Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00073523 (transcript) - C. hemisphaerica

Overview
NameTCONS_00073523
Unique NameTCONS_00073523
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length3484

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00073523 ID=TCONS_00073523|Name=TCONS_00073523|organism=Clytia hemisphaerica|type=transcript|length=3484bp
TGCAGATTTTCAAGaatgaagtttttttgaaaatgtaaacaaaacaaagc
aACTCATGCCGCTCTTTCGTGTAGATATTGGATATAGTTGGtagtttttg
agaattttgtttactttttagctaaaatggaCGAGGAAGAAATCACAAAT
GAACTATATTCTTGTTTCAATTCTATACGGAGCACAGTTGAGGGAATAAT
TCCTTACAACAGTGATGGTAATATTTGGAACATACCTGGAAGTTTGAAAC
GAGTGAAGAAAGcttcatatcaaattttgacGAATGGTTTAAGAGAAAAT
GTCAATTCAAATAATGTAGATGAAGAAGACAAATTAAAGGAGTTGTGTTT
GAAGCTTATTCCATCCTCCGGCAACGATTCGATTGATGATTTGGATAGCA
GTCAAGATATGCTTCTGGATTGGTTGGAAAAACACCTCCTCGCTAACAGC
ATCTTGGATTGTGTAAAAAACCTCTTCTTAGAAACTTGGTCTGNGGATTG
GTTGGAAAAACACCTCCTTGCTAACAGCATCTTGGATTGTGTAAAAAACC
TCTTCTTAGAAACTTGGTCTGAAAAGACACTATCTTCTTATAAAGAATAC
TCATATGTGAAGAACGAGGATTTGATGCAAGCGTATATAGCATGTTTAGA
ATCACTACAACAAGGGAATATGAGTGCTTTCATGTTGATCAAGCCGTCCC
TGCTGAACCGATCTACATTCATTGAAGAATTGAGACCATGGGTAACATCG
AAAGCAATCGAAGAAAACGAATTTCTCAAAGCACAAGAACAACAAATCGA
ATCTGAAAACTGTTTTGGTCTTTATTCCCAACAGGAGGATACCGGTGCTA
TTTCAGATGATAAATTATCAGATCACAAAGACATTGTTTATAATCAGAAC
CCTATACTAGTGGATAACGCTAGTAATAAACCTTCTCCTATACCATCTGA
TTTACTTATGAACAGTGCTTTAACAGCGGTCAATGATATTCAACGTGATG
AGTGTCCCGAAGACTGGTATATTGACGCTAATACTGAAAGGGCTCGTTTA
CTTTTACGTAGAGAAACGTCTCGCAGNGTATATTGACGCTAATACTGAAA
GGGCTCGTTTACTTTTACGTAGAGAAACCTCTCGCAGCGAATCAAGTATT
TACCACGAGGATGAGGACGGAATTAGTTCCCATACCTCTTCAAATGCATC
GGATAGTTTACAAGGGTTACACAGTGATTCGACGTTGGAGAGTCACCAAC
GTATACAAGGAAGTGCTTCTTTTTCGCATAAGAAACGTCAACAGCAACAG
CAAAGAAAAGGACACAGTCGATCAAAGTCTGACCAGATAGGTATTCATCA
TAACCAACATCACAACACAATTAGCATGATGAATCAAATGAATATGGAAC
TGAGCTTGCCTGGTGTTTCACTATCATTACCTAAAGAGATGGATACCACA
GACGGACTTTCTTCTTCACAACAATCTCACAGCCCTGGTTACTATAGATA
CGATGATGTTCAACTCGTACCCAGACCCTATGAAGGCCAATCATTGTTCA
GTTATTTGGATTCCAGAAACTATGATACTGGTGCACAACTCGACAAGGAG
AATGCACATTTCAGTATATGTGAAGCTCTAATCACTGCTATCGAAGAGAT
GAGATGTCAAAGATTCGACCGCATGTCTTCTAAACGCAGACGCACTATAT
TAAACAACGACAACGATCTTGCTTACGATAGTGGTTCGACGTCCGTTCTG
AGTGACGTCACGGCATCTTCGGGAGCATCATCCTGTCACAACAAATCATC
TGCTACGTTACCTTCCTCTTCTGATGCCCTCACTGATGACGCATGTATAT
CCGACTCTGCATTCCCGACGATGGCTGACCAACGACGAAGTATCGGTATG
TCATGGGAAAATGTGTCGGTGTCACCGAGAAGGTTGAAACGAGAAATCTC
TGAAAGTGAGAAACCGGAAATCATACAGAGTGAGGAGATTCCACCCAACG
ATTTTTCAGCAGAAGCAGTCGCTAAATCTCTTTTGCATAAATTTCAAGGC
CACAAACTTCCAGCTGCATCCGAGCTGAAATGGATCGTTTCCGAGTTGGA
AGCACCACAAGAACTTCTACCCTTACCGACAGCATGGCCTATTTCGCCGG
ACAGTCATTTAACGGACAACCCACCTGAACGTCATGTTCAAAGTGGAATG
GGAAAATCGATGCCTagTTTATTACGTGGTAATTTCGAATGGGCACCGCC
TCGATTACAGATTATCTTTGTCCCACACCCGTTTGTAAAGCGAAAAGTAA
TGTTACAAAGACAACATTATCGATGTGCGGGTTGTGGCTTGAAAGTATCA
CCAGATTTATCGAAACGATTTCGCTACTGTGAATATCTCGGCAAATATTT
TTGTACCAGTTGTCATCAGAAGGCAGAATCTGTTATTCCAGCCAAGATAT
TGTCCAAATGGGATTTCAAAAGatattttgttTCGGATTTTGCACGTGAC
CTATTGAAGAAGATACACAGGGATCCTTTGTTCAATGTTCATGATATTTC
TCCGAATCTTTACGATCGCGTCCGGCCACTCAACACAACCAAAAATTTAC
GAGTTCAACTACATTACATGAAGAAGTTTTTAGATAGTTGTCGATACGCT
GAAAGCTGTCAAAAGGAGGTGATGAAGTTACCGATGCATATTTCGGACGA
CCCTCATGTTTACTCCATTGATGACCTGATACAGGTGAAGAATGGGGAAT
TGCACAAGACGTTGAGTGGAGTGATAACACGTGGTGACAAGCACATCAAG
GAAGATTGCCAGGTGTGTCAGTTGAAAGGTTTTATATGCGAAGTATGTTC
GTCCGATGAAATTCTTTATCCATTTGAACTTAGGAAAGTTCATGTCTGTC
aaaGTTGTAAAACATGTTCACATAGAAGTTGCTATGTCAAAGGGAGCTGT
AAAAGATGTGAAAGGATAAAAGCAAGAAAATTGTTGGTCCAAGCAGACCT
GCCAGAATCACCGGAGCTTGAATAACGATGGATTTTGTTAGGaaagtttt
caaattcaattagtttgacaatttattttctttacttttgcAGAAAAAGG
GACGACCTTTCAAAGCATAGTTCTTTTAACATACGTGATATTTTTACTCT
CGGATACCTAATAACaaagtccgtataaaaaactaTGGTCTgcaagctta
ttgttttaacttttaggTATCCGAGAGTACACGCTTTCACGATGACAATT
TCGCAACAACACTAAGCTTTATTTGGCCAAAAACAAATTATGAATAAAAC
TGAACCTTAGAAATTAGTAATTACTATTAACGGTTTTTTGTGTCTGAAAG
TAAGCTTTTGAATTCGGAAATACGAATTGAGCAGATGAGCACCATGATTT
GTCTAGTTCTTTCCGTGTATCAACTGCATTCTTCATATCGTTCTTACACC
CCTGTTTCTCAGCCCCGAAGGAACTTTTTCGAac
Run BLAST on NCBI

transcript from alignment at scaffold_94:95011..133547+

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00073523 ID=TCONS_00073523|Name=TCONS_00073523|organism=Clytia hemisphaerica|type=transcript|length=38537bp|location=Sequence derived from alignment at scaffold_94:95011..133547+ (Clytia hemisphaerica)
TGCAGATTTTCAAGaatgaagtttttttgaaaatgtaaacaaaacaaagc aACTCATGCCGCTCTTTCGTGTAGATATTGGATATAGTTGGtagtttttg agaattttgtttactttttagctaaaatggaCGAGGAAGAAATCACAAAT GAACTATATTCTTGTTTCAATTCTATACGGAGCACAGTTGAGGGAATAAT TCCTTACAACAGTGATGGTAATATTTGGAACATACCTGGAAGTTTGAAAC GAGTGAAGAAAGcttcatatcaaattttgacGAATGGTTTAAGAGAAAAT GTCAATTCAAATAATGTAGATGAAGAAGACAAATTAAAGGTTTGCTTTTT TCATGATAATGTCCAGACTCTCTCACTAGATACCATCGCACCAACAgcaa cggctctaacttggtTCTAGTTTCTAGTTCTATTAAGTGATCACATAATA CGCTAAcgtacattatcatgatattgaaaataaaaagttataaaaaatac ctaataaaatgaaaacaactaaANNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAAGTAGCGA GATATGACTGAAGCTGAAAGACACCACCACAAGGATTTAGAATAGTATGT AGTAAACGGGAGGCTAAGATGTGATAATGTAGACCTGAAAGACTCCAGTT CATTGATAGAAAAATACAAGATCTACTCTCACCGATACTAAGAAGCCACG ACATTTTGgggaggaccctgccgacgcaccggactgtccggtgtatttgt ctggtggcaaaaagtatcctttcgcaaCACCAagcgcaataagtccggtg tcagtccggtgttgcatacagggaattttggacgctggacatttatgaaa caaaaaaattaagaaacacctaACGCACCGTACTGGTCATGGCCGGtatt ttgattgtccggtggtaaaaaaattcacatTTTACACAGACTTTCACGTG TCCAATGTTCGTTAAGTCTGGTGTGTCGGCAGGGTCCTACCTGACAGAAT GTCGTGGCTTCTTAGTATCGGTGAGAGTAGATCTTGTATTTTTCTATCAA TGAACTGGAGTTTTCTGGAGTTTCTGAACCTTTaggacagttagtcacac taaaCTAGCGTCCCCCCCAAATTGAGTAtaaaagattaatgctgcgaaaa gGGTTATATCttttacttgactcgcaagcaaaaaaaaaagcgccgcaaaa cttttaaagggattcatgaagaAATAAACTGGTGCTTTTAGACCATATTC AGACATTACGATTCCGTTTCATTCCATTCTGAAACGATTCCAAAACAAGT GTGGATGTCAGAattcaaaacgtcaaaaaagaagaagttACTAATtgtac aaagcaaaacagatctaAACAGCTTCGCTCCGCTTTAGTCATTCGGAATG GAACTGCTCTGTTTTGTTGCCCCCAAACGTCCtaaaaccaatatgaacac caTAGTGTCCGTCAGGGTCTCTACcccccccccatgcctagaatgaaaat tttccattcccccctcCCTCGTTTCCCCCCcccctggcttcaaaaaaaat tctctccCCCCTATACatccttttgacctcaaaacccattcccccctgaa tccaggggggaggacactatgaacacactcgatctgtaacaaaaatcata ccggagcaaAACGGAAcggtaacgtgtgaacatggtcttgatgaaattaa cattttcaaaatctaagGGAGATTACCTGGATTTTGAGCCATAGGTGAAA AATTTTTAACTGAGTCAACCTTGACGAGTGATTTGAAGAAcaaacttccc aagaaaaagatctattgGGAAGATGGAACCCACCTAAATCTGCGAGGCTC