACCTT GATGCTGAGACACTTTCTTGTCACACGCAACAATATTTTAACCGATTTCT CCAACCACCCATCACTGAAACCATTAACAATAATACTTCAAACCAAACGT TAAACAAAGCTCTACCCTTTATTCACGATGTTTCATTCGCTGAATTTCGA GCAGGTTTCGATAAGTTCATCATTGTCTGGTACCCTCTCTTGATTCCCAT CAGTATCCTCTCCCTTCTCGTGATCATCACAACCTGTATCACCATTAAAG GCCTTCAACACCCACCAGGACAGTGGCTACTTGCTATCACCTTCATCCTA CTATTCTACTTTTGTCTTCAATTTTTATGTGTCGTTTACGAACCTCCAAA GAAAGTGCGGAATTATATTCCAATACTAATCCACTGGTGTGTTGTGACCA AGTATCTTTATATCTGCATGCTCACGTACGAATTTATCGCCTTGTACCGT GGGAAACAGAACTCTCTGCATAATGTGGTTGTCCGNCTCACGTACGAATT TATCGCCTTGTACCGTGGGAAACAGAACTCTCTACATAATGTGGTTGTCC GTCTTATCCTATGCACTTCCCTCACCATGGCTGGTTGCGTTCTCTGTGGA TGGAAAGATGCCCTCATTCAATATGGCGAATGTCTCATCAAATCGTTCAC CGGTCGTTTGTTTGTTTACTGGGTTCCTATAGCAATCTTATGTTTCTCTA GCCTCTTCGCACTTCGTGCATTGAGGCTAAACATTAAACAAAACACGCGT GGTGCTTTAGATAAAGTTGATGCTCTTCTCTTGGCAAAAGCTGTGGACGG AACAGTACGTTTCCTTTTCATTGCCATCATTATAGACACGTTAGCCGTCA CACGATTCGACACGACAGTTGGCAATAGAGAGTTGTACCAATTATTGAAC GCAGCAATTCGTTTGGTGTTTTGCACGTTCAATTCCTTCCAAGGACTCTT ACTACTGGTCATCTTCATAAAACGCAAATTCATTATAATGACCTATCGCA AAAAGTTTCGGCGTACCGTCGCTAAATTCGTAAACGCGTTTTGTTGTGAA TGTTGTTTTCGTTATGATTTCGATGATGCTTACGTCACTGACGATGATGT CATTCATCAACAGAGACAAAATGGAGGACTAAACACCACCAGGGATACGG TGGTTTTAACAACAGCTAGGTCTTTAATGGGATCCTCTCGAGTGTGAACA ATAGCCGCCAGACAGTTGTACATTTGCGGACATTAATAGATAATCGTTGA TTTTTTAAACGAATGGAGAGACTCTGCTCCACTGTTCTATGAGTTGTCTA TCCAGTCTCTATATAAATTTCATATTGAAAGcttagtccgtataaaaaac tttggtctggaagcctattgttgtaactttttgttAACTTTGTCCTTTGT TAATACCGATTATAAAAATCtgtttgctcagtttttgatcacgtcaCCAA ATTAATCACATGAtaaaaaagtgagcaaaacaaaataatttctcaacgca agttcaagtccGCATtcaatagaaagaaacaaaagacttccagaccgggg tttctTATACGGACTATGTTGAAAGTAGTAACACAAAAAAGCTACTGAAC TAATTAAACAAAATGAAGCTTTGTTATAACaaaagaatatattttcaatG AGTGATaccaaccttcctattattcttATCTCTAAAGACGATATTAGAAG GGGTTGTCGATATTAGAAGGGGTTGTCGATATTAGAAGGGGTTGTCGATA TTAGAAGGGGCTGTCCATATTAGAAGGGATTTTAGATATTAGAAGGGGTT GTCGATGTTAGAAGGGGCTGTCGAAATTAAAAGGGGCTGTCTATATTAGG AGGGACTGTCGATGCTAGAAGGGGTGTCGATATTAGAAGAGATTATTGTA GCAGTATTTCAACGTATAGCCTTTTGCCTGAAAAAGAATGAAACATAGAA TGCATCCGGGTGGGAGTTGATCTTTTTTTCTTGGTTAGGGCTTTTTTTAC CTCGATAAGGGAGAGGGGCCTTTTTTTACCTCGATAAGGGAGAGGGGCCG CTATGTTTTGAAGTAGCCCTTAAGGCTGAGCTGAcaaatttatttctttt gtGAAGAACGCAACTGATCGTAAGGAGATATCAAAGAAAGGTTGGTCAAT TGATGGAGTTTATAGCATAGAGATCTCTGGTGAACCATCAATGTATCGGT CGATTCATTGCAAAATGTCTCTTCTCGATGGTGGTTGGAGAGTAGTCCAA AGACGCAAATACGGTGATATCACTTTCGATAAATCATGGAAAAAGTACAA AGCTGGCTTCGGTGATTTATCCAAAGATTTTTGGTACGGTAACGAAAAAT TACACCAACTGGCTAAACCCAACACTGATAATGAAATCATTTTCGAGCTT CAAAGTTCTGACGGTATTTTCTATTATCCATACTATGATCAATTCAATAT CGGTGACGAAACAGTAAATATCAACTCAATATTGGTGCATATCAACACAA ACCGGCGCATCAACAAATGGTGATGACATCCTCTACCACGATGGAATGAA ATCCTAACTTTCGACTCCGACaatgaaaaactttgaaaaaactatatata caggcttgcaaaaaaaaaaagtttatttcttATCCTCCAATCTCCTCCTT TCCAGTTCATAGTCATCAGGGGACTTGACTGGAATTTTGAGCGTTCCTAA AAGGaacaaaatctccaaatttgaaGGCAAAATTCTATTGCGCCGTTTGG CGGAAATCATTTGTAGGATGGTATATCCTCTTTCCACTGGAGAGGTATTG GCTGCAGTGGACAACATAACTTGCAAAAATTTAGAAGAGTTTTGGAACTC TAAAATATGCTGAGCCAAAAAGGATTTAATTGCTCGCAATTGACTTGGCT GCTCTTTCTTGAATTTGGCAGCGTTGACCTCAGCAAGCCAGATACTTCCC AACACTCCAAACGACTTTTTCAATTCATCTTTCAATTGTTGCTCAGTGCA ATCAATTTTGagatgaaaacttttaaaatttgagaaacagatgaaattgg atttttcaggtgggggttggaagatttttttaaatcaggtgggggttgcc caagaaggtgggggttgagtaatcttcaattttcaggtgggggtaagcCT ATGCAGGTNGAAGGTGGGGGTTGAGTAGTCTtcaattttcaggtgggggt tggaagatttttttaaatcaggtgGGGGTTGCCCAAGAAGGTGGGGGTTG AGTAGTCTtcaattttcaggtgggggtaagcctatgcaggtgggggtgac ttttTTTAGAtggggttggaggggtgttgcCCACTATGAGAGTGCCGATT TTTAGCTCCTTTTTAGTTTAGCCAATTAGTTATAACTTACTTAAATGAAC GCCAACTTCGAATTAACGCCTgctttcaatattattatgTAATATTAATA CTTAAAAGTGGTTTTCGATTTTTTCTCTCTTCAAAAAAGCGATAAGCTGC TATCATTTGGGAAGTAATTGATCTTCTTTCGGTTAGATGCTTCGtttaaa aagtcaccaaaatttcgagtaaacaaaccatctcattggctaaaagcaaa aacagtaaaacaaaaattttttagaGCATGAGAAAAATGTGCTTTCTGTG CTTTCTAGCATAGAAAGCCCACtattactcgaaattttggtgaaccTTTC TATACGAAACGACGAACcggaaaaaggtgtattgatcTTTTGTCAAGGTT AGATTCGCAAAACACGGTTGTCTAtcgaaattttaatttaatttatttaa ttcTCTTTGTATATTTCTCTTTATTTCTCACTTTTAGCACTTTGCACTTG TACTTGAATGTTtctaaaaattagaaaactatGGGAACTTTTTGGGCCTG TAATACATGAAACTGTTAgcaagaaaagatttttttagaaccaagtttat aagaacatcaggctgaaatttggaaaataaataAGAGTTCGTATTAAGAA AATGGCGAAACTGAGAATTGAAGAGATTAAAGTTTGCTAACAAATTATCT GAATTCAAATAAAGTAAAACTTTCGTAATTCCAATAATTCTTTTACTTCA AATTAGAGCAGATTTGTTTGACTTCAGTGCCATTTTTTTTATAACCAAAT TCTGTGGTATATTAATTTCAAGAACGTCACTAAGAACTTTTTAGGCTCAT ATACTTGTCAATAATAAGCACATCCAGCCTCcagaattaaaggttttgtt tttaaataagagtgatatcgtttgcttactcagcAATTTTGactcttatg taaaaataaaatctttaagacGTTCCAATAAAAAATAAGTGTATTTGTCT CTCCttatgtcaatttttttttcaaatcacagTTTGTTTCCATTTCTTGT ACTACATTCTTGAGGCTCAAAATTATTGTCCGAAATTAAGAGTAATTTGA AGTACAATACTGAACAAATAAATAGACTTCTGTAATTTTGCAccagaaat gaaaatgaaaacaacaatttgaggctcaacgTAAataagaaacaacaaaa taatcccTTTGctaacaaatttgttttctatAGCACTTTTCAATCGAAAG ATTTATAGTTTTTAAACCAGGAAGATCACGCCAAGAAACAAGTCAAAGAA CCAAGCATCAATGATTGTAAAGAAGCCTTCTCGTCTTTCCTACACCCTTT TCATGAAGCTGATTGAATAACCTAAATTTGAAGAGTTggtaaaaaagtca tttttttagcACATGGTTCTCATTTTAGCTTGACTTCTACAAAACTCTCT ACCTCCAGGCTAGAGCTCCCTGGAATTGTTAAATATTAAAATAAGTAAAC CAATCCAATCGAGATAGGTTTCGTTTTAAACTAAGTTGGTATTGTTtgtt tactcatcaatttaaatCACAAGCTTCTTCACATtaattgacacgaatgt ggagcagtATTTGTtcgaaagaagaagaaaaaagcaatataacaataggg agacaccgGCCTGATATAaaaatgtgtctgatatgaaacgggtaCATTTA TGTAAAACTAAAACATTTAATATAGAATTCAGCAAACAGGCTGGATATAC TGTATCTTGACCTGAATAAAACAGCTAAAGAGTCTTATTtctcaaaagtt tctaaaataatatgttcaatattttttacGGGGTCTTAATATTGAAAAAC TACATACTTCTTACTTAAAAGAttgatttatgaaaatttgaattaccTAA AGAGAATAATGACAATTAAATTAATCTTTACATTTATAATTAGCTAGTAA AAATTTATTCATATGTCGGCATTATGCCTATTTACATTACAAAACATCCA CCACCTTTTACAAcggactctcgctaattcgaactcatctataattcgaa ctcgTTTTAGTCGCCTTCCAGGAGATTCCTTTCGTGAAAAGCAcactata attcgaatctctccgtAAAACGAACCAAAGGAGGTTTCTTGCtcgagttc gaattaaagaCAGTCAACCTTTAACATTTGGACACTCATTTTAGATAATC TAGTGCTAGAGTCCACTCTCTAATGCGATCTTCAGAGGACAAACAATTTa ttcaaattagagaaagattcgaattgcagAGAACAATTTAGACAAAGGAG GGAACCATTATTTTATTTCGAATTACAGAACgtttcgaataatagaggtt caaattagagagagttaactGAAACATATGTAATTAATAtgttcaatatt cattcatgtTCAATATTCACAAAGCGATAAGTCCACCCCTCAGAAACTCA ACAAAAGTTCTTTCAGTTTCAACATCAAAAGAATCATCGTCGCTGCTTAC ATCTAGCTCAGCTTCTTTTTGCCTTTTCTCTGTCTGTTTCCGTAAATTCC GAAGTTGGCGCGCTCGAATACACTCGTCGTCTCGATCCAAGTCAAAAAAT TTACGGTATTTTTTCTTGATTCGTGCCCAACCCTTTTTATACATGTCTAG AACGCGTCCATTGATGACCAGATATCGAACGACAAAAACTCCATGCAAAG CGTTCGTTATGAGGAAAATGAATTCGCATACGTGGTTTATAAAGTAAAAA GCATCGCTTTCGGAAGAGTCCAACAAAACACTGTAAAAAGAATCTGTGAT CCACACCAGAGCGATAAATTTCATACACTGTTCGTAAGTCTGGATCAAGA ACTCGCTGATATGTTGATACTTTTGTACTGTTTGTTTTATTAACCGGGCC TCCTGTAATGCGGACATCAATAAAATTACGGAAATCCCGCACGCGATAGT GTTTGGTAGCAAGTAAAAGACTAAACGTCCTAAATACGATTCTAAATGGA AGgcgtgatttgattggccgatgATTAACAATACGGTTGCTACGATAATG ACACCTGTCGCCTGGACGACCAAATAAAAACGTTGCATCGATTTCGGTTT AGTGTAGTAATGTTGGAAATTACGTAAATGGTAGCAAAGAAAAGTTATGA GAACGTATTTGCAAATGGCACACCAGCGAAGGAGGACCACCATGTTTTGG CTCTCCCCCCAGGTGAAGTGTTTCAGGATGAACTTCAAATGGACCACATA ATACATATAAAGAACACAAGTTAATAAAAACATCACCTTCCCAGGGATGT GTTTTAATTCACGAAAATAAAAGAAGGTAATTAGTGTCCATGACAACGCG ATCAAACTAAGCATTATTAAGACAGGGGTCACGTCGTTCTGTATTTTAAT CAAATTGTAAGCGATGACTCGCAGAACAGGTGGCNCCATTATTAAGACGG GGGTCACGTCGTTCTGCATTTTAATCAAATTGTAAGCGATGACTCGCAGA ACAGATGGCTTTTGGACGACCGGAAGTATCTTTGGATATTGGTGACAATC CATATGATCTATGTCCAAATAACCATGCTCGCATAAAGTTATCTCTTCTT CCGCTCCATTTTCTAATATAACCCGCCCGTCTGATTGATACGCCCTCAGG ATCAGTTTTAAATCATATCCATGATCTAAATGATACTCGTGACGTAACCT TTTACAATTCATAACATGAGGTTTCGAACTGACTGTCTTGTTTTTATGTT CTTCATGTGTCGACATATCGCTTTGTGATGATGTAGCACACTTAAGACAT GACGGGTTCGCATATTTATGACCATCTTCGTCTACAACTGcagcaaaata agatttgcaagtTTTGTCATTAAGAGGGTTTCCACCACATTCGATATGGT TATGTAAGGGGCTCGACAGTCCACCAAAAGGGCAAACATTTTTTATTGGA TCATTGACCTCTATATGACACGTGTCTAAATATTGACTATCAAAGTCTGT ATCGTTTCCCAATAAGTAGTTGAAATACGTTTCATTGACGCAACGCGTCA GAACAATGTCGGGGTACGTAAAGTTTTGCCCATTACACGTGGCACAAAAT TCGTTGACGTAAAAAATACTGTCGTTGCCTTTAACTAGACGTGCGGTATT ATTGATATTTAAACACGTTTCTCCGTTACATTGATGAACTCCTAGAATAT ACTCTACGCCATGTCTTTTTGTGTAATTGCTCTCACGTATTACAGACATG CAACCCCAACCTTGGTGTTCTTTAGCCCGTGCAACCATGATGTTATTGTA TTCCGGTGGCCTCATTTCCGTTTCATTTGCCTCGTATTCAATGTCATAGC AACAATCATTGCGTTTATGACACAACGCATCGCATGAACAACAACGGGTT TCGTCCCCGTGCCCCGTTTCATCTACGTATTTTAAAGAGGGTTTTTTACA TTCATAGTTCGTCTTCATTTCGCCCGTTATGTCCTTGAACACGTAATTCA TCAACTCCTGCCGGTTTTCTTCTGGGTCCGGTGGTGGGAGCGTCGGTGGC GGCGGTGGTGTACCGGGCGGAGGAGGTCGCCATTCACGCGAGTCCAcatt tgtaataaaaatcatAAGTGACAATACAATAATAATTAATCCGCAATTCA TCTCTTGATTTTAGTTTCTCACAAGTGAGAGATCAACTTAAGTGTACCAA CTCGCCTGTTCCTACTTCTTTCCTCAAGTCGGTTTCTTTTTTAAAACCAT GCAATCATTagggaagaagaaaaaaacgaaaattgaaatttttgaaatac tgaAATAATGCATCCCTACAAAAACCACATGAAAGGTTCGATACAAGTTA TTCACGTTTTGTCATAATTGAAATTCGAAGTTCTTGATCTCATCGAGGAG ACCATTCATTGGACGTCTTTAGAAAACGTCAAATGGACCATCACAAGATG TCGTTTATTGATTTTATATCGAATCCATTGAATTAATGTCTCTATGGTTG TGGGAAagggaaaagaaaacattgaaaaatcacAATTCCATTCATAGCGT GTGCTGGCTGcactttttgtcaaattttgacAAGCTATTTCCGAATTTCT CTTATAAGAACTTAATTCAATTTTCCtactttcatatttttcttattaTG ATTTTTCTACATTGTTCCAAAGACCATTATGGTCCTTGCTGCTCTTTGAA CCCACCCACTGATTATTTTGAGCTGGGgtaaaaattagagtataattttc cgctggggacgatattttggacaattttttccaatgggaagggGTCTCAG TGGGTCTTTGAGAGAAGGGGGTATGTTTGATTTACTTCATTTTCAACGAA GAACTCTTCTTATTTTTGATATgggtaagtcaagatgacgacatattttt taacggaagcactctaaaaaagccggattttgacttccgtttttctattt ttagtaacagagaggggtcaaatcccggattttttcgggtgtttccgcta gaaaaatgacttacgcatatcaagaattcttATAAGAAGTTTCACTCGTT NTTAGAAAAATGACTTGAGCATATCAAGAATTCTTATAAGAAGTTTCACT CGTTCAATTCTTTCAATTCTCTAAAATGGCTACAGTATTGAACTATTTGG AACCCAAAATGAACACCTTGTCAAATAAATATTGAAGTTTTCGTGATGGA CATCTGAATGAAAAATCAATTCACATTTCATTCAATTCATGAATAGCCTA TCTTCACGTAACATCCCTTTACCTACaccaattttttataaaaacatcNC AGCCTATCTTCACGTAACATCCCTTTACCTACaccaattttttataagaa catcccaaaATTGTGAAGCCTTTTGATgttgttaactttttgagttttga gcctaAAGGTGCGTTCTTAAATTGATcattaatttcaccattttgtaagt atctttgtgcaatttcctaagaaatcggttgTTTTAAAAGtctataaagc cttaaaatgttctcaactagttcttgatattttgataaTCGAAGCttcgt gttcttatatagtttgctcttataaaaaaNAGtctataaagccttaaaat gttctcaactagttcttgatattttgataaTCGAAGCttcgtgttcttat atagtttgctcttataaaaaacgtgtattcatttATATAGTCCCCTTTTT TATGAACAAACCATTCATACCATTTATTAATATTTCATTTTGCTCACAGT TGTGacaccattttgaattttctttgtcGGGTTTATTTTTGGGTATATTT TTGACAACCTCACGGTTATGGTTCATTCCCTGTGTCAAGGTTGTTTGTAA ATGCGTGAAAGAACGTTTTGCTATTATAAGAGAATCTAGATCTTTTAATA GCGATCAATTTTTCAGCGCGTGGGAAAGAGTAAAAAACCACGACCAGCTG ACAATTTGATGTAAAACAATCTAAATAATAACCCgaaaaatttcaccatc atcatcttcatcagaaaatgcacgcttttttttaataagaatacacttta taagaatgtccatgatgaaaatggcataaaaatattaagaatatgctaag aatataaCCATCATGTAATTTTGCtcctcaagctaagaatgccattttta gagcatttttaattataaattgtcaattacccccaagtaaggttcgaaca ctcctttcacaaaaatgccatcttatgcttgagacgtatgtactaaatgt taaatctattcTGAGTTATGATCCTAAGCTAAGaatatgctgtaagaata ttttaggatgattttccctagaaagttaagaatatccatgatgaaatgaa tttacaccattcttataaaaaaaaagcatgACAAGTAGCGTTATGAAAGT TATGATCAGATATTAAGAGGCCTATAGAAAGTGTCAAATATCCTCAAAAG TGCTCGAGTCAGTTATTTTCCAACTCTGAGATATTcaattgtttgaaatt tctaaCGCAAAATAATGGcttaaatatgataaattttatTTGCAAATGTG CAGGTGAAAAGTGAAGGCAAGGCTTAACTGTTCCCCATGGGTCCTTAAAA TATTATCGACTTTCACTGTCATTAGCACACGTCAAGCAGATATATAACTT AGtgataaaatatgaaaattaaagGATTTTGAGAAAGAGAACTTGACATT ctcattatttattatttatttatttatttatagtaatatatttcgcaggt ctatcgacctctatgaaataatcatatttattAATAACATTTTGTAGGCG CACAGTTGGCCTCTAAATCAGTCgtctttacaatatttcattttcagtaa cgCTTAAGTCACAGCAGATCTTCTTNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNgaagtttcaactactttcgttttct aattttttttccgatgacaccgccgcgaaaggctatcgtaatactttcgc