GGAAATCCCGAGTTATTGATATAtgatataccgtgagattgggtaacttg catcagtggaggctaacatgcatagccctcaaatgaaatacctgactggt cattaaaatacaaaattaaatcaaaacaaaaatgggagAGTAatgctgca agcggagctgcgtagttgtattttaatgaccagccaggtctttcatttga gggctatgcttgttagcctctactgatgcaagttatccaatctcacggta tatatattcattttcatcgGGACCGGCTGGacataagaaaaaataactaa aaaatgTAAAGGAAGGAAAAATAACTTGAGAATGTGaaagaaggaaaaaa tctagttaaaacacaaaataactcaaaactaaaaaaaagaacaaaaaaat aactcaaGAAACTACATGGAGCAAAATACAGTagctcgaaaatttaaagg aaggaaaaaaaaccgagttaaaattattatttcttaATTTTAACTCGGCT TTTTTTCCTTCCTTCCTGAGACATTAgaaggaaaaaataaagaaacgcAA AAATAACTCGAGAATCTACAGGAAAAAgaataactcaaaattttaaagac acAGAAAAAAACTAAGTTACAAAATTGGAAATGAAGTCATCAgaaggtac aaaatgacgtcagattttccaaaaaaaacgtCATAACTCTTTTTTTTGGA ACTCGGTTTTTTAACTCAAGAAAAATAACTTGGGATTTCCAAGCCTCTAA ATCTGCGCAACCATCAtgtaggctatttcccggaaattttgccagacTTC AAACACTGGTCCATTTACATATccagaattatttttactttagcatatAA ATAAGGCCTAACAAATCAAAGCGTTATCTCaaaaattgaatgacaaattt agTTGGTTGATTATGGCTGCTGCATGTTTACGTTTAGCAATCattcattt tgtttcattttaagTCTTCAAGTTtaaattaattgtcttgggatcttgaa cttgattcaggtaactctcatccttgttgttgcaaatagaCCCTGACCCT GTAGAAagcttgtttttttctaaaagcttgtTTTCCTAAGTGTGGCTAAC TGTCAGTGAAGGTTATTGTGACATGTATTGACAGAAAGTATATGACTGAT AAATTTGGTGGAATtattaaaacaaatttgttgacAAAGAGATTTAAGAG TCAGTGAAAATACATGCCAGATATGCCAATCATCCCAAGTTAGGGCCGTT GATGGTATAATTGATGCAATAACTTTTTCCATTCTATGACCaaattaata gaccttttcagtTTTTCTAGGAGCGATGTCATTTGATTATAAACTCCAGC ATAAATTGAGATAGCTCCAACTTTCAATAGATGGGATGGAAAACTTTGGC TATGTTATTGTttatgctggagtttttaaccattttaaaaactttgaaaa taataGTCACAATTTGAGGATTTGATTGAATTACCCCAGCATAAAAACCT GCAAACTCCCTAATGGTTGGAAAATTGTAATCCGTctatcattttctcaa gcgaagagtacgtaAAGCGATTCTAGGCTTCTTTATAGTGCTGCAGATCA TCAGGTGATAATactcaattatcattatccctttactttcttcatttctg aaacattttcaaaataatggaaaaatagaaaagtttttatttttcagtgc TCTATTCACATTTATTTGAATTAGAAAGATTTTCTATGCTGCattatttt gcaaacttcaaaaaactgattacTGATTGAGGGATGGATATAAAGGGGGG ATGAAATGATAATGAAAAATTAGCAATAGAAAATTAGCGATAGAAATATA TTTATACAATTTAGAAGTCATTGTAGAGTCTTTTAAGTGTCCAAattttt cttagcaaaattcttcaaaaacagtTGAATACGTATAGCAGACTTTTTAA GAAACAGAACCTTTGTGCCCCTGTCTCTTAGCCACTGCTTTCATCAATTC ATTTGTAATTCATGTTAATTATTCAACAAGGCATCGTGATTTCCATTTTT GGAATTGGAAAGAGAAAAGACAAGTCTACCCCTCTTCTCAGTTTGTATAG CAAAAGAATTTATCAAATTGATTCAGACTTGAGATATTGCATTTTAACTG ACACTTGGGCCTTAAATGGGCAAAAGATACGgcaatttcaatgtcaatag AAAGCCTCGTAACTGCCACCGTTTTTTTTGTCCATGAAACTCCTTTGAAA ACTTGAATAATCGCATTATTAGCCCCAGAAAAACAATTTCCTCTTCCCTA TCAGTTTAGACAGAATTGTGTTATCATTTTAAGAAATGACAACAAAAGAA GGCAATAAAAGACCAAAGGTTGTAAGTGAGCAAAAAATTATTGTTCGCCA ATCTAAAATTctgaaaactcaaaattattttagtatcccaggaaaaaatt tttatttacatgTTAAAATACCTAAAAACTAGGTTGTGTTATGCACTTAA AAGGATCTGATCCAACCAGGTGCACACTGGATGATAATTTTCCAAATGGa actgtgtttttttttaatttatgatCGTAACTTCCTTATAATGAGAGATA TCATGAAATACCATAGCGGTGAAAACAATTGTTCAAAAACGTTTGCAGCT TTCAAAGCATAATTAATACTGTCCACATTTGGAATATTGTATATGTAAGC CACTGCACGCATTTCATTAAATAAagataacaaaaataaacaaacccaAC TGACCGAATCCAATCGTTTTAAAATGAACATTGATCTCTTGTAAGGGTTA ATTCTTTTATGCAGGTACCAAAACAAAGCGAATAATGATGTGATATACAA GATACGGTAGATAGGGTTTGTTAGAAACACAGATAAACCAGCTATAATGA AACGCTCCATCAAACGCCATGCTTCCCACcagatatatttttctttgtaa gGTAACTCGAACATCTCAACTAAACGATCGTCAGCTTTCTGGTGAAGATG TCTATTGTCTTTCTTAATGAATTTTTTACATGCTATCAAAAAGAATGCAC CGCATGGGACGGTTAAAAGCATCATGAATTTCAAACGTGATATCTCTCTG TTTTTCAGCTTTTGATAACCGATTGCAACAGCTATGGGGAATGAAAACAC CCATAATATCAAGAATACAATATTTACAATCTGCCAGTAGTGAAAACACT CAATACTTCCATCAATGTATAGAAATCGTCGACCATTCATTGTTTTACAG TTCACGAATGAAAAAGCATTATGGCATACATTTTTATAGCAAAATGCCAA AACAATATAATAACCAACGTAAAATCTACCGGTAAATAACGTTCGGTCGG TATCCTTATTACATCTCAATCTGTTTATTAGTTTACAAATAAGTAAGCAA AACACGACAGTCAAAAGCATGATAATAGGACTTCCATACCCTATTAGGAA CATATTTGTTGTAACCGTCATCCCTTTGAAAGAACAGAGATGTTTCAGTT CTTCCCGCCCTTTTGTAATCCACTCAATATTGAAAATTTGATCGATAcct aaattattattattattaNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNAAAATTAGCAATAGAAAATTAGCGATAGAAATATATT TATACAATTTAGAAGTCATTGTAGAGTCTTTTAAGTGTCCAAatttttct tagcaaaattcttcaaaaacagtTGAATACGTATAGCAGACTTTTTAAGA AACAGAACCTTTGTGCCCCTGTCTCTTAGCCACTGCTTTCATCAATTCAT TTGTAATTCATGTTAATTATTCAACAAGGCATCGTGATTTCCATTTTTGG AATTGGAAAGAGAAAAGACAAGTCTACCCCTCTTCTCAGTTTGTATAGCA AAAGAATTTATCAAATTGATTCAGACTTGAGATATTGCATTTTAACTGAC ACTTGGGCCTTAAATGGGCAAAAGATACGgcaatttcaatgtcaatagAA AGCCTCGTAACTGCCACCGTTTTTTTTGTCCATCAAACTCCTTTGAAAAC TTGAATAATCGCATTATTAGCCCCAGAAAAAACAATTTCCTCTTCCCTAT CAGTTTAGACAGAATTGTGTTATCATTTTAAGAAATGACAACAAAAGGAG GCAATAAAAGACCAAAGGTTGTAAGTGAGCAAAAATTATTGTTCGCCAAt ctaaaattctcaaaactcaaaattattttagtatcccaggaaaaaaattt atttacatgTTAAAATACCTAAAAACTATGTTGTGTTATGCACTTAAAAG GATCTGGTCCATCCAGGTGCACACTGGATGATAATTTTCCAAATGGaact gtgttttttttttaatttatgatCGTAACTTCCTTATAATGAGAGATATC ATGAAATACCATAGCGGTGAAAACAATTGTTCAAAAACGTTTGCAGCTTT CAAAGCATAATTAATACTGTCCACATTTGGAATATTGTATATGTAAGCCA CTGCACGCATTTCATTAAATAAagataacaaaaataaacaaacccaACTG ACCGAATCCAATCGTTTTAAAATGAACATTGATCTCTTGTAAGGGTTAAT TCTTTTATGCAGGTACCAAAACAAAGCGAATAATGATGTGATATACAAGA TACGGTAGATAGGGTTTGTTAGAAACACAGATAAACCAGCTATAATGAAA CGCTCCATCAAACGCCATGCTTCCCACcagatatatttttctttgtaagG TAACTCGAACATCTCAACTAAACGATCGTCAGCTTTCTGGTGAAGATGTC TATTGTCTTTCTTAATGAATTTTTTACATGCTATCAAAAAGAATGCACCG CATGGGACGGTTAAAAGCATCATGAATTTCAAACGTGATATCTCTCtgtt tttcaacttttgataaCCGATTGCAACAGCTATGGGGAATGAAAACACCC ATGATATCAAGAATACAATATTTACAATCTGCCAGTAGTGAAAACACTCA ATACTTCCATCAATGTATAGAAATCGTCTACCATTCATTGTTTTACAGTT CACGAATGAAAAAGCATTATGGCATACATTTTTATAGCAAAATGCCAAAA CAATATAATAACCAACGTAAAATCTACCGGTAAATAACGTTCGGTCGGTA TCCTTATTACATCTCAATCTGTTTATTAGTTTACAAATAAGTAAGCAAAA CACGACAGTCAAAAGCATGATAATAGGACTTCCATACCCTATTAGGAACA TATTTGTTGTAACCGTCATCCCTTTGAAAGAACAGAGATGTTTCAGTTCT TCCCGCCCTTTTGTAATCCACTCAATATTGAAAATTTGATCGATAcctaa attattattattattaNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAAAATTAGCAATAGAAAATT AGCGATAGAAATATATTTATACAATTTAGAAGTCATTGTAGAGTCTTTTA AGTGTCCAAatttttcttagcaaaattcttcaaaaacagtTGAATACGTA TAGCAGACTTTTTAAGAAACAGAACCTTTGTGCCCCTGTCTCTTAGCCAC TGCTTTCATCAATTCATTTGTAATTCATGTTAATTATTCAACAAGGCATC GTGATTTCCATTTTTGGAATTGGAAAGAGAAAAGACAAGTCTACCCCTCT TCTCAGTTTGTATAGCAAAAGAATTTATCAAATTGATTCAGACTTGAGAT ATTGCATTTTAACTGACACTTGGGCCTTAAATGGGCAGAAGATACGgcaa tttcaatgtcaatagAAAGCCTCGTAACTGCCACCGTTTTTTTTGTCCAT CAAACTCCTTTGAAAACTTGAATAATCGCATTATTAGCCCCAGAAAAAAC AATTTCCTCTTCCCTATCAGTTTAGACAGAATTGTGTTATCATTTTAAGA AATGACAACAAAAGGAGGCAATAAAAGACCAAAGGTTGTAAGTGAGCAAA