tatgcgaaattaataaattcAAGGTcgaaatcaataaaatcaaataaatc aaataaatgaaacaaaaatcagtaaaatcaaaaaatcacgtACGTTTATT TTCGGAGTGTTTCACCTCTCGACTtaaataccgtgaaaagcacataTCGA AATATCGATTCTTCCCTACATTTAAACCCACCCACAGTTTTtttgctaga cattaatatgacAATATTCtatcttcatctttgattctttctacaaaGAT TAGATTGACACGTGTGCGATAAAATTTGTATACTTGgtcgtcagaggttg atatgCTCTTTGAAAACTCTGATACTCAGTATATATGGCTTACATCGATG CGATGCGGCTTAGAACATcgggaaatttaaaaaattttgaggcTAATTTA TAAGTGAAATTGGTAAAAACATAAAATCGACTTTTGATTAATGACAGTTT ATTGGTACGAAAGAATTCGCACCACTTGCGCGAGAACAATTGAATGAAAG CTACTCCCCCGGCTCACTAGATCACATTTACTTagatacatttttttata tataagaaccagcaaaatttttctgaggcttggcttttcttatttttttg cactttcagcctcaaattgttcttatcctgttcttatttatacacgtttt ttttataatgaNACTAGATCACATTTACTTagatacatttttttatatat aagaaccagcaaaatttttctgaggcttggcttttcttatttttttgcac tttcagcctcaaattgttcttatcctgttcttatttatacacgttttttt tataatgaacctTAACTTAGCTCTAAGCCTGAAGCtccttatttttcaaa ttcaagagaATTTCAGCTCAAAGTTCCTCATTGAGTTCCTAATTTACTTA GCTGTTAAGTTTGGATTTACTTTACTAAGTATTTGACTTCTGTTCAAGTA TAATCTCtgtaaattttctctttttgaccCATTTGAATGTCGTTTCAGCA AAATGATTTTATCATCTTTTTGTTTAGGTTCGTTTAGGTTATTAGAAAAG TGTGAAACTGAAAGTTCAAGTTTAACCCAACTGTTCTTTAACTTGATTTC TTATTGTGATGTGAGCCTGaccagttccttaacaattccttacttttgga ccattttcattCTTTAACGAGATATTTATGGCAAGAAAATACCAACATTA TGGGATCCAATAAGTTTAGATATCATACTGCGCACTTTTGATGGAAATTA CATAATTCTAGAAACATGGCAATTATCAATCAACTAATTTGGAAAACAAG GATCCAAAACATAAAAACCACTTTTCTATATATAATAGACTTGGCATTCT ACTAAAATCTGTGCTATCAATATCCAGCAATAGCTAGCAAAAGGTAAACT TCTCTATCACTTATAGATTGACACCCCTGCCAGCCTGCTATAAATTCTTC TGTGGTATACTTAGTAAATGATAATCTGNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNAATAAATTCAAGGTcgaaatcaataaaatcaaataaatcaaataaat gaaacaaaaatcagtaaaatcaaaaaatcacgtACGTTTATTTTCGGAGT GTTTCACCTCTCGACTtaaataccgtgaaaagcacataTCGAAATATCGA TTCTTCCCTACATTTAAACCCACCCACAGTTTTtttgctagacattaata tgacAATATTCtatcttcatctttgattctttctacaaaGATTAGATTGA CACGTGTGCGATAAAATTTGTATACTTGgtcgtcagaggttgatatgCTC TTTGAAAACTCTGATACTCAGTATATATGGCTTACATCGATGCGATGCGG CTTAGAACATcgggaaatttaaaaaattttgaggcTAATTTATAAGTGAA ATTGGTAAAAACATAAAATCGACTTTTGATTAATGACAGTTTATTGGTAC GAAAGAATTCGCACCACTTGCGCGAGAACAATTGAATGAAAGCTACTCCC CCGGCTCACTAGATCACATTTACTTagatacatttttttatatataagaa ccagcaaaatttttctgaggcttggcttttcttatttttttgcactttca gcctcaaattgttcttatcctgttcttatttatacacgttttttttataa tgaacctTAACTTAGCTCTAAGCCTGAAGCtccttatttttcaaattcaa gagaATTTCAGCTCAAAGTTCCTCATTGAGTTCCTAATTTACTTAGCTGT TAAGTTTGGATTTACTTTACTAAGTATTTGACTTCTGTTCAAGTATAATC TCtgtaaattttctctttttgaccCATTTGAATGTCGTTTCAGCAAAATG ATTTTATCATCTTTTTGTTTAGGTTCGTTTAGGTTATTAGAAAAGTGTGA AACTGAAAGTTCAAGTTTAACCCAACTGTTCTTTAACTTGATTTCTTATT GTGATGTGAGCCTGaccagttccttaacaattccttacttttggaccatt ttcagcctcaagttccttataaacgtgttccttataaaaaacgtgtagga tgcaattgaggtattttaggcgttatacacgatttttactactttgacac cttgaaattgagtaaattATTCAGCAGAGATAAAAAAGTGTAGAGAGTAG AGATTCTCAAATCATCACTGACCGATGATGAAAGCGTAAACAggaaagtt ttgaaaacaaataaaccgtttctttaatctttatatACTAGATTCTCAAA TGTAAATCTTGCAGGTTTGTATCGGAAAAAAATCCGCTACACTACACACC AGGCAGTCCGGGTGGCGTAATCGGGCCTAAAAATTAGCCGCCGGCCAAAA GAGCCTAACATACGGNNNNNNGATAGAATGCCACGTATCATTGGTCTTTA TGTATTATCCTTTTATCTAATACATACTATACTTTTTATCTATTggatat ctatgtatctatgtatctatgtatctatatatctacatatctacacatct atgtatctacgtatctacataaagattaagaaacgttgtatttcttttca atacttaaagtttcttgctttcgcattcatcagttgattagaaataacta tcaaaacaaaattccacGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNACGAGGAAAGTGTTTGTCGATCAACTTCAAGA ACTTTTGTGCGATATTTGTTTCGACCGATTTGCTGAAGGGAGGGTTAAAC CAAATGACGTTGCGTTTTCTTTGGCGTGTCTGTGGTCTGTTCACTGTTGG TGTGTAGATTAAGTTGGTTTCATAGCCGGCGTCTTTCAAAGCCTTTTCGT AAATGGGttttgcttcattgaagattTGTTCATTGGACGAATGCTCCGAT AAGCGTTTTTCAATCGTTTTTGGTAAGAAaaacgtatctatgtatctacg tatctatgtatctatgtatctatatatctacatatctacacatctatgta tctacatatccatgtatctatgtatctatgtatctacatatccatgtatc tatgtatctatatatctacatatctacgcatccatgtatctatgtatcta catatctatgtatctatgtatccacgtatctatgtatctacatatctacg catccatgtatctttgtatctacatatctacgcatccatgtatctatgta tctacatatctacacatctatgtatctacatatctacacatccatgtatc tatgtatctacatatctacaaatctatgcatctacatatccacgtatcta tgtatctacatatccacgtatctatgtatctatgtatctacatatctacg catctatgtatctatgtatctacatatatacacatctatgtatctacata tccatgtatctatgtatctacatatctacgcatctatgtatctatgtatc tacatatctacacatctatgtatctacacatccacgtatctatgtatcta catatctacacaccTATCTACATATCcccgtatctatgtatctatgtatc tacatatctacgcatctatgtatctatgtatctacatatctacacatcta tgtatctacatatccacgtatctatatatctatgtatctacatatctaca catccacgtatctatgtatctacatatctacacaccTATCTACATATCcc cgtatctatgtatctatgtatctacatatctacgcatctatgtatctatg tatctacatatctacacatctatgtatctacatatccacgtatctatgta tctacatatctacgcatccatgtatctatgtatctacatatatacacatc tatgtatctacatatccacgtatctatgtatctatgtatctacatatcta cgcatctatgtatctatgtatctacatatatacacatctatgtatctaca tatccacgtatctatgtatctacatatctacgcatctatgtatctatgta tctacatatctacacatctatgtatctacatatccacgtatctatatatc tatgtatctacatatctacacatccacgtatctatgtatctacatatcta cacacctatctacatatccacgtatctatgtatctatgtatctacatatc tacacatccacgtatctatgtatctacatatctacacacctatctacata tccacgtatctatgtatctatgtatctacatatctacgcatctatgtatc tatgtatctacatatctacaaaTCTATGCATCttcatatccatgtatcta tgtatctatgtatctacatatctacacatccatgtatctatgtatctaca tatctacgcatctatgtatctatgtatctacatatctacacatctatgta tctacatatccacgtatctatgtatctacatatttacgcatccatgtatc tacatatccacgtatctatgtatctatgtatctacatatctacgcatcta tgtatctatgtatctacatatctacacatctatgtatctacatatccacg tatctatgtatctatatatctacacatccatgtatctatgtatctacata tccacgtagatacgcatatctatgtatctacatatctacacatccatgta tctatgtatctatgtatatctatgcatccatgtatctatgtatctatgta tctacacatccatgtatatatgtatctatgtatctatgtatctacgcatc catgtatctatgtatcaacgcatccatgtatctaattatctatgtatcta catatctacacatccatgtatctatgtatctatgtatatctatgcatcca tgtatctatgtatctatgtatctacacatccatgtatatatgtatctatg