AATTATTGTTCGCCAAtctaaaattctcaaaactcaaaattattttagta tcccaggaaaaaaatttatttacatgTTAAAATACCTAAAAACTATGTTG TGTTATGCACTTAAAAGGATCTGGTCCATCCAGGTGCACACTGGATGATA ATTTTCCAAATGGaactgtgttttttttttaatttatgatCGTAACTTCC TTATAATGAGAGATATCATGAAATACCATAGCGGTGAAAACAATTGTTCA AAAACGTTTGCAGCTTTCAAAGCATAGTTAATACTGTCCACATTTGGAAT ATTGTATATGTAAGCCACTGCACGCATTTCATTAAATAAagataacaaaa ataaacaaacccaACTGACCGAATCCAATCGTTTTAAAATGAACATTGAT CTCTTGTAAGGGTTAATTCTTTTATGCAGGTACCAAAACAAAGCGAATAA TGATGTGATATACAAGATACGGTAGATAGGGTTTGTTAGAAACACAGATA AACCAGCTATAATGAAACGCTCCATCAAACGCCATGCTTCCCACcagata tatttttctttgtaagGTAACTCGAACATCTCAACTAAACGATCGTCAGC CTTCTGGTGAAGATGTCTATTGTCTTTCTTAATGAATTTTTTACATGCTA TCAAAAAGAATGCACCGCATGGGACGGTTAAAAGCATCATGAATTTCAAA CGTGATATCTCTCtgtttttcaacttttgataaCCGATTGCAACAGCTAT GGGGAATGAAAACACCCATGATATCAAGAATACAATATTTACAATCTGCC AGTAGTGAAAACACTCAATACTTCCATCAATGTATAGAAATCGTCTACCA TTCATTGTTTTACAGTTCACGAATGAAAAAGCATTATGGCATACATTTTT ATAGCAAAATGCCAAAACAATATAATAACCAACGTAAAATCTACCGGTAA ATAACGTTCGGTCAGTATCCTTATTACATCTTAATCTGTTTATTAGTTTA CAAATAAGTAAGCAAAACACGACAGTCAGGAGCATGATAATAGGACTTCC ATATCCTATTAGGAACATATTTGTTGTAACCGTCATCCCTTTGAAAGAAC AGAGATGTTTCAGTTCTTCCCGCCCTTTTGTAATCCACTCGATATTGAAA ATTTGATCGATAcctaaattattattattattactctCATTAACTCCTTT AACAGTAATCAATGCTTTCAATTGATAAAAAGTCATTACTATGTTAAATA TGGCTGTAAAAGAAATCTCCTTTCGAATTGTGTTTGGTTTTTCGACAGTT ATGCTTTTTGGTTTCACAACTTGACTATTTTTATGATTCTCTTGTTTACA GCAATTCACCCAAAGTATAAATCTGATGACTAAATACTTGAGATCTTTAG CAAATGTCATTAAGAATGAAAGTGTCATTGGGACAGCCAAGAACAGTATC CAATAAATATGTTGGCTTTTTTTTGTACATTTCGAATTATGGACACATTG ATTATTCAGGTTAAGAAAATGGTCTTTTTCGCAACTCCCACATAATAGAC CAGTACGATTTGAGCTACAAGTAGTTGGTGTCACGCATGGTGATGTATCC AAGCTACAACAATAACCTTCTGGACATAAAACAAATTCATATTCTCTGTA TTCATTAGCAAAGCCATAAAAGTTATCGCGTGCTTTGATTGCTCCATCTT CACAAATTGCACCAGTTGGACAAGTTTGACATTGGAGTGTTGTAGTTTGT ACATTATCGAGgatgatattttttgttctGTCTAGTCTTGTGGTTAAATT CATCTGTTTACCAAGTCTGTTTGTTGGGTAAGTATTCTGTTCACATTTTT GACAACCTAGCCTTAACGAATCATCCGACTTTCTGCTGAATTTTAACACT GGTTTGAAGTTCTGAGGGCATTGAAACATAAATGCTGTCAAATTACTATG TGTCTGTTTAGCAAAATCCCATTTCATAATTTGAAATTGTAAAGATTTTG AACCATTTGCATAAAAATTGACATTGTTTGTATATAATTCGGTATCAATC AATTCAGTAATTCGTTCGTAACTCATCAAGGCTGCTATGTAAACATACGT TCTGGTGAGGCTTATAATGGAAGATGACTCTGCGATAATGAATTTTGTAC GCCTCGATTCTTCATTCAAATCTGATATCAAATCCACCATTTTGACTTTG GAGGTTGATGATCTTAATAATGTTGAAAACTCGTTGTTCTTTATATAAGT TTTAGTTATTATTATATCAGAGTTGGTTACCAAAAACAGATATAGGTCAA TTTTGCAATGAGCCAGAAAGAGATTAGAAATGTTGACCAatgaatttttc agaaaattaaaaCCATTCATGCTATCTATACTTTCTGGGTAGCTTCGTTT GAACTTAAGGCTGGTCAGGTTAAGGTTTGCAATATTTAAGATAGATTCTG ATgccataaaaatattttccatcgTGATATTATGAAGTTGAAGTCCATTC ATATAGACGTCAGTTTTCTGCTTCATGAGAAAGATTGATTTCCAAAAACT GGAATTGATCATATAAACTCTGTTTAAATGGATGTTTATACATTCTTCAA AAAAGAATCCTTCAGCCAAAAAGTTAGTATTGACTACTGTCAGATCAGTT ATATTCACAAGATCGGTGTAAAAGAGATAGAACAAATGTTCTGTAATGTT AGTGTTTCGAATTTGTAGATTGTTAACATCTATCTTAGTGTAGAGTACAG CACGGAAGAAATGTGACTCAAACTGGCACCTGTCAATTTTGGTATTGGTT AAGGAAACTCGACCAATATATGGATTAATAACATCAAAACCAAAATAGGT ATTGATTATTGTTAAGTTAGTTAACAATAGATCTGTACGAGCTAATCGAA AACATTCTCTGTTCGTTATCGAGTCTTGAATACTCAAATTGATAGCTTCA ATAACACCTTGCCGATAATAGTTTGacgatttaaaaattttgtcatCGAT TTGAGCTCTTAGAATTTGTAGATCCACAATTTTGATGTCGGTTGTATATA ACATAAACATCACCGTGGAAACTTGAACATCAGTGATAGTGAAGTTGTTC ATGTAAATGAAGCTACGTTTCGATTGAAAAATAGAATGTAGTTTTTCGTT TGACGAAAGTGATATGTTTTCCAAGGTACCCGTACTGTctgtaaaatcaa aaggaatgcAATTTAAAGCCATAAAGAATGCTTCTACTTGGATTCCAGTA AGCTTAATGTTGCTCTCACGAGATTctattattttgtaaaaatcgaGGTT ATGATGGAAATGGATATTTTTGATGCTTCCAGATACCTTTTCAGTTTTAA TCATTCTTTTTACAACCAGTCGTTGAAAAGtacaattttcaattaaaaca tCTCTGGTGTTTTGTAGGTCTATTAAAGAATGTGGTATGATAGCTTCAAG TATTGTTGTATTTATTGTATCTCTTGAGTCATTCTGAAATTCAGGAAAAC GTGCTTTGAATTCATAAAACTGACTTGACTGAACCACAAATTCGGTTGGT ATCCTCGGGATGTTGTCGTCAATGCGACAGTTTTTCACATGAAATGATTG AACATTCTTTATTTGAAAACGCCCACCACTGATCTTAGTGTCTGTAATCA TAATCTGACTCTGATTATTGGAATCTTCATTCATTACAACATCAAGCCAT TGATATTTATCAATGATTATTTGTTGTCCTTCTATGATGAACGGTGATTT TAAGTTACAATGTTCAATTGTAATGAATGCTTTCTTGGCTTGTTTTAAAG ATATGAAATTAGATTGGTTGATGTATATTGATGAAGCTCTGATGTTGATC ACCACACTTGCATGATTCTCTTTTGAATCCAATAACATCACATTGTATAG ATCAATTGAATCGATTGATATTTCAATTTCTCCTTGCCGAACTCCAATAA ATGAATGATTGTTACCATAAATTATTGGATCGGCTCCTTTCGGATCATCC TTTATCAAACTCAAGATGACACTTTTGTTGTTATTGATTTGCAGTTGATT TGTGAACCTGTACTGTAGACTCTCAACTGGTGATGTTTCGAACACTAGAG AGATATCATTGATATGATCTGTTTGATTAAAGCCGTATTCGATTGTCTGA CATTTGTGTAATATGTCTCCGCATTCTGGTTCATCTACTCCGTTTGGTGA AAGGTGAATGGTTGAAACATCTCCTGGAAATGATAGAGGTAATACAGCTG GTCAGGGTTACTTTATAAACTTagaaactatggtcaaaattccAAATTCA ATATTCACTTCTAATGTACACTCGCTATACTCGGCCAGTCGTCTAAATAA AGCTTATTATCTCGTTGCAGTAGTAACAGTTTTGATTTGGTACTGGCGGG GAGGGAAAATGCGATTTTCAAGTGGTTTATGAGTAAATAATCGGATTGAC TTTCTCAAGGAAAGACCCGGTATAAATCCTTTTTTTAATTGTTGTCGCTT ATAATTGTAATTATAATTACCTTCAACTCGAATTAAACAAACAAGTTGTA TCAATATCACTAAACGAAGCATCTTGAGATATACTCCTTAACCGTGATAC CGTGAAGAAGGTGTCCgctgaagattgaaaatgaaattaaaaaatagatt tttcatATAACTCTGAGACtataaaaatcaattaaaatcaCCAACcacaa agaaatcaaaaagagaaaagttttaACCAGTGCGATTAAttgttttgcca aaaaaaaacaatacatcAATAATTAAAAACCATTATGGAAGtgagaattt gaaaataattcttagtgatttgtttttcttcagaaaatctAATTAAGAAT TTTAGTTTGACTTGTGTGATATTTCGCAATTTTTactgagaatttttttt ataactaGCACTGCGGGAAACTTTCTCGCAATTATTTGTGTTATTGATTA AAGatttattccaaaaaataatattgattAATCTATTTTCATCACTTTGA TTTATATTGTATTTTGTTAGGGAAAGGTTccttttaaaaagcttaaagtc GGCAAAATACTAAAGGAATAAGGGGAGGAAAAAGAAACAGCTAGAAGGAA TTAAAATATCGTAAAGAATaggaaaaatgacaaaaagtagACCCTAATca aatacattttttgaaaacacttAAATTTTGCGCCTCGCCCACTAGCAAAT TTGATGCCTAAAAAGAGACCATACTATACGACATGTCCCATTTAACCCTC TCTTCTGCTATCCAACCACCCCAGGGACGACGTTGGACGGAAtttaaaat ctttcatttttaaagaaaattatttcaattttaataGGATTAATAAGACA GACATTGGAACGTGCCATGACACTCATAAGATTCGGCCTCGCGTGAGCAT CGCTCCTCCAGTGTCATTCGAGGttcatggtatacgccatgaCTTAGCAG CTTGTGCCTGTCAAGTCGCAGGTCTGTCAGCTCCatgattcctactcctt cggGGGGAGAATCTATCGCAAATTCTTTTTCCGTCAGCGGACGCAGACCT GATTTaggcggccgaagacctgaattaatggccgaagacctgaattaacg gccgaagacctgaattaacggtCGAAGACCTTTTtcaacggccgaagacc tgatttagcaaGTCGCCGGCCAAATACCTGATACCCGGAGGGCTCATATT TATCTATCAATCTATTTTAATAGGAGTTGTGTTTGAAGCTTATTCCATCC TCCGGCAACGATTCGATTGATGATTTGGATAGCAGTCAAGATATGCTTCT GGATTGGTTGGAAAAACACCTCCTCGCTAACAGCATCTTGGATTGTGTAA AAAACCTCTTCTTAGAAACTTGGTCTGNGGATTGGTTGGAAAAACACCTC CTTGCTAACAGCATCTTGGATTGTGTAAAAAACCTCTTCTTAGAAACTTG GTCTGAAAAGACACTATCTTCTTATAAAGGTATTACAATAAACgttattt cataagaacaagttaagaacatttttgcagACTCTTTATAACACCCATTC CCTTAGGACATTGCATAAAAATACTCACAACATGGCGAGAATAGACATTT CCAGAACATTTTAGGAACTTCTTTTAGTCTTGGAACCCNGGCGAAAATAG ACattttcagaacattttaagaacttcTTTTAGTCTTGGAACCCCCCTTG AAACTCAAATAGCTAAGAACACCCGTAGGTTTCAAAAACCTTTGATGctc ttaaaagaagaaaaaaattttttttactggtTGAAAAAAGACTTCAAATT AGGGGTTATGGAGAAAATTCAGAAGTAAATAAGGAGgcaaagtttgaaaa gttgttggaataattttttaacttcgcTTTTATATGAATATCCTATTTCT TAAAAAGAACCTCTGATGGAATTTGAGGAGATATGAACGGGCTACGTTTA GTTCTTATTAGCCGGTCACTATCATGCTTTGCTATTTGCGAAGGCTttaa aagctaaaattttgaaagttatgGTATCCTGATGATCCAGTTTATTTCTA ATACATTATTATCATTTTTGCTACTAGAATACTCATATGTGAAGAACGAG GATTTGATGCAAGCGTATATAGCATGTTTAGAATCACTACAACAAGGGAA TATGAGTGCTTTCATGTTGATCAAGCCGTCCCTGGTATGTTTATATGTAA ACGTTTGTTATTTATTAGAACAATCTTACAATATACAGGAAAAATCTGAG GCTCGACTTTCAAGAACCTATATTTTTCCTCTCGAAATTCATGAATGATC AATAATTATTGAATTTAATCGATGTAGTGGCATGTTAATACACTTGACAT GGTTTCTGCCCCTCTCCCCCCCCTTATAGCCTTTTAAAATAAGGGGGGAT TCTTTATCAAGGGCTGcaaaaatctatcaaaacaagaaaaaaggggggac tagaatttgaaaattgttgATTGAATTTCAGATGTCATGTCTTTGGTTTT ATTAATgataattttctttatctaatAATATCTTCTTTCCCGTTTTCGTG CTCACAATCTCATGCCCACTTTTTTGCAGACCATGCTGTATTGAATCTTA TGTACATTAGAACAACTTTTAACAGACTAAATCAAACCATAAGAACTATT ATATATTATCCTCCCCAATTCGATaacgttttaaggtgttttgagggtgt aaaaagtgaaaaataatctCCCCCCCCACTCAAAATGGATCGCCGGGGCC CATGAATCTGCATCCTCTCTTCCCTCTCTCTCTCTATTGTAAAAGTTTGT TTGCTGAAAGGGTAATAGTTGGTCGACATCAATGATCTTACTTGTGTTTT ACTGCCTAAATTCTCTACTTGGGAAGACCTCTTGCTCCTTGACCTtggtt ttatttataaaaagttttatttgtatCATTTGATTATAGGATCCAGTTTA TTTccaatgatttctttttattgaattttatttagtCGGATATCATTATG TACCCAATATAATGTTGATAGCATTGATATCAAACCAATCGTTGTACTTT GTTATTGTCAAACTCTAAAGATAAAAATCTGAGGGGGGACtactcttttt ttcattttaaggggCGACATTCTAACAAGGGGTACTGgtaatttttgttc aatttaagggggaagttttctttaagggcaaaattgcattttaagggCGA CTGAAAAAGTAGGCAGAAACCATGCTTGTCATTGCTGAAAGGTAATAAAT CAATTCCACGCAGGAGAAATGTAAAATTTTGCCTCGGCGTCTCGCACAAG TGAACTTAGCAGGCCTCTTTTTACCCAAAATCCTTTGTTAACCTCTCTTT TAACCtcctattcttgatatgcgtaagtcaagataaCGTCATATTTTACG GTTTTTGacctccgtgtttctatttttagtaacagagagaggttaaatcc cggcttttttagggtgtttccgctagaaaaataacttacgcatatcaaga ataagaCCACTTTCACGCGGTACGGATCCGTTTCTCTCCAAAGTTATTCT ATTGGTTGAATTTAAGGTTTTACGTCATTTCtcaccaatagaatggcttc atttcgttttggAGCGTAACATTGTATTAACCTTTCTTATACCTTTCACA GCTGAACCGATCTACATTCATTGAAGAATTGAGACCATGGGTAACATCGA AAGCAATCGAAGAAAACGAATTTCTCAAAGCACAAGAACAACAAATCGAA TCTGAAAACTGTTTTGGTCTTTATTCCCAACAGGAGGATACCGGTGCTAT TTCAGATGATAAATTATCAGATCACAAAGACATTGTTTATAATCAGAACC CTATACTAGTGGATAACGCTAGTAATAAACCTTCTCCTATACCATCTGAT TTACTTATGAACAGTGCTTTAACAGCGGTCAATGATATTCAACGTGATGA GTGTCCCGAAGACTGGTATATTGACGCTAATACTGAAAGGGCTCGTTTAC TTTTACGTAGAGAAACGTCTCGCAGNGTATATTGACGCTAATACTGAAAG GGCTCGTTTACTTTTACGTAGAGAAACCTCTCGCAGCGAATCAAGTATTT ACCACGAGGATGAGGACGGAATTAGTTCCCATACCTCTTCAAATGCATCG GATAGTTTACAAGGGTTACACAGTGATTCGACGTTGGAGAGTCACCAACG TATACAAGGAAGTGCTTCTTTTTCGCATAAGAAACGTCAACAGCAACAGC AAAGAAAAGGTATGGGTATTTATCCTCTTATTTggtcttattcatgatat gcaccactggagagtcttctgagaacttttaaaattttccacccaatacg tcacttaaacaatagaaaaagtgacgtattgggttgaacaaaaacagaaa agttgcataatttcttgaagtcattgcagtggtgcatatcatgaataaag gcCCATTCCGGGGAAATGTCATCCACTATTATATTACACCCGATTGAACC TTGTGTTATCATATGGTGCATTGGTcacaaccactgacctttatatacag GTCAGTGGTCACAACGCTTTGTAGTATCCAGTCAAATTTTGAACATGCGA CTTAACTTATCGTATCGTCAGTTCTCTGGACTGGCCGTAAAAATTACGGT TCTATGCAATTTAATAAGctgcttttttactttttccagcactttttgaa agtaaataattgattcatttgaacataacttttgatccaattaacaaaat tatacaacaaaatttaagttttttttgttcCCTTTTCCCATACAACAAAG TTTGTTCTAGAGAGGGCGTTTATTGAAAGGTAGGTGTTTATTCAAAGTTA TATGGTATATTCACTCCCTGCCCCGCCGACAGCAAACCAAACAActatct ttattttttaaccTCATGACAAAGACGGTCAAAGTCTGACCAGACATGTA ACAATGTACAATGATCTTGATGTTAAAATGCTGCTGTTTCAAAGCTGCTT TTATCAACTTTTGTTTAATCCAAGCTGGTATTAAAGTAACGTCAAAGTAA CGTGTATCTAACACCAATAACGTTGAACCAACATTGTGTGCTCTAACTTC CtaataaatttcttttgtttcttccTACCTCAGGACACAGTCGATCAAAG TCTGACCAGATAGGTATTCATCATAACCAACATCACAACACAATTAGCAT GATGAATCAAATGAATATGGAACTGAGCTTGCCTGGTGTTTCACTATCAT TACCTAAAGAGATGGATACCACAGGTTTGTCTGAGAAAATATTAATGTAT TCTTAACTTCAGTTGAGCCAGAATCTGAGATTGTCTATGCATCTGTCTGT CTATTCcctcgaaaatttgggggaaataaagaaaatggtccaaaatttTG TGCTCTTGATTCCAGAACCGTCTAACTATCAATTTAACGAATTTTCATTA ATGATCTGCCACCTCTTGAGTGTCTgttgacaatttaaaaaaaatttata cttAAGATAACTATTTTATGATATAAAAAGGAAGCGCGCCTTTATGGTCG ACAAAGCTGACAAGGACTAGATACGGAAATCTGAGGCATTTCGTGTCTTC TGGTTTAGCGTTGATTTTCTCCcctgtttcagccattttgtgGACACGCC TTCACGTGAGACACCACTCGTTTGGATGTTGCTCTCTTTGGTCCATAAGT GATGgagccttggagtttttacaagatacttcactaattggtcatttaaa gtgatagagatgacgcgttctttagaaaaagtaataagattcttttatta aatcttaacgaccaaccaaatcaaataagagcttgtaaaaactccagctt gtcccaagtGATGTGCAGATGTCGAATAACTTTCCAAACGTGTTTATTTC CTCCTTTTCAGACGGACTTTCTTCTTCACAACAATCTCACAGCCCTGGTT ACTATAGATACGATGATGTTCAACTCGTACCCAGACCCTATGAAGGCCAA TCATTGTTCAGTTATTTGGATTCCAGAAACTATGATACTGGTGCACAACT CGACAAGGTATGTTTTGGACTTGGAAATTAGTGCACCCGTAGTTTAACGA AATATAAAGCGGCAATTTCTCTTGCTTGCGTTGCTAAAATCGACCTATTA GGAACGTGGACGAACTTTTAGGCCAGAGGTATTTAATGTGATATACACAA GTAAAATGAACAAGTCAATTTCGCTGAGGCTCGGCTGCTGtcattttttt catgattttgatcgCTTTATTAACTTTGAGGAGGCTTAAGATTAGcattt tttagccatttgaaaaaatatgtaGGAATGAAAATACGAATTGACCACTA TTGGGCCGTATGCATCGTTCTTACGAACCTAGGATCAAATGGTAGGTCTA TAGATCTGATGTCGTCGATCACAGCACTTAGGTTTTTTCAATGTAGAAGT TTGAAGGATTATCACAGAACTGTTTTTCATTTAATTCcgtcaatttttaa tttttatgtttgtttTCAGGAGAATGCACATTTCAGTATATGTGAAGCTC TAATCACTGCTATCGAAGAGGTAACCTGATCACTACTTTGTCATCTTTTC CTAGTATGAAAAAAGTTCTAAATAGCCGACAATGTCTTTGACCAAATAAA ACTAccacaaaaggtgttggttgacctagacagcaggacggtggccatgg aagtcgGAATCCGCTAATTGTCCAACTTTTTGCCTGTTTCTTAAAACTgc ctttttcttttattgaaacTAAATGGTCCCAAATTGTTCTTTCAAGAAAT AAAGACCTACACTTTCAGGGGTTGGTATGGTTATTGCTTGATAAACGACT ATAACAGAGACAGGAATAAATAGCCTCTGTGTAGTGTATCCTCTTTTGTT CTAGCCTTTGTTCTCTGAATTTTTATCGAGTCTACTTCGTTTCtgaaaaa agtctaaaatccGACTAATTTTGCACAAGCGACAAGAAAATGCGCCCCAA AAGATATCATAGGTCTTAAAGGTAGTTGTCACTATTTCTAACGATTATGC ATTATATCTCAACCAACAAGAACAAGagtaattaaaaagtgaaagaagAT CGCATTGAGAAAATTTCTTGCTggaccagataaatttgataaaaaaagtg aaaactagaaatttaattttattcattatttttgacgtttcggtgtcttc tTTGCACCAAGATCACATTGCTGTCAGAATTGTGTCTCCGTAACTTTATA CAATCTTTCACCGATTTCAAACAGATGAGATGTCAAAGATTCGACCGCAT GTCTTCTAAACGCAGACGCACTATATTAAACAACGACAACGATCTTGCTT ACGATAGTGGTTCGACGTCCGTTCTGAGTGACGTCACGGCATCTTCGGGA GCATCATCCTGTCACAACAAATCATCTGCTACGTTACCTTCCTCTTCTGA TGCCCTCACTGGTAAGAGATAATGTTTTTTATTATTCGGTGGGTTTCAAC AATGCTGTTAGGTTCTATTTGAAtttttaccgagtttatgtatgtgtgtt tttctgcgacggagacggtaaggttctaatttgtctacatcctgactATC