tatctatgtatctacgcatccatgtatctatgtatcaacgcatccatgta tctaattatctatgtatctacatatctacacatccatgtatctatgtatc tatgtatatctatgcatccatgtatctatgtatctatgtatctacacatc catgtatatatgtatctatgtatctatgtatctacgcatccatatatcta tgtatcaacgcatccatgtatctaattatctatgtatctacgtatctatg tatctacatatccatgtatctatgtatctatgtatctttatatctacata tctacgcatccatgtatctacgtatctacatatctacacatctatgtatc tacatatccacgtatctatgtatctatgtatctacatatctacgcatcca tgtatctatgtatctacatatctacacatctatgtatctacatatccacg tatctatgtatctatgtatctacatatctacgcatccatgtatctatgta tccatttatctacatatccatgtatctatgtatctattaTATGTATCTAT GTACTTATGTATCTATTAGTCGCGAAtagagaaaaatatattttccgaTA CTCAGATTTTGTGCTTTTTCAGGCAATCTTTAGtcagattttaaaaactt aTGAAAACGACATTTGTTCACAGTATGATTGATGTCTTCATTCCGGCATT AAAAGGGGCGGtaaaaagggcaaaaattttgcaaattttacttAAAATTG GCGTTAATTTTGATCATTTTTCTCTATTTAAAGGATTATAATCATGATTA AAAGATAAAAAATGATCCATTGTTTTACTACATATCTAAAACTTCGCAAA AATCCgtgattttcaatgaaagtttcaacagtttactactgaaaaatgat attttaatgtaaattgaagcataaaaagtcattctaacaaattttggcgt tactTACGatcctaattggcgtaagcccaaaatcagGCTGTGGTGTAATA AgtgccggcgtaaaaagggctgataaggTAGTTTAATAACCAAACCATTG TTTTCCGACTTAACTCTGTTTTGTTATATCACATTAACTTCTATGTCACT ACTTTAGAAGTAGAAGTTTCTCTCTCGAGTAAAAACTTTTGAGGTTGAAA AATCGCGATATTTACTTACGTAAATTcgacgaagaaaaaatattaaacat aaAAAAGACTTAGATGGAGAAATGCTTCTTAGATTGGTTTGAAACTGTTG CCCTTTGACTTATTACTATCAGGCTTTTAataggctaaaaagtgccatga atattacattttttcaaagtttgaagttttacagattttctatttgtCAC GAATTTTTCTCGAATGgctcttttaaaaatattcaaagacaTTTACCTTC GAGAAAAGGGCCGAAATTCACGCAGACCGAGAAAGTTTCTGCAAAATGTT TGGCTAGAACAAATCTTTGTGAAACAATTTcacgggtttttttttacaaa tccgcgaaattaaacaCTGCGAAACACAAACATTCcattctcaggattta aaaaatcaaatctaaaataataaataaaaaattctctcTCCGCTTAAGGT ATTGAATTGTATTTAGTTTGAAAAGGGCCGTCTTCATATCATAAGTTATT TggaattatattattttttcttgagAAGTGAAGACTAATATTTGATGTTA TAATGCTATAAAGGTATTGTACTCTAAGACTTCTATTCATTTATCATTAG AAACCAGAATAAACCGAGACTCAGATAGATTGATCGTCATATGAtacata aaatgattttttattttaacacaACCAGACGGTATGAAAATGAATCAATC AAATGAGCGAGTTAACAATTAAATAATGTAGATACAGCCTtgcaacaata gaaaaatataatgctATCCAAATATTATTTCAAAAGATATAAAAACAGGA TAATACAATAAAAAGTCTGTTCAAGGTGTGCGAGAGTTGGAAGGGTACAT TGTAAGATTTGTTGCATTTTATAAAGACATCCTCCCAGTTTAAAAAttta cccgattccgcaattctgcaaactttttctccaatttccgtcaaaccgtc taaaAATCTACCAAACTTCCGCCACGGAAAATATGCCTTTGAAATTCAag gtttttgtcaaaaattctgcgaattttgaatatttttagtcaattccgaa attccgcaaaactttttgctaaattccgtttttctgcactaaaattgtgt aattttccgtctccgtcggAGAACGTAATTTNtcgattttttttggtatt tctttagttttcgccattttgatgcatttcgacgagcacaaccagccaga aaaaaatttgacgtcaaaatataTGATGATTATGATATAtatagactggg aatccagtcgtttataacgtttttgttgaaagcgggaaatttttatgtcg ggatatggttaaaataaacgactgggctaaggtggtttccgtagcttacg ggagttccagcagggcccgcagatttctgcggggtgagaaaacaatctta tacaacaaaatatataaacaaataaaaatttcagccaatgagaatttcta agtgaaagaaaaaaaaacaaaccaaaacaaaccaacaaggccccctgaaa atgttatccaaaaacatgaaaaaagagaatttttatgaaaagtttgttgt gcacaaaatattctagacgactatattgatgcTCCTGTCAAGTTTTCTTC TTCCTATTTTTTACTGAGTTAAgtcgtctagcatgctagactatgATATA TATGATATGATTCTCATGTTCTTTGATTCACTTTGATTCCTTTTCTTTGA ACAAAATACATGTTAATGAAATTATGTACAATTTTTTAGTTCAAAATTCC TAATAATACATAGCATTTCACGTTATCTCTTGGCTGGAATGATGGCTCAA TTTTCCATTTGGTTTCCACCCCTCTCTTCCACGCAGTCCACGCAGAGGCA TCCTTCTTGAGCTCCGAGCATTTATTAACGTCGCTTGGGTGTAACAAGAA AAAGTTTGCGCACGTGGGCACTGGTGGAAGACCCGTCGTATCCATTTCTT TGCCGTTGCAATCTTCAATTACGACTCCACTGGAATTCGACACTAACCAC AGGCGTGGAATACAACTAGGGACTTTGATGAAAGAGAATCGGCTGTTTCC GTAGTGCGtattcagattttccaaaattttctccaCTGATTTAAAACACT CTTGATATGATGAACACAAATTGCTCTCTTGTTGTTTTCCCAGAAAATAT TTCTCTGCGCATCATGTAAGTCGGTACATGTTTGAGATAAACACTTCGTC CATTTTGAATGCCTTGTAAAGATGAAGAAGACAAAACTGCAAACTGCTTC GTTCGAACGTTAAAATCCAAGAAAACGTACTGTTTTTAGATAGATCGCTT AATTCTCCTTTTATCCTTTCTCGAAAGAAATAAGAGGGGAAAATAATTAT CCACAGCTGATAAGGAAAACCTTATAAAAAtctctttcttttcaaattct aTATTACTAATtcatattttttggaaattttactcAGTAAATTAACACCT ACTAACCTACAgaatcgaaaaaaataaaaggggaaaataattttccacAG GTGATAACGAAAGCCTTATAAATAAATAcgcattcaattttttttcgacg atGTTTTGAcctctttcttttcaaattctaTATTACTCATTCATATTTCT CGGAAATTTTATTCGGTAAATTAACACCTACATGTGTATTTACACCTACA ATGCTTCATAACACAAGGATGTGAAGCTAGAGTTCTTGTACAGCATTCAT CAACAACCTCATAGGTCATATCAACTCAAGATAACAGAGAACAGAATTCA GATAAAAACCAACGACCGTATTTGGGGTATTTGAATAGTCTTTTAACTCA TTCCATGATTCCCAAAATTATGAACGGATGCAAACTCCTGAATTTCGGTT CATTTGTTGGTATTTTCCAAGCTAACATGGTATTGGCAGTGTCTTTCTTC AACTCAATGCTTTGTCCAAGACTTACTGGATCCAGTATAAAGAAATTAAC ATGTGCAGGTATGGATCCACTTCCCTTCACATAATGTTTTAGTCCTTGGT TCGAAACAGTGTAGACATTTCCATCTGCTGAACCGATGTTCATCCAAGAT CCATCAAGTTTCTGAAGCTTAATAAAGGTAAATTGTTTATTCCCATATCG AACATCAACCTCCAGTAAATTTTCAACAAACTGATACCAATCCTGGTAAG ACTTATACAAAGCCAATTCTTGTTGTTTTCCGAGGAAATATCGTTCTGCG CCCCATACAAGTCTGTACATGTTGGAGACATAGAACCTGCCAAAGGAAGC CTTTGTCTTATCATCTACGTTTAAATGAGACATTTTTAAGTGTGTAGATA TTATCTGATGTCacttaaaaatgaatttaaaaaaagtaaacgaTTAGAAC ATCAGTAATTTTAGACTTTGAATATAATTGTTTATCTTTCCAAACCAAAT CTCGTATTTCAAGATTAATCTCCTCCTTTGAGGCCCTCCGATGGGCCTCC GATATATCTCAAAGTGCAAAGATCGTTGAGTTTAAAGGCTTTAGCTGATT ACTAGAGAGAAAACTTTCTCAAAGTAGTAAAAGTGATTTGCGCCACTTTT AGCTTGATGGGTTTAATCTAGCGTTTTTTTTGTCATCGAGCGGTACATTT TTGGAAACCTGATACCGGTTGAACCGGTGATGAATTTTATTACCACGTGG ATCATACGTCTTAGATCGTAAATAAGTGACTTCATTCCCCGTTCAAAATT TTCCTCTCTAGCCGCCCTTTTAACTAGCTTAGCTAACTTAACTTAAACTC GATAGCAAAGATCCATTATTTTCCAGCAAAACGTACTGCTCTAAAGCAAA GGGATGCGTTAAATGTAATAATCTTGTTCAATTGGATTGCCTTTTGACTG AAAACACGTGTAACCCAATAACCTGAACAAAAGCAATTAGAGaccttaaa atacaaaaatacacGAACATTCAGCCCCCGCAAAAtgtctttatttttta tattaaaagTAATGGGGTGTCGTTTACCCTTTCATCTGAGAAACTTGACA ATAAAAGAACCGACCTTCATTACAatatttacacgctttttttataagaa ccagtaattctttttttgaaatttacaagCTTAAATGCTTTATCGATGTT GTTGATACGCTaggttcttataataaaaaacttaaaatgggtTTAGTTCT GGTTGTTTGTAAAATCTGAGGCACAGATTATTCTTTTAATTTGTTCTAgg attttgatcatttttaatTCTTGTGTTCCTATAAAGTGTCCAcctttttt ataatcttttttattaggatttgactaggaaacagcCGGGGAAAAACatt