TAGGACGACTGTAAATCAGCACTTTAACCGTCCTCGATATTGCGAGTTta tattccaaatcgcttcagacactttaccgtcctcaaaagtgcaaatacat aaactctctTTTGTGGGAGGTGTCCTCGCTACGATCTAGGGCTCGCAAAC GCGTGTTTCCAATAAGGTCGATGCCCTCAAAATTGCGAATCTAAGTTTTA TCAAGACGGTAGTCCGTAAATACCCTGGTATagcaagaaattattttttc ctccGTTTTCCTTTAGAAAATAAAGCAAGTAGCAGGTTTTCTCACATTTT CTAATTATTTAGTCACGTTGCAAAATTTTGGGGTTTCTAGTTCAAGTTCA AACTCTGCTAACATAAGTATTTAGTTGCAAATCTGACTTGCAATTCGACA AAATGCTCTATACCATATTGGTAGAGCGGTATATCAGCCAAGAATAGaaa ataccgggtgcaccaaaaaaaagtatacaggtttgtcgagatattgtgag cttcaggatttaatttttttgtttattctttttttattgtatagaggatg ctttaacttgaattttgagctatcataattaaaatttgaaaaagtagttc gaaagttatttaaaaaaactgactttttttccatgtcgaaatttcaaaaa atcattaaaaacagcaatcacgctataagcaaaacaaaatggcaaaaaca caattttattgtttttttgttgttattttttcttatttatattttgccaa cagtttctccatcttatttgcCTGTCCTGAACATTTAGGAATGGTGatat gtactagttatcgcatgatttcgagtgcaatacgagaaatattttacgag ttccgatatttttccgtaatatttttccgagcctttaggcgaggaaaaat atcggtaaaatctcggaacgagtaaaatatcgagtattgcacgagaagtc atgtgataaNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNgacgagtaaaatatcgagtattgcacgagaagtcatgtgataact aatttattgtcgactcaaaaaaattgtcctctttttgtttcaaaacttac ttccgccttcttctgcctcagtgtagtttcgaatgtttttattcgaaaat ctaattccaacgttagattcgaacaaaaacattcgataacttcccgctga aaatattcacacaaaaacaaaacttttcgatcattttcgatccagaagtt ttgttttgaaaagttgcagatttttcagagatgcatttgaaagtttctag attgataattcaaaatgcagatgatgtacagtattgtttcgatgaAGAAG AAACCttccatcattggattaatcagattgaattgataacattcagtctt tttctattttcttgttTCGATGACATATGGCcatggaaaagaatagcaga ggtaaggagtcccacgatggaaatgtatgcttgtaaaaatggttaaagaa caacatttttttcaacagcaaaacaatttggatactttcttgatcATCGT CAAGCTCTTAATGTTTCGAATTTcagaaggaagatgtaatgattgttgag ttgaaaagtcaaggaccgtacgttgttgtcgagaaagagaattaggagag aacttttataaaaatcactcgtcatttggtttaatacaagacattacact tcccttgttatgttatgagaatttttattggcaaacattcaagaatctca agttattttgtatgcattgataaaaagcTGTTTGGTTACCACAAggacaa atttgccaaaagttgaaaatatttgggtggtgttaagtagttttataatt tcttagttcatcagatttgattttagtgtattttatggaagaactccaaa ccaaagtaaaagttaatctgaacatatttttgttgcgtttttccctttga ttcccaagtcagtttctccgaaggtcagttcttttcggctgttttgtttt tatttttctcccgcccgcttacccagtcccccaaaagtcaacccggtcat atttccagactaaagacatatgaaatatcgcaaatatctcgatgctctcg accaatcaaaacgctgatatttttttgggtcggcaataaatcttttttat taaagttttctcacatagcacacacataacatcaaaacctcctctcttgg agatttcaaaaactttttatcagcttttccaaaaatattatcccaaTAAT ATAATAAGCTTGCTttaccatatttttaaattctgtaatgagttttgatg aacatagctgcattttttggtatttttatgtgtaaagaataagtgtcaag agaaaagtttgcttgttgtttttgatgatttgttgtttcttttaaataac tttcgaactactttttcaaacctaatgtatgatagctcaaaattcaagtt agggcatcctctatacgataaaaaaagaatgaacaaaaaatttaaatcct gaagttcacaatatctcgacaaacctgtatacttttttttggtgcaccca gTAGATAAATTTTTCTCTACTCTTGACTGATAAAAGCTTATTTTCATTCC TTCTAATATTATCATATTCCCAATCCCATCATAGATGACGCATGTATATC CGACTCTGCATTCCCGACGATGGCTGACCAACGACGAAGTATCGGTATGT CATGGGAAAATGTGTCGGTGTCACCGAGAAGGTTGAAACGAGAAATCTCT GAAAGTGAGAAACCGGAAATCATACAGAGTGAGGAGATTCCACCCAACGA TTTTTCAGCAGAAGCAGTCGCTAAATCTCTTTTGCATGTGAGTGATgcag tattcatgatatgcaccattgcagtGTCTTCTAACCCAACATATTTTTAA TATAAACTACGTAAAAccaatcaatacgtcactttcaaccaatcagctgt taggtccgtggaagacattgcaatcaTGAATTGAGATTCTTCCGTCTGCA AAGGAAGTGTGTTTATTTGAGGTTTCTTACAAGGATTTCAATCACTAGTA ATTATCTTTGGAAAAAGCTTTCAGTATTTAtggtatgcaccattgcaatg tcttccacggaaccaacagctgattggttgcaagtgacgtgttgactgat tttacgtagtttacaaccaatcagctgtgattcgtgatgtaatgtcagaa gtcattgcagtgatgcatatcaGGAATAATTCCCGTCTAGTTTGGATAAA CACTTATACAACATCTGGTACCAACTAGAACCAATACCCCTTTTTACTAT ACGAATgaactatatgagaacataaggcttacACGATCAAAATATTACTT TTCGTAGACTCTATATCACCAAATATCTTATGAggttgcacaaaaatact cacatcAAGGAAATAAAGACATCTTAAGATAAAAGGTGTTTGATGTTCTC ATAAATAACGTTTAGGATCAATAAAGGAAAATACCATTTCAAATGATTCT TTTCTTATTGTTTCATTATAGAAATTTCAAGGCCACAAACTTCCAGCTGC ATCCGAGCTGAAATGGATCGTTTCCGAGTTGGAAGCACCACAAGAACTTC TACCCTTACCGACAGCATGGCCTATTTCGCCGGACAGTCATTTAACGGAC AACCCACCTGAACGTCATGTTCAAAGTGGAATGGGAAAATCGATGCCTGT AAGTCAAAGATTTACTCAAATTTCTCCTTGAAACTgtattctttaaagaa aatatcGTGCTTTCCAAATCTTTGCGTGTTCGTGTATCGTCCGGATTATT TGTTCACTGTTATGAACGTTGAATTTCAAGCAATCAACAACATTCATGAT TGTTTCTCtatgattttatatttttgtagagTTTATTACGTGGTAATTTC GAATGGGCACCGCCTCGATTACAGATTATCTTTGTCCCACACCCGTTTGT AAAGTAAGTGATATCGAGACAAGAGAGTTTGTTTATCCTTAAAATACCAC TATTTCCATTGAGGGTGAATTATTTATACCAGAAAAACAATAATTTTATG GAGTTGAtttagttttatattttttcaccatgtaataaaacaattacgTG AATATTCTTTATTTTGCTTACAATTTttacactcccttctcacagaccca ctgggacaccttcccaatgaaaaaatttgccaaaatatcgtccccagtgg agaattatactttaatttttttcctcGCTGAAAATTATCAGATAAGGTAA TCCTCATCAAATTATtgtgctattttattgaattgtattgctcgaaaaca atggaattaaaatccccagtcataagaaaacatgggaatatcgatcccca tcgagttttggtccgctATTTTTAATCCCGaaggctgaaaaaatcccaca gggtctgtgagaagagggtgtacTTTTTCAACGAATCCTTCAACCTTTac atatcatataccgttgcAAAGTTAATTCAGACCACTAGAATCTCTGGGGA AAataattaaaacaattttacaaaattgagataaaaaatgtagatgaaaa aatgaactttttactAATAAAAAACtcagtgcacacttaaagcaaaTTAA GTCCTTCAGTCAGATGCCACATTGCCAATCAAGCAtaatcaacaatcaaa tcaatcgaACAAGTTTCAACGCGATTGATCGATTGAAATCTGATTAtaga attcaattcaaaactgAAAAAGCCCAGACAATTATAATACGAttcacaaa atatttaattatgctattttggcttttttttcaGGCGAAAAGTAATGTTA CAAAGACAACATTATCGATGTGCGGGTTGTGGCTTGAAAGTATCACCAGG TATTGAAAGCGTGAGAATCTTCTAAGCTAAAATTGATTTAGAGTTCTTTC TTTGGTCctgtttttctgaaaattaaacTTCAACATTTCAAAGTAAACTT GGCCGTGTAGTCATCGTGATTTATCGATTTCTTTTTGTTCGGTTTTAGAT TTATCGAAACGATTTCGCTACTGTGAATATCTCGGCAAATATTTTTGTAC CAGTTGTCATCAGAAGGCAGAATCTGTTATTCCAGCCAAGATATTGTCCA AATGGGATTTCAAAAGGTATCTCATTTTTCGTTCGGCTTTGCTTAATTAC CTGAtataatttcaatgttttttaattgATCCTAACAGCTGAACCTAACA TAAACcctatggaatttttttcaatgccagccgaccaaaatttatttttg aaagtggtaccctaataaTAGAACAAGTCAATAGCGGTTTAATATATCGA CGGCGCTGGGTCTACTTTCTTTGGATACttgtgatgtagcgccgttggAC GTTAGGTAAAGTTTTAACCCTTCTTTGCGGGCACCACTTTTAATTCCGAT TAAAGACATAGGATAGAGCTTAGACGAGACTCTACGAAGGTCAGTAGTTT AAAGGCTTTTCCATTCCATCTTTCAGGGTATTAATGGCATGACATTAGGA AGAATTGAGAGAAACTTTAGAGTCATCTAATTTTGAagcttgttttgttt ttatgcgtaccttatcggggagaactttgtcggggaaaagtgacgaaact CTAGCCaaatgaagaatatttttcctGAAGAAGTTTAGGTATAACTTACC CGATAAAGTACGCACGATTTAATTTCTATAATCTCTACCACATACAATAA TAACATTTGAAGGTTATTTTTCAGGAAATGCAttaattttctgtttttca gatattttgttTCGGATTTTGCACGTGACCTATTGAAGAAGATACACAGG GATCCTTTGTTCAATGTTCATGATATTTCTCCGAATCTTTACGATCGCGT CCGGCCACTCAACACAACCAAAGTAAGTATTGTGTTTTCCAGGCCTTTAA AAACCTGTGTTTTGCCTCATGCAATTTTTTGATTACTTTGTATGGTGGAG TACTTCCATCCTAATCCAGATAATCGACTTTTAGTGGGGAAACCTTTTCT TTTTGCTAACGAAAAAGCCTTTTTGTTTCGCTAACGAAAAGATTGAGAAT AAAGTTCttggaaaaaaacattatcaTAATTGATAGTgtaataagtaata gttattgcatggtacagagtacaatatgggatatatttttcgagttcaga cTTTTCGTCATATTTTCCAAGCCTTTAGGCTTCATTactcaataaatatt tttccataagaaaatctttttataaGCTCAGTTTAATAAGCTCATGGTTT CATTGCCTACTTTATTTTCTTCACTCTTTTGACAGAATTTACGAGTTCAA CTACATTACATGAAGAAGTTTTTAGATAGTTGTCGATACGCTGAAAGGTG TGTATATTTTATTATCAATCTACTTGTCTATTATAATATTCACGTTATAG agactttttttattgaacCATTTGATAAAGGGGCCAAAAATCTTACTTTA ACTATTTGGAGATTTTACTACAGCAAAGTCtatttaactcgaatgtctcc ttaactcgaaagaGTTTTCTcgttccttcagttaacaataccttattAAC CAATCTCCGTAATTCGAAATTTCTTCACTCGAACAAATCTGTGTTCCCCA CGTGCGTCCTCGAGATATGGAGACCCCACTTTATAtgaattttaacaata ttttgatAGCTGTCAAAAGGAGGTGATGAAGTTACCGATGCATATTTCGG ACGACCCTCATGTTTACTCCATTGATGACCTGATACAGGTAATTACATTA GTAAGCAAATGTTAGCATATACATttgacgttctctaattcgatgtttta ctcttcgatacgctccattattcatgatatgtacaattgcaatgtcttcc attccacccaatagctgattggttcaaagtgacgtattgactaattttac gtcacttacaaccaatgagcgattggttccgtgatgtaatgtcagaagac attgcagtggtgcatatcatgaattcgaCAATATCGAAAGTCATCTTCAA CAAGAACCTCTTATAAACGACGTTCTACCATTCCATACGATCAAGGTCCG CTTGAAAATCAaactagagagcgtcaactgtaggcAGAACAACCGGCTAG GGtgcacaaggttgtgggttccaCTCAAAGGAGGATNGATTGTCCTGTTT GCCTGATGGTTTTATCTGGGATACGAATGTAAGTCTCAAAACAAGTGCTG TTCCATCTACCAAGTTGTTTAATTAGCCAGCTTGGTAGTCCTGCTGCTGC TGCTGTTGTGGCGGCTCCTATTCTGAAGGAGTGGGCTGAGATCGGATGTG TTTTGGTATTATGAAGAATAGTGTGAAGGAACTGGTTGAATCTGCGCCTA GTTAGAAACGAAACGTTTGAAAATGCGAAGAGAGGTCCGGATTTTTTCGG ATGCATCCGGCAGAGGTCCTTTAGGTTACGAACAGGACATATTGGGTGAC TGGTGGGACACAGGCGTATGACGCAGCCTTGGCGGAAGGGGTCTGTTTTT GATGCTTTTATGTTGACCAGGGCCATGGATGTCATTACGGTGATGTCATT GTATAATAATGTAGTGGTTGGTTCAAACTTATGCGAGGATGGTGAGAGGT ATTCTGATGAGCGTAGGAAGCCAAAGAATGCTGTTGTACAGGCGGTCCAT AGCATTTGTCGGTCAAAGGTGCAATATTCTGAATTTAGCAGGTATTTGTA AATCTGAGTAAGTAGTTCAACTGTGATGGGTTGCCGTTTGGGTTTTTTGT ATTGCGGGCCCTGGGTGCGTTTTATGCTGCGTATGAGGAGGTATAGTCGT GGAAGCGGTGGCAGTTGTGTGTGATAACAATATCGAATATCGTGGAACTT TAGTGCTGATAAGTGCATTTTGATGTTGTTGTATGACGAATATTCAGAGA GAAAAGTGGTGTAAAGCATTAGTACTTCCTCGGTTAATGGGAATGTTTGT AGGTGGAAATGTTGGCAGAAGTTGGAGTAGTTGGTAGTGCATCGTTTGTA TTGTTCGTTGGTGCTTGGGGCCAGGGTGTTAGCCATGAGATGATGCATTT TTGTGGTTAGTCTCTCGATGGTTAGACTTCCCAAGCGTTGGATGGTAGCG GTGTTGGATGTGCGTCTGCTGATGGTGCTAGCTGCCGGAATCTTACGTCC TGGAAACGAGAAATAGCATCAGCTATAGGGTTATCAAGGCCATATACATG TTTAAAAGAGATGAAACATTGAAGTCTAGCCGCAGTTAAGTATAATGTTC GAATGAGGGTCATGAGTAGGGGTGATTTCGTAGAGCCAGCCTGCCAGATC TGAGTGATTGGGAGATTGTCTGTTAAGAACACAATACGTTTCCCGGCCCA GTTATGCCCCCAGGTCTTAGTTGCGATGACAATTGTAAAGAGTTCTTTAA AATCAATGTCATATTGTACGTTGGTAAACTGCGTGGGCCAAGCTGCTTGG ATCCAGGAGTTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNGataataagtaatagttattgcatggtacagagtacaatatggg atatatttttcgagttcagacTTTTCGTCATATTTTCCAAGCCTTTAGGC TTCATTactcaataaatatttttccataagaaaatctttttataaGCTCA GTTTAATAAGCTCATGGTTTCATTGCCTACTTTATTTTCTTCACTCTTTT GACAGAATTTACGAGTTCAACTACATTACATGAAGAAGTTTTTAGATAGT TGTCGATACGCTGAAAGGTGTGTATATTTTATTATCAATCTACTTGTCTA TTATAATATTCACGTTATAGagactttttttattgaacCATTTGATAAAG GGGCCAAAAATCTTACTTTAACTATTTGGAGATTTTACTACAGCAAAGTC tatttaactcgaatgtctccttaactcgaaagaGTTTTCTcgttccttca gttaacaataccttattAACCAATCTCCGTAATTCGAAATTTCTTCACTC GAACAAATCTGTGTTCCCCACGTGCGTCCTCGAGATATGGAGACCCCACT TTATAtgaattttaacaatattttgatAGCTGTCAAAAGGAGGTGATGAA GTTACCGATGCATATTTCGGACGACCCTCATGTTTACTCCATTGATGACC TGATACAGGTAATAACTTTAGTAAGCAAATGTTAGCATATACATttgacg ttctctaattcgatgttttactcttcgatacgctccattattcatgatat gtacaattgcaatgtcttccattccacccaatagctgattggttcaaagt gacgtattgactaattttacgtcacttacaaccaatgagcgattggttcc gtgatgtaatgtcagaagacattgcagtggtgcatatcatgaattcgaCA ATATCGAAAGTCATCTTCAACAAGAACCTCTTATAAACGACGTTCTACCA TTCCATACGATCAAGGTCCGCTTGAAAATCAaactagagagcgtcaactg taggcAGAACAACCGGCTAGGGtgcacaaggttgtgggttccaCTCAAAG GAGGATCATACTAAGGatctaaaaatgataattaatgTCTCTCTACTTGA TGCTAAGCGACTAAAGAAAAGGGTCTAGGGTAATTGGAGAGAAATAAAAG GACTCTCACAGGGTAAACAGCTAAGGTAACTTTGGTATGTCAGCCATCTT TGAGACCCAAAGTTAAGTCTATAGTTATACTTATAAGTATTatacttttg aaagaaaaaagatgtaGATCCTTCAATACTCCGAAGAACACATGCGTTTT CATAACGAAAtcttttgaattaaaagttttgtttttaatttaaataAGAG TGTTATCGTTTGCTTACCCATCAGTTTTAATTCACAAGCATTTTTCACAT TTgattgacatggatgtggagcaagattggtcagaaagagtaaaagaaaa acattttttgcttatatcaggacaatataacaatagcaaggcACTCTCCT GATATataatatgtgtctgatatgaaacggaaacacttatgtaaagtTTT TCTCCACAGGTGAAGAATGGGGAATTGCACAAGACGTTGAGTGGAGTGAT AACACGTGGTGACAAGCACATCAAGGAAGATTGCCAGGTaccaaaaaact gattttgaattttggccataacatttcttttgtttatgttggacggtgaa aaagaatgcggctattatattttgatttttcccgacatgtttcggactcg gtccgttctcaagggaatcatttcttttgtttataagcataacgcttgtA AACATAGTCAGGTTGAGATTTTGGCTTGGAAACAATTGGTGTGATATTAT AGATAGATAGGTATAGATGGATAGATATGCCTCGAAATGGGTCCTACCCT CGATgaagtaggaatcacagcgcaatcagacattgcaaccctgcagacgc gagctgccgagccaaggcgtataccatgacactcgaactacacgggagaa cggatgtcctcgcaggtgtagaGTTGCCTGAGTGTCTTAGCGCACCACAA TATCTGgaatatctacccatactcttgtatcagagttatggtgACAttat agaacaatagaaatttaagNGTCCGgaatatctacccatactcttgtatc agagttatggtgATAttatagaacaatagaaatttaagCATATGTCCAGC CTCAGCTCAAATGAACGCTAcgttaatatttttaaaaagcagGCTTCAAG TAGAAAAAACCCTTTCCGACTATCGTTCttcctcgaataagcgccctgGC GCTCTTCAAATTTTCATAGATTTTGGTGTTGTACTCTTTAGAGGTTTTCT TTCCCCTAGTTCCAAGTTTTAATTCTAAGTGTGGTGGTAATTGTAGGACG GTTCTCTTTCTGTTAATTACCTTTGTTAATCCATATATTCTCCCGTTGGG CTTGTccagataaaaatatttttaccaccgctgttgaggatatcctactt tattagtaaagacattggaatatccactcttaaaaatatgcttatCCCCA TGAATATCCTCTCTTGATATGATCTTTCttgatatcgtattttttactta tcGTATTACactttacccctggatatccgaaacactttcttttttacata ttttcattCCAGGTGTGTCAGTTGAAAGGTTTTATATGCGAAGTATGTTC GTCCGATGAAATTCTTTATCCATTTGAACTTAGGAAAGTTCATGTCTGTC aaagtaagtttttttaaactgaGTGCTTATTTTCTAGTCTGGATCTCCAA GCTGTAAGTCATTTTCTTGTTTCGATGTTACTGCTATTTACGGTTCGGCa aattaaaatttacaaaaagacCGCTAAGAGTCCAGTTAATTTAGCAGTCA TTTCGAAGCACCCGGGCCCAGAAAGGCCTTAATCTACCGGTCGATATCGT TTTTAGATGCAATCGTTACTAATAAACACTATAGAACGGCCATGAACGTC TACCAGGAACTTTTCGAATCCAGATTTTTTAGAAGGTCTAAAGGCAGATT TAAAGTAAATAACTGACCGCTATGAGACCGCTCCAAATACCGTACTAAAA CCGGTCCGATTTTCAGGTGCTTTAAATCGCTGGGGGAGTCACATATAAGA ATGCAAATCACTTTAGGAAGACAAGACGGTAAACCAGAAAcatcaataat aaaaaaagtttacagcctggataccCTGGCTAAGTGTTTCCTAGTTTTTC CATATTCGTAAGGAAGGGCGTTATCATTTTACCATGCTTAGAGTGAAAAT CTCTCTAACGTTGTTAAACTTGCGCGTATTATATAAGTAACTTTCCCAGA ATTGTCTAAATCTAAGCTTAAGGCTTATTAATCTGCAGTGGCATAGAcac aaaatatattttaggAGGACCCTATATGTCTAGTATCTAAGgagggccca ccatggttggggccgacggggCAGGAAAATTTTTGGACTTTATACCCTCC AGACTGCCTCTCCGAAAGtcaattttctacaaaaagtaaGTAGAAATTGC GTGCATATtagtatattttcaaatcataagACTATCCTCTTACATAGTTA