ttgtccgctaatcagaggtttCCGCTTTTTAAAGTGTCCGCTAATTGAAG GTTCTACTGTAATTTCTTACATATTCTTGGATTTCAAAAATAGTAATTAG AATTTCATCCGttgattttctttcattttagttATATAAtctgaaataat tttcattttctggatAACATCCCTGAAAATGATATATGTAATCTTACAAT AATTAGTCCAATCGTAAAGTTTAGTAGATTATTAAAAGATTTACAAGTTC TCAGTTCAAAATTCCTAATATTATAAAATATTGTTGGGTCATTTGGTAAT CTGGGTCAACTTTATGCAATTCGATATCCCAAGTTAGAATACTCTCCCCA CTTCTCATTGAACTCTCGTGGACATTTTTCTTGAGCTCACTACATGTTTG GAGATCTGTTGGATGCAACAAGAAATAGTTTGCGCATCCGGAGACTGGTG AACTTCCAACTACGCTCGTTGATCGGTTGGTATTGTTGATGGTGATTCCA TTGCTGCTTGACACTAACTTCTCATTTCCACTTCCTCGTGTGATCTTCAT AAAGGAATATCGACTGTTACCATAATACATACAAGGAGTTGGCAACAGTT CCTGTACCAAGGATTGATACCATTCTTGAtatgatgaatacaaaattctt ttttgttgttttcccAGGAAATATTTCTCTGCGCCCCATGTAAGTTTGTA CATGTTTGAGATAAACACTTCGTCCATTTTGAATGCCTTCTTTCTAGATG AAAAAGACAAAACTGCTCTTATTCGTTCGAACGTTATAATCCAAGAAACC GTACTGTATTTGTTAGTAAGGTCTCTTAGAtagagtttgtttgtttgtcg aATCAGATTTCACTGTTCTTTCGTTtaaccctcctttttttcttgctCTC CCTCTCTATGTGTACTCGGCATGATCAGAATCACATTTTCTAATGTCAGG TTTAAAGTTTTAGAAATCGTTCAATTTGTCGATTCGGGTTGCCTCTAATA GTATTTGCGTAAAAATGTCCCTCTCAAAATATATTTAAGCCCTCtagttt ttcacattttttctgCACGCAATTTTGCTATTATAGGGAATTTATATACT TGCACTTTTGAGAACAGTGGAGTGACTGAAAAGATTTAGATTAGCCCGCA CTTCTTACCCGCaatatcgaggacggtaaaagtgatTGTttatacacctt tcccgagatGTTGCtatattttaaaggttttcaaaTCATATCAAAATTTC TATGTTTATGTATTATAGAGACGAATCGATCctggaaatttgagctcaaa agcTCTTTTCTATCACTGTATATGGCTATATTTATTCATGAAAATCGAAA CATACAGCCCGGCCTCGTTTTCATTTAAttatattgtttaaaaaaaaagt ttttaatttgttttgcaTTTTTCTACAGATTTTTATTTCACCAAAATGAA ACACTCAAACATTGTAACAAAAAAGTCGAAAACATCTCGGGAAAGGTTTA TTGTCGTTCTCAGttgatcaggatctagacaaatcacAAGATAACCGTCT CCGttgctgaaaaaaaaagatacataaactcgctaaaaaatgttgttcgc cgttggaaagatattttaaagagGATTATCTCAGATTCAAGACTTGAAAG ATTAAAAACATGACGTGAAAAGTTTTTCTACTGGTTCGAGAATGATGATA TGACACTTTTTAAATCAATTGAACTTTGCAGATTTCAAATCTGTGTTCAA ATGTTTTCATTATCTTTCTTAGATAGACAAGCCCTGCGAAATAGGCCAGA ACAAcctaaaatgaccaaaaatagcCACAGTAGACTTACTTAAAAGGACT ATGTAACTTTTATTAAGGAGAAAATATTATGAAAGATTTATTATTATTTG AAAGTACAGAATAACGATATACTAATGCTGctccttttaaaaatattaaa atactcCTAAGATTATAAAAGTAGACTGTGATACGTCTTTTGGTCGAGCC TTCCAAGAATGTCTTTTGACTTCCAAGAATGTCTTTCGACTTTATCATTC TTTTCATTGTAAAACACAGTGTTTGACTGTCTCATCTCGAAACGTGACAT GGGTGACATGGGTGACAGAACATAAAATTTCATCCGTTGTGCATCCTTAT TCCCTTTACCGTTAATGACGAAAATATTTGCGTTATCTGTGCTTGGTCGT AGTTTCGATTTGGTTTCGGACGGAAATTCGCTTTCCTCATCTTCATATGT TCTGATTTTCGTAAACTCGTTTGGATCCTGAGTAAGCACGGCATGAATAG TTTGACCAGCTCTTATCTCTTTTTTCATGAAGCAAACATCATCATCACCG TACTGTTTTTCGTCTTCCATATCTCTTGTAATACATTCATACCAATCTCC ATAAGAAGAGTTATNCTATCTCTTTTTTTATGAAGCAAACATCATCATCA CCGTACTGTTTTTCGTCTTCCATATCTCTTGTAATACATTCATACCAATC TCCATAAGAAGAGTTATAATTCAGAATGGTTTTTCCTTTCATGAATTTAT ACCTTTTTGCACCCCACATTAATCTTTTCTCTACACTGATGGTGCTTTTT TCATGTGAAGNTTATCTCTTTTTTCATGAAGCAAACATCATCATCACCGT ACTGTTTTTCGTCTTCCATATCTCTTGTAATACATTCATACCAATCTCCA TAAGAAGAGTTATTATTCAGAATGGTTTTTCCTTTCATGAATTTATACCT TTTTGCACCCCACATTAATCTTTTCTCTACACTGATGGTGCTTTTTTCAT GTGAAGGCGCTGGATCGGTGGCCTCGTCGCTTACGTCGCTCTCAACCGAT TCATCTAACATTTCTTCTAGNGGCGCTGGATCGGTGGCCTCGTCGCTTAC GTCGCTCTCAACCGATTCATCTAACATTTCTTCTAGATCAGAAGCCTCAC TCCCTCTGCTCCCCACTAAATCATCACATACATCGTTTTCTTCTTCGCGT AACCTTTTCTTCAGCTCTGTGTTCTGGCCTTTTAGAGCCTGATTTTCATC TTCTAAATAATTGTTTCGCTCAATCAAGATAATATTTTGTTGATTCAATT CTCTAACTAATATCTCAGAAAATCTaggtttccttgttttttttcgagaa aaatccATATCTTGGAAAAATCAACACCAATTTTATCTTTTTACCATTAA AACATGacaacacgctttttttaaaaagcgcgcttcgttttcttttattt atcgCACACGAGGGAGTGTTTAACCCTGTCTTTTTGGTAACAACTTGCTC CTAGTTCGCAATCACCTTAgatctttgaaaaaacttctACATCTTGTTTA TATTTTGTGTCAGATTTCAAGGGTAtacaggtttttttataagaacaaac tatataggaacataaggcttcgaaggccaaaatgttaagaacaagttaaa aacattttaaTGCTTTGCAGGCTCCAAAGCATCGAATTTCTTAGGAAAAT GGACAAAAATACTCCAAAAACGGTGAAAATAAGGATATGTTAAGAACATT TTTAGGCTTAAAACTCAAATTTTGGATGTTCTTATGAAAAAAAGTGTATA CGTCTGTATAAATTCCTTTACTCACTTCGCATCCTCTTTACCCTGGAATC GAATTTCATTGTTATTTTTTACAAAATCGTCTGAAGTATTGACAGTAAGG TTTCCGTTAACAGCCAGCATTTAAAATTTTTACCCTTCCTCATACCCAAA AATTAACTTTATAGATTATAATTTCTGCTAAAATTACTTCTTTCACCATA ATAAATTCCGTTAACCCTTTCCGTGCCCACGAGGGAAAAAATGTCCGGCG GGAGGAAATGAAAAAAAAGTATTTTGAGCAGCCGATGACATTTATATTAG TTGTTAGCCGCCAGGCCCAATGTCAAATATACTTTATGACTTCTAATTTT TTTCCCAGTTTTTTTTTTGCGGCTACTCAATTGATTCTAAAAAGCATTTC GCAATGTCAAATATACTTGACATGGGCACGGAAAAGGTTAAAGGTATTCC TTTTACACAGCCTCTTGTCGTTGATAAGTTAATAGTTGAACTTTGTTGAT AACTACAGTCAACTCTCTATAATTCGAACCTCTACCGTTCGCATCTTTCT ATAATTCGAACTAATATATTGGTTCCCTCAGCTAAAAAGTAGTATAAAAA TAGTCTCTGTAATAGACGATAACGGATTTAGATAAATGCAATGCATTCTG GTTTCTAGGGACTCTCAAAGGAATTATaatctattataattgatctatta taattcctttgagagtccctagaaaccagaatgcattgcatttatctaaa tccgatatcgtctattcaaatccttctcctattcgaagaaaattcttggt ctcttgaagatcgaattagagagagctaACTGTAAAATCGTCTCGTTATT ATCAGCACCATAAGATAACAGATTTCTCATAATTTGTCATTGTTTTTTCC ACAGACTTGGTTATCACTGGCTGAATTCTTCTTGAAAGACATTGAATGGG AGGGTATCAAGAAGACATGCTTCAACGATCGACGCAACCCTGACGATGAC GAACTGGACACTCAAATCGTCAAAGTAAGTGTAATTTGCTGACCGCAATA TCTAATCATTACTGTATAAACTACTGACCATAACATCTCCTCAGtactgt ttaaaaaaatttttccccagTATATTATTTGACCAGAACACTTTGCTCGG AGTAAATTGTTGACCAAAATATCTCATTTACCCATTCTCATCTCGGTCGG ATAAAGACTCGCAAGAGAAACGATGCCTACAGTTTTAACCCATGCGCTTT GATAAGATAAGAAATTTATTATACGTCTTTAGAATCAAAGCCGCCTGGTT AATCTTTTTGCCTATTTCTGTCAACCTTCATTCGCAAAAACCTTGCTTTC ATACTTCAAACGAGACCAACTCATTCACTTCCCCATTTCTCTTTCTAAGG ATTTGCATCGTACAGGGTGCGGCTGGTTTTTCGAACATGATACGGCCGAA GACCGCGCCAGTCTGAAGCGCGTTTTACTAGCGTACGCGCGTTGGAACAA ACAGATCGGATATTGCCAAGGGTTCAACGTCATTGCAGCTCTGATCTTAC AAGTCATGGAAGGAAACGAAGAACACGCACTCAAGGTATAGTTTATATTC CTTTGCTTAAATACAGTGTATTTCTAAAGAAAggcaaatttttataaaaa aagtgaaatccTCAAAACGCATCATCTTAACTGGGCTCAAATTGATTCAA AAAAAGATTAGAATTCNAAAGAAAggcaaatttttataaaaaaagtgaaa tccTCAAAACGCATCATCTTAACTGGGCTCAAATTGATTCAAAAAAAGAT TAGaattctctgttcaatcaatagatattcaattcttaaaataattgaat