GTGCGTTAGTTAGATATCTCGTTCTGTGGCACGCGTCGGCTCAAcgtaaa aaaggtaaaaagagGGAAGAGATTAAGCAAATAAATCAAATAAGTAAATA TACAGACAACGTTGACGAAATTtacacctttttcaaaaaaacaccaTAAT CTAAAAAAGCTTTTGGGGGGCCCAGGCCCCCGGCCCCCGCTGGCTACGGC ACTGATCTGGTCCTAGATTATAGGGTTTATtgatgtactcttaggttcca aataaacgccccccctcccttgttaatttttcgaaaatgttctattaatt tttaagaattttttcagctttcaaagagaaggtccctgATTCTGCTCTAA ATAGCCAGATTTTgacctatatttaccttattttggggttttcgcaagta caatttccaacccccggcaattaggcccccccccccccccttaatttTNN NNNNNNNNTTTTGGGGTTTTCgcaagtacaatttccaacccccggcaatt aggccccccccccctttattaaTTTTCCAACTCCCCCgcttatttggaac ctaagagtaacgcTTTGACTCGCTTGGTCGAATATTGCCAAATGTCTAAA GTTGCTGCATTACTGACTCGTCCCAATCCCCTTTGTTATGTCATGATTCG TAGGTGTATCCCTTGAATAAGAATTGTCTTAATTCTTAAACGTTCTCTCG GTAGGTTGTAAAACATGTTCACATAGAAGTTGCTATGTCAAAGGGAGCTG TAAAAGATGTGAAAGGATAAAAGCAAGGTATCGTTTACGTTGTTTTTTCC TATTTCCCTTATCGAAAAACCGACTATCGAATTAATCAGATTTAATCGAA TTTAATCGAACGGTTTAAATGGACTTAATCAAAACCGCAAAGGGTAGACA ATTTCTGTCATTATTATTCGATAGATTcgatttttaattaaaaacttCAT TAAAAAAACCATTCGGCTACCGATCGAATAATAATCGAATTAATCATAAA TATATTACAATTGATTAATTCCACTGCCGTCCGTTAAATCAATTACAAAA tcacaaatcgattttgatTATTGTTTGTCATTAGCAAAAACttcacacgt ttttttatagagcatccaaaaattttgaagccttcggatgttcttaactt tttgagttttaagcctaaaaatgttcttaacttgttctcaatattttaac cagcgaagccttatgttcttttttagttttttcttataaaaaaaacgtgt atttgtaTAAACTGTCTTGGTTTTGTTAGTAATTCATTCACTTTTTCATT AACATATCTACTCTTTCTCCATTCTTTAGAAAATTGTTGGTCCAAGCAGA CCTGCCAGAATCACCGGAGCTTGAATAACGATGGATTTTGTTAGGaaagt tttcaaattcaattagtttgacaatttattttctttacttttgcAGAAAA AGGGACGACCTTTCAAAGCATAGTTCTTTTAACATACGTGATATTTTTAC TCTCGGATACCTAATAACaaagtccgtataaaaaactaTGGTCTgcaagc ttattgttttaacttttaggTATCCGAGAGTACACGCTTTCACGATGACA ATTTCGCAACAACACTAAGCTTTATTTGGCCAAAAACAAATTATGAATAA AACTGAACCTTAGAAATTAGTAATTACTATTAACGGTTTTTTGTGTCTGA AAGTAAGCTTTTGAATTCGGAAATACGAATTGAGCAGATGAGCACCATGA TTTGTCTAGTTCTTTCCGTGTATCAACTGCATTCTTCATATCGTTCTTAC ACCCCTGTTTCTCAGCCCCGAAGGAACTTTTTCGAac
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_045635XLOC_045635Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073523-exon-scaffold_94-1491911889:95011..95349TCONS_00073523-exon-scaffold_94-1491911889:95011..95349Clytia hemisphaericaexon
TCONS_00073523-exon-scaffold_94-1510915933:95011..95349TCONS_00073523-exon-scaffold_94-1510915933:95011..95349Clytia hemisphaericaexon
TCONS_00073523-exon-scaffold_94-1575043694:95011..95349TCONS_00073523-exon-scaffold_94-1575043694:95011..95349Clytia hemisphaericaexon
TCONS_00073523-exon-scaffold_94-1491911889:109434..109689TCONS_00073523-exon-scaffold_94-1491911889:109434..109689Clytia hemisphaericaexon
TCONS_00073523-exon-scaffold_94-1510915933:109434..109689TCONS_00073523-exon-scaffold_94-1510915933:109434..109689Clytia hemisphaericaexon
TCONS_00073523-exon-scaffold_94-1575043694:109434..109689TCONS_00073523-exon-scaffold_94-1575043694:109434..109689Clytia hemisphaericaexon
TCONS_00073523-exon-scaffold_94-1491911889:110288..110394TCONS_00073523-exon-scaffold_94-1491911889:110288..110394Clytia hemisphaericaexon
TCONS_00073523-exon-scaffold_94-1510915933:110288..110394TCONS_00073523-exon-scaffold_94-1510915933:110288..110394Clytia hemisphaericaexon
TCONS_00073523-exon-scaffold_94-1575043694:110288..110394TCONS_00073523-exon-scaffold_94-1575043694:110288..110394Clytia hemisphaericaexon
TCONS_00073523-exon-scaffold_94-1491911889:111862..112469TCONS_00073523-exon-scaffold_94-1491911889:111862..112469Clytia hemisphaericaexon
TCONS_00073523-exon-scaffold_94-1510915933:111862..112469TCONS_00073523-exon-scaffold_94-1510915933:111862..112469Clytia hemisphaericaexon
TCONS_00073523-exon-scaffold_94-1575043694:111862..112469TCONS_00073523-exon-scaffold_94-1575043694:111862..112469Clytia hemisphaericaexon
TCONS_00073523-exon-scaffold_94-1491911889:113344..113484TCONS_00073523-exon-scaffold_94-1491911889:113344..113484Clytia hemisphaericaexon
TCONS_00073523-exon-scaffold_94-1510915933:113344..113484TCONS_00073523-exon-scaffold_94-1510915933:113344..113484Clytia hemisphaericaexon
TCONS_00073523-exon-scaffold_94-1575043694:113344..113484TCONS_00073523-exon-scaffold_94-1575043694:113344..113484Clytia hemisphaericaexon
TCONS_00073523-exon-scaffold_94-1491911889:114122..114267TCONS_00073523-exon-scaffold_94-1491911889:114122..114267Clytia hemisphaericaexon
TCONS_00073523-exon-scaffold_94-1510915933:114122..114267TCONS_00073523-exon-scaffold_94-1510915933:114122..114267Clytia hemisphaericaexon
TCONS_00073523-exon-scaffold_94-1575043694:114122..114267TCONS_00073523-exon-scaffold_94-1575043694:114122..114267Clytia hemisphaericaexon
TCONS_00073523-exon-scaffold_94-1491911889:114730..114780TCONS_00073523-exon-scaffold_94-1491911889:114730..114780Clytia hemisphaericaexon
TCONS_00073523-exon-scaffold_94-1510915933:114730..114780TCONS_00073523-exon-scaffold_94-1510915933:114730..114780Clytia hemisphaericaexon
TCONS_00073523-exon-scaffold_94-1575043694:114730..114780TCONS_00073523-exon-scaffold_94-1575043694:114730..114780Clytia hemisphaericaexon
TCONS_00073523-exon-scaffold_94-1491911889:115485..115671TCONS_00073523-exon-scaffold_94-1491911889:115485..115671Clytia hemisphaericaexon
TCONS_00073523-exon-scaffold_94-1510915933:115485..115671TCONS_00073523-exon-scaffold_94-1510915933:115485..115671Clytia hemisphaericaexon
TCONS_00073523-exon-scaffold_94-1575043694:115485..115671TCONS_00073523-exon-scaffold_94-1575043694:115485..115671Clytia hemisphaericaexon
TCONS_00073523-exon-scaffold_94-1491911889:118445..118647TCONS_00073523-exon-scaffold_94-1491911889:118445..118647Clytia hemisphaericaexon
TCONS_00073523-exon-scaffold_94-1510915933:118445..118647TCONS_00073523-exon-scaffold_94-1510915933:118445..118647Clytia hemisphaericaexon
TCONS_00073523-exon-scaffold_94-1575043694:118445..118647TCONS_00073523-exon-scaffold_94-1575043694:118445..118647Clytia hemisphaericaexon
TCONS_00073523-exon-scaffold_94-1491911889:119332..119508TCONS_00073523-exon-scaffold_94-1491911889:119332..119508Clytia hemisphaericaexon
TCONS_00073523-exon-scaffold_94-1510915933:119332..119508TCONS_00073523-exon-scaffold_94-1510915933:119332..119508Clytia hemisphaericaexon
TCONS_00073523-exon-scaffold_94-1575043694:119332..119508TCONS_00073523-exon-scaffold_94-1575043694:119332..119508Clytia hemisphaericaexon