aggtttttgagattgaaatatatTCATTATAGAAGTCATAAGATATCGCA TGAACTATGATGATTttatttcatataaaaattttccgCTTTTTTTGAGA CGCACTGTACTAACAGATGTCTAAAAACAGGTAGGAGGGGGTAATTaagt tttccttattttccagtattttaagctttctcctattttTCATCTGcttt taaatttagaaattacccaaatttttagtcggttttcattattagtcggc ccttagtgactaaattttgacgaggtgactaaaattaggtccgactaata attaaggccgactaataatcaaggccgactaataattaaggccgactaaa attaaggccgactaagttttggtcgATAAGGTATAAAGATCAGGTGACTG AATGCAAAATGAGGaacttttcttttgactgctaaaaagtattttcaaaa aataataaacttgGGGTTTTCTTATTAAGGTCTGCGGCACCTGAAAGTAC ActgtttcaaaattatttctctGCTTTGAGTCGGTTTAAATTGCCCGAAA ATAAGCTATGATATATAATTCAACCAATGGGTTACTCCCCCCTCCACCGA TTCTCAGCAAAGTGAATATTAAAGTCAAATCTACTGACGATATAAATTTA CTTCAtataaattttgtaatttcccttgTTGATTGAATTGCTTACTGGAT CGTTGTATCGAGNTATAAATTTACTTCAtataaattttgtaatttccctt gTTGATTGAATTGCTTACTGGATCGTTGTATCGAGATCTATGATAAAAAG TCAACATAAAACAACTTTCCTTTTCGCCGAGCGAGGTTAATTTTCCCCTA TATTTGGTCTAGATTAAGTTCGTATCACTTTCTAATCGTTATTTTGGCAA TGGTTGATTTGACAATTACTGTAACTTGGCTAATTTTCAACCAAGTGTGG TTTGGTGATATTGCATTTTGTTGGCTTGATATATTTTCGGCTGTTGTACT GCTCATGATATCTTGTTTGGTGTTGGTTGTTCTATCTTACGACAGttata gtgtggtcgtgttacaaaaatacaggctgtttgtaggaaaagaataagat ccagctgaaactttctccagaccttctctataggatNctgcgtgaattat cttgacttaggtaatgaaatcggctatacccgtttgaaagtcttctatat agtttttcgagagctttcgaatggtatattTGATACtgtaatgtctgaaa atgactttgaaattttcaaaaaattttgcccttagggttttgcctgggga aaaaagaaatgtcccaaaaaaaggatgttccaccagtgggattttagggg aatttttcctNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNaggggaatttttcctgaggc ataaccatcctatagagaaggtctggagaaagtttcagctggatcttatt tttttcccttaaattatGCTAGACAACCCCACTATTACATATCTATTGTC TTCTCTTTACAAAGGAGAATCTGTAAAATGAAATATAGCCGTTtgcattt ttattatttttaaggcGTACATCGTGAATACTCTTTCTCTTTACTTTAGC CCATTGTTATACTTTTACATTAGTTACATTACTCACCAAATCCAATATTA GCAGCTAAGTAAATAAGGAGTGAATGGCCGTGAATACGTGGGGGTGATAT TTTCATCTTTGTCAAAGTTTCGATTTTTATGGGCGTGATTACTAGTTTTA GCTCCCATAACAAGGCTAAAAGCTTCGGGACAGGCTGGAGACTTAAAaat tcgttttcaagcaaaaagcaaCGCGGATTTTATTGTTGTAGTTTTCAACA AACGGGTCAGATCGACACTTGccatatccctttagagcagaACATGGTGG GCTCAGAACGGTTGATCTGTTGAGAGATTATTTATGACTGCTTCACGGAC AGCCCTCGATGAAAAACGAATTTTGTTCTAGAATTAAACTTTATCACCCA ATGAACGAAACAACAGATCTTAGAAATAACATTAACTTTGTTAACTACAT CATTTTCAGGTCATGATCTTTTTGGTGGATTATGTGCTTCCTAGAAACTA TTTCTCCAACAATCTACGCGCGCTCTCCGTCGATATGGCCGTCCTGCGTG ACTTGATGCAGATGAAACTTGGCTATCTCGCAAACAGGCTACAACAGTTG CAGAAAGAGGCTATGGATGGGTCAAAAAACACGTCTGCAAGTTATGAACC ACCTCTGATTAACATGTTTACAATGCAATGGTTTCTGACCCTCTTTGCGA CCTGTCTGCCAAGGAACACAGTATTGAGGATTTGGGACGCGGTCTTGTTG GAAGGGTCCGAAGTACTTCTTCGAGTTGCACTCGCTTTATGGGCCAAACT GGGGAGGTACGATATTCGAAAAATTACTTAGCATCCATAGACGCTTATTA AGTACATACCTATATATTTCAGCTAATGACATGGTACGATAGATATAGAA TGATAAGCACGGTATACATTCGCTCACCATCTGGATAAGACTTAACTTGA ACCGCAATgaactgtgttcgaatcccaagcacttcCAGGGAGGGTGTtcg ggaaatatggtgatagactctcatCTTGACTCGTATACCACTCAATGATG CGGAAAGGAGGAAATCTCTCACTATCAATGTAGGAACATATTAAGAACCA TCTGATTATCAGATTCAGGATTACACAATACAATTAACTCTTTCCCTAAT TCGTGAATCTCTGCAAATCAAATCTTTCATCCTTGTACTTCAACCTCTAA CTCTAACTTTCTTTTAGCTGGGAAGTGGTTGAATATGCTGTAATTCGAAT CAGAGAGATTCAACCGTACTAAAATACATTGTTTTTCTCACTTATTCTGT TttatttttccagttttttcgATGAGGTGGAAACAGCAGCAGATTTCTAC ATGACCATGGGGAAGTTGATCCAAGAGCTCATCACAGACGAATTCATACT TGTTCAAAAACTTATGCAGGTTGGTTTTTATTCAGCCCAACGCAAAAAGA GGATTCAGTTCACTACGCTCTCCTCGTAATGTGTATAATCCTTGTTTCCA AAATATTGTTGCCAAGATACTGCAACGCCGTCAGACATGATTAATGTTTG TAAGGGTTTGCGGTTttgtatcaaaattgaaaatgatctTTTGAGAAAAC ATATTACACGTGTCAATGACGtttgaaattattatttcatttgaaaacga ggcctgcTGTTTATTTATCTCAAGAAGTGTGAATTTCTAAGCCGAACAAT CAATTTAACAACTTGAGAAGATATTATTATTCAACCTTGATTCACTCCGA TGGTCTACTCCCCAATGAAATTGTATTTTCTATGTTGACGAGCTCATTTA AGAAGGTGAAGCCGCCCCCTGATTCTTGGGTAATCTTTGAGATACCCTAT TGATTCTTGCTCATTTTGATGACTTTCCGATTCTTGCTCATTTTGATACT TTCCGATTCTTGCTCATTTTGAAACCGTTCGAAAGTCATTCATACAGTAG TATCCTTTTCATAATAACGTGCGTCATTTTGTAATCAAATTCTTTTCATC ACCTGAGCTGAAATTACTTGCCCGTACAATAAAAGTGTGACCACTCACTG ATATTTAACTACTTAACGGTATCCAGCTTCCACTATAATAGAAGTTGTTT CCAGCTTTTGAGCTGACTAGTTCGTTAAGGATTCGAATGTTTCGATATAA gaacgttcgaaaatctgaaaaaaacgaGCATGGCGGACTAGTCGACTTCA AAACTACACACACTTCCACGGAAAACCTGTGAGCAATTAGCCTTTTAGTG TgtattataagaatatcatagCTGTAGTAAGTGTGACTGTCTGAAACGCT GTATGTGATACCCCTGACGCACAACATAACGTTAATATAAACGTGCAACC TTGTTTTCCACCTTTCAACCAATCACGCAATTCCCAATCAATGACACTGC TCTTTTTAAGGCTGTATATCAGATGGCATCCTTTCCATGGGTCGAACTGA CGGAATTACGAGAAAAATACACGTACGATATCCATCCATTTACGACGTTC AGAGAAGAAAAGAAACGCGAAAAACTGAAATTGCAACGACAAATGAACAA ACCTCGTAAGTTTCTAGTATTCCTTCTCTTCTAACCTTTCCAATTAGCGT CATCCCTCTTAATGTTTCTAAAGATGTGTCTAattgtgtaaatttgaatt ttccgAGCATTAGAAGGATAAAATTATTCATCTCATTAGGAAATAAAGAT AAAGTTAAAGTTATAAAGGACATAGAGCTTCGATTACCAAATATCGAGGC CCCCtcttaaaatctcaagattgacaagtgctatgaccttgaaattttga ccataggTAAATATGGATAATTGAAGATGATTTGCATAATTTTGGTTCGG CCACCTGTCTAgttagtattttacagaccagaatataaacttgaccaaaa tcatgtattgactgattgactcgtttgatttgactgaaatttgttcctga aggctgatttgtcaaataaaagagaaataaataaaaattcgtAATTCGTT CCCATgagtatttggtactttgcTGACCGGTCTGTAAGATACACGTTGAC GCCCTGCCGGAACTCAGGAACTACTGGAGCTTTTAACTTGAGATATTCAC CAGTGATAGTAGATATTGACCATCTAagacagtgtgcaaaatttgaattt agtcACGTGAGCAGTTCGGTATTTTACATACCGGTCCATTTTTACCTAAA ATTATCACTTTCAGCATAACCATTCGTACGACTTTGCTGATGTTTTGGCT ACAAGCTTGTATCATCAATACctaatttgtcaaaatttcaagtcaatagc attttccAATCACCAGATACAGTATCCTAGGGCAATTTTGagccagtctg taaaatacacgatacTAACAGGTGGCATAAAATTGACCTTCTACCCCGAA ACGAAATTTTCACCAATGATGCCAATTCATATTTTGGTGCACACTTGCAT AATTTCAAGTCAGTTGGatagatatttcaaaagttatcaaaaaaaatccC TCTttgtcagcccccccccccaagattCTCCGAGGGCTAATATTTCgttc ataaagaatgaaagttaGAGTTATGGCATGAAAAATGTGTTCAATAGATC ACGTtacaaatcttcaaaattttccatcATTATTAAATATTTGCTAAGTA CATATTAATTGATGTGAGAAAACATGTTGTTGTTCAAAGAAGAAGTAGCT CCATGTGGAAGAATCAGTAAGAGGAAGTGAAGAAGAGTAGAAAGCGAAAG AAAGGTCTTTTGCAAAGCTGTTGTTAGTTTTTGACGATGTTTTTTGATCG