TCONS_00073523-exon-scaffold_94-1491911889:119690..119763TCONS_00073523-exon-scaffold_94-1491911889:119690..119763Clytia hemisphaericaexon
TCONS_00073523-exon-scaffold_94-1510915933:119690..119763TCONS_00073523-exon-scaffold_94-1510915933:119690..119763Clytia hemisphaericaexon
TCONS_00073523-exon-scaffold_94-1575043694:119690..119763TCONS_00073523-exon-scaffold_94-1575043694:119690..119763Clytia hemisphaericaexon
TCONS_00073523-exon-scaffold_94-1491911889:120595..120659TCONS_00073523-exon-scaffold_94-1491911889:120595..120659Clytia hemisphaericaexon
TCONS_00073523-exon-scaffold_94-1510915933:120595..120659TCONS_00073523-exon-scaffold_94-1510915933:120595..120659Clytia hemisphaericaexon
TCONS_00073523-exon-scaffold_94-1575043694:120595..120659TCONS_00073523-exon-scaffold_94-1575043694:120595..120659Clytia hemisphaericaexon
TCONS_00073523-exon-scaffold_94-1491911889:120809..120926TCONS_00073523-exon-scaffold_94-1491911889:120809..120926Clytia hemisphaericaexon
TCONS_00073523-exon-scaffold_94-1510915933:120809..120926TCONS_00073523-exon-scaffold_94-1510915933:120809..120926Clytia hemisphaericaexon
TCONS_00073523-exon-scaffold_94-1575043694:120809..120926TCONS_00073523-exon-scaffold_94-1575043694:120809..120926Clytia hemisphaericaexon
TCONS_00073523-exon-scaffold_94-1491911889:121562..121682TCONS_00073523-exon-scaffold_94-1491911889:121562..121682Clytia hemisphaericaexon
TCONS_00073523-exon-scaffold_94-1510915933:121562..121682TCONS_00073523-exon-scaffold_94-1510915933:121562..121682Clytia hemisphaericaexon
TCONS_00073523-exon-scaffold_94-1575043694:121562..121682TCONS_00073523-exon-scaffold_94-1575043694:121562..121682Clytia hemisphaericaexon
TCONS_00073523-exon-scaffold_94-1491911889:128316..128377TCONS_00073523-exon-scaffold_94-1491911889:128316..128377Clytia hemisphaericaexon
TCONS_00073523-exon-scaffold_94-1510915933:128316..128377TCONS_00073523-exon-scaffold_94-1510915933:128316..128377Clytia hemisphaericaexon
TCONS_00073523-exon-scaffold_94-1575043694:128316..128377TCONS_00073523-exon-scaffold_94-1575043694:128316..128377Clytia hemisphaericaexon
TCONS_00073523-exon-scaffold_94-1491911889:128690..128768TCONS_00073523-exon-scaffold_94-1491911889:128690..128768Clytia hemisphaericaexon
TCONS_00073523-exon-scaffold_94-1510915933:128690..128768TCONS_00073523-exon-scaffold_94-1510915933:128690..128768Clytia hemisphaericaexon
TCONS_00073523-exon-scaffold_94-1575043694:128690..128768TCONS_00073523-exon-scaffold_94-1575043694:128690..128768Clytia hemisphaericaexon
TCONS_00073523-exon-scaffold_94-1491911889:129670..129747TCONS_00073523-exon-scaffold_94-1491911889:129670..129747Clytia hemisphaericaexon
TCONS_00073523-exon-scaffold_94-1510915933:129670..129747TCONS_00073523-exon-scaffold_94-1510915933:129670..129747Clytia hemisphaericaexon
TCONS_00073523-exon-scaffold_94-1575043694:129670..129747TCONS_00073523-exon-scaffold_94-1575043694:129670..129747Clytia hemisphaericaexon
TCONS_00073523-exon-scaffold_94-1491911889:130773..130863TCONS_00073523-exon-scaffold_94-1491911889:130773..130863Clytia hemisphaericaexon
TCONS_00073523-exon-scaffold_94-1510915933:130773..130863TCONS_00073523-exon-scaffold_94-1510915933:130773..130863Clytia hemisphaericaexon
TCONS_00073523-exon-scaffold_94-1575043694:130773..130863TCONS_00073523-exon-scaffold_94-1575043694:130773..130863Clytia hemisphaericaexon
TCONS_00073523-exon-scaffold_94-1491911889:132415..132487TCONS_00073523-exon-scaffold_94-1491911889:132415..132487Clytia hemisphaericaexon
TCONS_00073523-exon-scaffold_94-1510915933:132415..132487TCONS_00073523-exon-scaffold_94-1510915933:132415..132487Clytia hemisphaericaexon
TCONS_00073523-exon-scaffold_94-1575043694:132415..132487TCONS_00073523-exon-scaffold_94-1575043694:132415..132487Clytia hemisphaericaexon
TCONS_00073523-exon-scaffold_94-1491911889:133040..133547TCONS_00073523-exon-scaffold_94-1491911889:133040..133547Clytia hemisphaericaexon
TCONS_00073523-exon-scaffold_94-1510915933:133040..133547TCONS_00073523-exon-scaffold_94-1510915933:133040..133547Clytia hemisphaericaexon
TCONS_00073523-exon-scaffold_94-1575043694:133040..133547TCONS_00073523-exon-scaffold_94-1575043694:133040..133547Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_94supercontigscaffold_94:95011..133547 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
3.90413e-07 0.00179238 1.26861e-06 0.363998 0.110582 5.29808e-05 2.88106e-05 1.55398e-07 0 1.19883e-05 0.980449 3.00964e-06 0 0 3.30943e-06 9.97349e-09 5.98006e-07 0 0.000431116 3.05468e-08 0.0678029 0.000422915 3.84188e-09 0 0.158942 0.00274631 0.00232115 0.00150488 5.9639e-07 0.000114526
Blast
BLAST of TCONS_00073523 vs. Swiss-Prot (Human)
Match: RUBIC (Run domain Beclin-1-interacting and cysteine-rich domain-containing protein OS=Homo sapiens GN=RUBCN PE=1 SV=4)

HSP 1 Score: 328.176 bits (840), Expect = 6.607e-95
Identity = 161/326 (49.39%), Postives = 221/326 (67.79%), Query Frame = 2
Query: 2006 SAEAVAKSLLHKFQGHKLPAASELKWIVSXXXXXXXXXXXXTAWPISPDSHLTDNPPERHVQSGMGKSMPSLLRGNFEWAPPRLQIIFVPHPFVKRKVMLQRQHYRCAGCGLKVSPDLSKRFRYCEYLGKYFCTSCHQKAESVIPAKILSKWDFKRYFVSDFARDLLKKIHRDPLFNVHDISPNLYDRVRPLNTTKNLRVQLHYMKKFLDSCRYAESCQKEVMKLPMHISDDPHVYSIDDLIQVKNGELHKTLSGVITRGDKHIKEDCQVCQLKGFICEVC-SSDEILYPFELRKVHVCQSCKTCSHRSCYVKGSCKRCERIKARK 2980
            SAEAVA  LL +F+G +LPAASEL+W+V E +APQ+LLP+P + PISPD     +  +  ++          +RGN EWAPPR QIIF  HP   RK+ + +Q+YRCAGCG++  PD  KR RYCEYLGKYFC  CH+ A+  IP+++L KWDF +Y+VS+F++DLL KI  DPLFNV DI+  LY +V+ LN  + LRVQL +MK    +CR A+        +P H+++D H+YS++DL   + GEL   L+ +   G  H+ E C +CQ KGFICE C + D+I++PFEL K   C+ CK C H++C+  GSC RCER++AR+
Sbjct:  625 SAEAVAMGLLKQFEGMQLPAASELEWLVPEHDAPQKLLPIPDSLPISPDDGQHADIYKLRIR----------VRGNLEWAPPRPQIIFNVHPAPTRKIAVAKQNYRCAGCGIRTDPDYIKRLRYCEYLGKYFCQCCHENAQMAIPSRVLRKWDFSKYYVSNFSKDLLIKIWNDPLFNVQDINSALYRKVKLLNQVRLLRVQLCHMKNMFKTCRLAKELLDSFDTVPGHLTEDLHLYSLNDLTATRKGELGPRLAELTRAGATHV-ERCMLCQAKGFICEFCQNEDDIIFPFELHKCRTCEECKACYHKACFKSGSCPRCERLQARR 939          
The following BLAST results are available for this feature:
BLAST of TCONS_00073523 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
RUBIC6.607e-9549.39Run domain Beclin-1-interacting and cysteine-rich ... [more]
back to top