AGAAGAAGAGTGTAGAATCCAAAACATCGTCTTCTGGTATTACAtcatac aagtttttttatgagaacattcaaaaagttttgaagccttatgatgttct taacttttttagttctaagcctgaaatgttcttaatttgttcttaacatt tttaccatcgaagcctcatgttcttacatagtttgttcttataaagagaa CGTGTAGACCCAATAGTTTATTGGTTGTAATCCAATCAATAACCAATCAA GTGTTGCGtctatgatgtaatgtcagaagacgtTTAAAATGTGCATATCA CCAATATGCatattactcttgtctcccgaatagacgggggggggaggggt ctgaataagcaggggggtaggaaaattttttaaattctaataagcagggg ggctggaataagagggggggggggggggcctgaataagcaggggggtagg aaaattttctaaattctaataagcaggggggatggaataagagggggggg gttaatttgaagacataattttttctaactggtatcaatttcaacaacaa aaaagaaactttaacaaatgaacacatgtaaaataagaaccaatactaac aaaatggaaaattttagaacaagtttaaggacatgttttttttttgactg taccaaaatgccgattttcaaccaacccggttcaaatcggcactcacaga gacagctgaaccctttcttatcgttattcaaaaataaaaaaatagattaG TAGCTCTGTCCGATACANTTCACCAGTGATAGTAGATATTGACCATCTAa gacagtgtgcaaaatttgaatttagtcACGTGAGCAGTTCGGTATTTTAC ATACCGGTCCGTTTTTACCTAAAATGATTACTTTCAGCATAACCATTCGT ACGACTTTGGTGATGTTTTGGCTGCAAGCTTGTATCATCAATAcctaatt ttgtcaaaatttcaagtcaatagcattttccAATCACCAGATACAGTATC CTAGGGCAATTTTGAGCCAGTCGTAAAATACACGATACTAACAGGTGGCA TAAAATTGACCTTCTACCCCGAAACGAAATTTTCACCAATGATGCCAATT CATACTTTNTTAATAGCTTTTATGGAACTTAAGATATTGCTTGTTGAAtc cggagtatttcaggatgaaaaaaatcatagtctATTTCGGATTTATAAAG TCGGCTCTATATTTTGCCTTTGTCGTGTCCTATTTATATACGAAACTTAT ATCAGGGTTTAGCtaaaggattgaattttcacatcgatctcttttttttg gaaaaaaacggaggaaaatgggatcaaattgatcatttttgaaatctagg tgctaattctaatcgtatatattttccgacaagtctatctatcggggagg tgatttgagatttttgtttagttgataAGAAAGGAACNAtcgtatatatt ttcctgacaagtctatctatcggggaggtgatttgagatttttgtttagt tgataagaaaggaacgaactaaagaaaacgGGAATTGTTAACTCACTCcg gcctttaaaaaaattactcctcgggctattttatgattttaggctACCTC ATGCATGCATAGAAACCTCCTCAGGACCGAACAATGAGTCATGGAGTGAG ATATGATCCAAAACACTCCATNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNatggggggggg gggggtcttaataagagcggggggatggatttttttgtctcttaacaatt agcggggggacgtctattcgggagacaagagtaagtgCAAGgagactggg ttctaataaacatttttgaagtcttagACGATGTTATGATTAGCATTACG ATTATTATACAACGATTAATATATTGATGCATCGAATCTATCCATTGCTT TGGGGATTATCATTAAAAGTCTTAGCACCCATCTCATTGAATTATTCTTG AAACATAACCGTCGAGAAGAATGATGTACAACATTTATATTCAACAATCC TTAAGGGAGCTTACATTCTCCACTTACCCCTTTTATATGTTCAACAGACT CGGTAAGAAGAAATGATATGTACGGTCTTTTTTATACCTCTAGAAGGTTT TGCGTTTTTTTTTGTCTGTctttctgtctgtctgtctgtttgtCTACTAC TGCAGTTGGACTTCGTTTACTATTTTAGGcgttattttgatgttttttct taTTGTAGCTGATTGTAGTAGTAGAGATTTTCTAAGATTTTTCCATTTTA TTAAAGGTTGTTTGAATTGAAACTTTACTAAACTTAACATATGGGAACAA ATgatatttgcaatttttcgaatGATCGCCAGTTTAATGATTACAAATGA TTACAAATGATATATAATGAAAACGATTTGCGATATTCATCTTATAGATA GCAACCAACTAACCAACTGTGCTTTCGGAGGCTAGCTTCTTTTACTTGAC AATCAAAGTTCATTTTGTCATCTTTTCctgtttttccttttctttatttt cttatttttccttaTATAAGCTCCCTGCTGTCAATCCACTTAAAAAGCCT TTGCTGAGTACCTTTCACTTAGTTTTTTGAAGAAGTATAACCTTATGGTG ACAAGTTAATTCCTTGGCCTTCCAGATTTGGAACCTCGTGGCTAATTCCC TGGCAATATTTACACGGAAAGTCTCGACttcaaaaagttatatttcGCCC TTTTTTGGGTAATATAAAGTCACACCCAAACCCTCACATGACCAAATCTA CTCAGACCTTtttttgaatagaccttttgaAGGAAGAGAAAGATTACATG GTTTTTTATAGGAGCAAAGTATATACGAGGCGGAAAAGATGAGTAATACT CAACATttagaaaacatttaaaactctaaaacgtgaaatttcctaggaaa ttctACTAAGAatactgaaaataagaacaacttaagaacatttttaatat TAAAACCCAAAAGTTAAGCACATTTTGTCTTCAAAACGTTTGgacgttct aataaaagaaaacgtATTATGGTTGCTTAAAAATAATTTCACCAGCCGTT TTAGTGTTCCCTACTGGGTCTATTTTCTTAATATAGAAAACaaaatgaga aataaatggaaatATTTTGGTGAGATTATCATCACAAAGCATTCATCACt tcatcaattttattgaagatTATAGAATTATAGATTATTGGTGTGAATTA AAGTCAAGTTGGACCACAATATGCTTAGGATTTTGTTAACAAGAGTATGT ATGATGTACGATAGTCGTGTTTAAGTTAAGTTGAACCTGTCCAGATCAAT TCGACggatgggcttttccagaaaaaactgtataccccctgttgaggagg tccatttttGTTGTTCCAAGGGATTAAGGTTtaatatgtggcggaattcc atagtgagatacaaaaatctgtcaaaaataagtgGAATTCCATGGAGGTA GCTTTTTCAATCATACTAAagttcagaattccagagggtttTAAAcgtga aattgcctggaattccagggggttacatCATTTCCAGCCACATAGGGATG GCCCTCCTCAACAGgaggtatacggtttttttctggaaaagcccaatgtc cAGGCTGAGGGAAAATTATGGGAATGAGTAAACAAACATTCTTATTTTAC ACCTCTCTCTTTGTTTCTATTCACAGCGAGCGATGAAGAAGAATATGATG ACGTCAACGACGATGACGTCATGGTAGGTTGTCTTGGTTTCGTTGCCGGT TCATCGGACACGCCACACCTCATGTTATCATCACCTAATAAACACAACAA AAACACAAACTCGAACTTGCATTCAGCACAATCAAACTCTTCTTCAAAGA ACGCCAAATCGTCCGCACAACACGTATCATCTAAGCAAAGGAGGTCACGT CAAGATGTAGCTTCTAAAAACGATATTACAAAAGTCACACCAGGTATGTT ATGCTCTTGTTGTTTTGTTTCTAGACATAAAAGTTACCCCTGATAGTTTA ACCCACCAGGATTTTAACCTAGGAAAATCAACCCCCTTGCCTCATGGAGT TTTGCTTTGGTAGAATGACattgaccttttcataaattgcgTCACGAACA Tcccttgcctcgtattcaaacaattaccatggtaattatgtctcttgaga cataaaatgatttttttatgaatagaaggtatagttttgataaaatccgc tGTGAAttaatcaccatgacaataGTTTCAAAACGAGGTGAGTGATGTTT GTAAcctaatttatgaaaaggtctgtTAATGAATGACATTGTTACAGTTT ATATGAACTAATATTATCTTATAATAATTATCGTCTTATCATATAgcacc catattactgtattatcatatagcacccatattactgtattttCATATAg cacccatattactgtattatcgTATAACACTCATATTACGGTATAACacg gattataaacgactccagtcatTTGATTTGTGAACGCTAATCAGGTTAGC ACACTCTGGTCGTTTCAAAGTCAATGCGACGTCATATTTGATTATTGTAC ACGGACTTTGTTTTTACGTTTCGTAACCGTTGAGAATATCCTACCGGGTG TCCTAGAAAAAATTTCCCctctttgaattgaattttctcgagttctataa ACTGTTATAGAATCaatctttttgcattggaaagaggaagggtgatgaac ttaaattttgaggggtagtttgtcaaatttggtcacCTAGATCGAAAGTT ATATGTAggctaaatgctaaaacattacttttcaaaaaaaagacaCCCGG TACCGGTTAGAATAATATCTGTTGATCCATTCTTTCAGGTGCCTACATCA CAGACCAAGAAGCGAGAAACGCTTACAAAGAACAAATGAGAGCCAAAGAG TTGATGAGAGAGACTGAAAAACTTGACGTCAATAAATTACGTAATCAGTA CGGGCGTATGAGGCGGTTACAACAAAAAGCAATGCTTGTTTTCAACGCCG ATGACTTTAAAGATGAATCTTATAAAGTGAAAAACCCGCCCTCCGCCATC AATCATTTATTCGTTGATGTTAATAACGTGGTCGCTCCGCCTAGAGCTCG ATATCGAAAGCCGAGTAATTTTCCCGCCCTCAAAACGCTTGGGAAGGGTG GACCACCCGCACCTCCCCGTCCAATCAAAGAATCACCGAAAGTAGTTCAC GAGTCGACCAGTTCCAAAGGTGAGGGTGAAACaaaaacttctttaaaaaa acaggACAGTTTCTCTATCACCAACCCTTACGTCATGTTAGAAGTTCAAG GGAATGGGGACGAGAGTGACGCAATCAACGACCCAGACGCGCATGCGCAC ATCATGAAAAAGACAGCACCGACCAATAAGATTCGGTCTGCaccaaccaa tcagctgtcagCTCCCACTAAAAAAGACTCGAATCTTTCAAGTGAGCTTA ACTCTGTTTCACCTTTGTATAAAGTGGACAAATCGGCTTTGTATCCGACT AATTTCAAACCTTTCCCGAAACGGAATATCGGGAAAAGATCAAATTTTAG CAGCAAAACGTAATAATGATTAACAGGTGGAATGTACAGGGACGGCGGTT AGTATTTTATACAAATTCTATTTTTATGAGGGGAGGGTGC
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_045639XLOC_045639Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073531-exon-scaffold_94-1491911889:305363..305431TCONS_00073531-exon-scaffold_94-1491911889:305363..305431Clytia hemisphaericaexon
TCONS_00073531-exon-scaffold_94-1510915933:305363..305431TCONS_00073531-exon-scaffold_94-1510915933:305363..305431Clytia hemisphaericaexon
TCONS_00073531-exon-scaffold_94-1575043694:305363..305431TCONS_00073531-exon-scaffold_94-1575043694:305363..305431Clytia hemisphaericaexon
TCONS_00073531-exon-scaffold_94-1491911889:336117..336236TCONS_00073531-exon-scaffold_94-1491911889:336117..336236Clytia hemisphaericaexon
TCONS_00073531-exon-scaffold_94-1510915933:336117..336236TCONS_00073531-exon-scaffold_94-1510915933:336117..336236Clytia hemisphaericaexon
TCONS_00073531-exon-scaffold_94-1575043694:336117..336236TCONS_00073531-exon-scaffold_94-1575043694:336117..336236Clytia hemisphaericaexon
TCONS_00073531-exon-scaffold_94-1491911889:336612..336797TCONS_00073531-exon-scaffold_94-1491911889:336612..336797Clytia hemisphaericaexon
TCONS_00073531-exon-scaffold_94-1510915933:336612..336797TCONS_00073531-exon-scaffold_94-1510915933:336612..336797Clytia hemisphaericaexon
TCONS_00073531-exon-scaffold_94-1575043694:336612..336797TCONS_00073531-exon-scaffold_94-1575043694:336612..336797Clytia hemisphaericaexon
TCONS_00073531-exon-scaffold_94-1491911889:339222..339568TCONS_00073531-exon-scaffold_94-1491911889:339222..339568Clytia hemisphaericaexon
TCONS_00073531-exon-scaffold_94-1510915933:339222..339568TCONS_00073531-exon-scaffold_94-1510915933:339222..339568Clytia hemisphaericaexon
TCONS_00073531-exon-scaffold_94-1575043694:339222..339568TCONS_00073531-exon-scaffold_94-1575043694:339222..339568Clytia hemisphaericaexon
TCONS_00073531-exon-scaffold_94-1491911889:340076..340181TCONS_00073531-exon-scaffold_94-1491911889:340076..340181Clytia hemisphaericaexon
TCONS_00073531-exon-scaffold_94-1510915933:340076..340181TCONS_00073531-exon-scaffold_94-1510915933:340076..340181Clytia hemisphaericaexon
TCONS_00073531-exon-scaffold_94-1575043694:340076..340181TCONS_00073531-exon-scaffold_94-1575043694:340076..340181Clytia hemisphaericaexon
TCONS_00073531-exon-scaffold_94-1491911889:341173..341317TCONS_00073531-exon-scaffold_94-1491911889:341173..341317Clytia hemisphaericaexon
TCONS_00073531-exon-scaffold_94-1510915933:341173..341317TCONS_00073531-exon-scaffold_94-1510915933:341173..341317Clytia hemisphaericaexon
TCONS_00073531-exon-scaffold_94-1575043694:341173..341317TCONS_00073531-exon-scaffold_94-1575043694:341173..341317Clytia hemisphaericaexon
TCONS_00073531-exon-scaffold_94-1491911889:346789..347055TCONS_00073531-exon-scaffold_94-1491911889:346789..347055Clytia hemisphaericaexon
TCONS_00073531-exon-scaffold_94-1510915933:346789..347055TCONS_00073531-exon-scaffold_94-1510915933:346789..347055Clytia hemisphaericaexon
TCONS_00073531-exon-scaffold_94-1575043694:346789..347055TCONS_00073531-exon-scaffold_94-1575043694:346789..347055Clytia hemisphaericaexon
TCONS_00073531-exon-scaffold_94-1491911889:347951..348752TCONS_00073531-exon-scaffold_94-1491911889:347951..348752Clytia hemisphaericaexon
TCONS_00073531-exon-scaffold_94-1510915933:347951..348752TCONS_00073531-exon-scaffold_94-1510915933:347951..348752Clytia hemisphaericaexon
TCONS_00073531-exon-scaffold_94-1575043694:347951..348752TCONS_00073531-exon-scaffold_94-1575043694:347951..348752Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_94supercontigscaffold_94:305363..348752 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
3.58133 3.05062 1.54499 0.968811 9.39787 8.33275 13.6716 13.8026 8.2921 11.3368 7.14266 6.15137 5.43397 5.00709 4.43689 4.80485 5.60521 5.42106 4.40445 5.96296 2.65063 3.48034 4.69679 5.36677 9.96746 8.66565 3.79443 2.21419 4.23206 3.73179
Blast
BLAST of TCONS_00073531 vs. Swiss-Prot (Human)
Match: TBC30 (TBC1 domain family member 30 OS=Homo sapiens GN=TBC1D30 PE=1 SV=2)

HSP 1 Score: 402.905 bits (1034), Expect = 3.745e-127
Identity = 185/305 (60.66%), Postives = 232/305 (76.07%), Query Frame = 1
Query:    1 QWIDALKAVARMPGGIPAEWRKRTWLSLAEFFLKDI--EWEGIKKTCFNDRRNPDDDELDTQIVKDLHRTGCGWFFEHDTAEDRASLKRVLLAYARWNKQIGYCQGFNVIAALILQVMEGNEEHALKVMIFLVDYVLPRNYFSNNLRALSVDMAVLRDLMQMKLGYLANRLQQLQKEAMDGSKNTSASYEPPLINMFTMQWFLTLFATCLPRNTVLRIWDAVLLEGSEVLLRVALALWAKLGSFFDEVETAADFYMTMGKLIQELITDEFILVQKLMQAVYQMASFPWVELTELREKYTYDIHPF 909
            QW DALKAVAR+  GIP EWR++ WL+LA+ +L  I  +W+   +  FN+R NPDDD +  QIVKDLHRTGC  +   +  +DR  LKRVLLAYARWNK +GYCQGFN++AALIL+VMEGNE  ALK+MI+L+D VLP +YF NNLRALSVDMAV RDL++MKL  L+  L  LQ+ A   +K +   YEPPL N+FTMQWFLTLFATCLP  TVL+IWD+V  EGSE++LRV+LA+WAKLG   +  ETA +FY TMG+L QE++ ++ +   +LMQ VY MA FP+ +L ELREKYTY+I PF
Sbjct:  235 QWYDALKAVARLSTGIPKEWRRKVWLTLADHYLHSIAIDWDKTMRFTFNERSNPDDDSMGIQIVKDLHRTGCSSYCGQEAEQDRVVLKRVLLAYARWNKTVGYCQGFNILAALILEVMEGNEGDALKIMIYLIDKVLPESYFVNNLRALSVDMAVFRDLLRMKLPELSQHLDTLQRTA---NKESGGGYEPPLTNVFTMQWFLTLFATCLPNQTVLKIWDSVFFEGSEIILRVSLAIWAKLGEQIECCETADEFYSTMGRLTQEMLENDLLQSHELMQTVYSMAPFPFPQLAELREKYTYNITPF 536          
The following BLAST results are available for this feature:
BLAST of TCONS_00073531 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
TBC303.745e-12760.66TBC1 domain family member 30 OS=Homo sapiens GN=TB... [more]
back to top