Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00073510 (transcript) - C. hemisphaerica

Overview
NameTCONS_00073510
Unique NameTCONS_00073510
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length814

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00073510 ID=TCONS_00073510|Name=TCONS_00073510|organism=Clytia hemisphaerica|type=transcript|length=814bp
ctctaaacggacgatagcatcgtctacactttttcttgcttgagaaaggt
tgaagattcaccTCTAACCTTTGGTTAAAGATTCACCTCTAACCTTTGGT
TAAAGATTCACCTCTAACCTTCGGCTTTAAACTTAACACTTATAGTCTTT
AAAACATTGAAATGGTTTCTGCATGAAAGTTGGAGTAAGCGCCAACTAAA
ATCATATATACTAATTCGCTTCTAACCTAGCTGGCACACagcgtcgtttc
aacgtttatctaatgttcataacgtccatataacgttagttgaacgttga
aacaatgttgtgtgccagctgggaacttACTTTGATTGTAAACAACGTGA
AGTCCTTCGTTTGTCAAATGTGATGGGAggtaaatgacgtcatcaaagaa
TGTTGGTGTCGTTCCGCCGAAATAAAACGCATTTAAATCAGCTTGGGTAT
GAACACCGACTGAGGCCTCGAATAACTCATTgttgaaaatacaatgaaat
tTTCCATCATGTGAGTTATATGTTAACCCAAACAACATCCATTCTTTGAA
CTGCTTATCTTTGAACTGGTTTAATTGACAAAAAGCGTAATCGGTGTTTG
TATGGAATTCAATGGATATCTTTTTTCCAAACCAAATAGAGAACCCTTGT
TGAGTTGATCGAAAGCCTTGGCTAACTAGAACAGCATATCCAGTTTCAAC
ATCAATATTGCGTGGATAAAGAGCTCTTACCCAGAAAGCAAGAGTGAATC
CGTTTGGACAAGCAGTTGGTAAAGCTGACAAAGAAGTAACGAATGAAGAT
TGCCtattaaaaag
Run BLAST on NCBI

protein sequence of TCONS_00073510-protein

>TCONS_00073510-protein ID=TCONS_00073510-protein|Name=TCONS_00073510-protein|organism=Clytia hemisphaerica|type=polypeptide|length=184bp
LFNRQSSFVTSLSALPTACPNGFTLAFWVRALYPRNIDVETGYAVLVSQG
FRSTQQGFSIWFGKKISIEFHTNTDYAFCQLNQFKDKQFKEWMLFGLTYN
SHDGKFHCIFNNELFEASVGVHTQADLNAFYFGGTTPTFFDDVIYLPSHL
TNEGLHVVYNQSKFPAGTQHCFNVQLTLYGRYEH
Run BLAST on NCBI

transcript from alignment at scaffold_93:194..1007

Legend: exonCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00073510 ID=TCONS_00073510|Name=TCONS_00073510|organism=Clytia hemisphaerica|type=transcript|length=814bp|location=Sequence derived from alignment at scaffold_93:194..1007 (Clytia hemisphaerica)
ctttttaataGGCAATCTTCATTCGTTACTTCTTTGTCAGCTTTACCAAC TGCTTGTCCAAACGGATTCACTCTTGCTTTCTGGGTAAGAGCTCTTTATC CACGCAATATTGATGTTGAAACTGGATATGCTGTTCTAGTTAGCCAAGGC TTTCGATCAACTCAACAAGGGTTCTCTATTTGGTTTGGAAAAAAGATATC CATTGAATTCCATACAAACACCGATTACGCTTTTTGTCAATTAAACCAGT TCAAAGATAAGCAGTTCAAAGAATGGATGTTGTTTGGGTTAACATATAAC TCACATGATGGAAaatttcattgtattttcaacAATGAGTTATTCGAGGC CTCAGTCGGTGTTCATACCCAAGCTGATTTAAATGCGTTTTATTTCGGCG GAACGACACCAACAttctttgatgacgtcatttaccTCCCATCACATTTG ACAAACGAAGGACTTCACGTTGTTTACAATCAAAGTaagttcccagctgg cacacaacattgtttcaacgttcaactaacgttatatggacgttatgaac attagataaacgttgaaacgacgctGTGTGCCAGCTAGGTTAGAAGCGAA TTAGTATATATGATTTTAGTTGGCGCTTACTCCAACTTTCATGCAGAAAC CATTTCAATGTTTTAAAGACTATAAGTGTTAAGTTTAAAGCCGAAGGTTA GAGGTGAATCTTTAACCAAAGGTTAGAGGTGAATCTTTAACCAAAGGTTA GAggtgaatcttcaacctttctcaagcaagaaaaagtgtagacgatgcta tcgtccgtttagag

Coding sequence (CDS) from alignment at scaffold_93:194..1007

>TCONS_00073510 ID=TCONS_00073510|Name=TCONS_00073510|organism=Clytia hemisphaerica|type=CDS|length=555bp|location=Sequence derived from alignment at scaffold_93:194..1007 (Clytia hemisphaerica)
ctttttaataGGCAATCTTCATTCGTTACTTCTTTGTCAGCTTTACCAAC
TGCTTGTCCAAACGGATTCACTCTTGCTTTCTGGGTAAGAGCTCTTTATC
CACGCAATATTGATGTTGAAACTGGATATGCTGTTCTAGTTAGCCAAGGC
TTTCGATCAACTCAACAAGGGTTCTCTATTTGGTTTGGAAAAAAGATATC
CATTGAATTCCATACAAACACCGATTACGCTTTTTGTCAATTAAACCAGT
TCAAAGATAAGCAGTTCAAAGAATGGATGTTGTTTGGGTTAACATATAAC
TCACATGATGGAAaatttcattgtattttcaacAATGAGTTATTCGAGGC
CTCAGTCGGTGTTCATACCCAAGCTGATTTAAATGCGTTTTATTTCGGCG
GAACGACACCAACAttctttgatgacgtcatttaccTCCCATCACATTTG
ACAAACGAAGGACTTCACGTTGTTTACAATCAAAGTaagttcccagctgg
cacacaacattgtttcaacgttcaactaacgttatatggacgttatgaac
attag
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_045624XLOC_045624Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073510-exon-scaffold_93-1491911889:194..1007TCONS_00073510-exon-scaffold_93-1491911889:194..1007Clytia hemisphaericaexon
TCONS_00073510-exon-scaffold_93-1510915933:194..1007TCONS_00073510-exon-scaffold_93-1510915933:194..1007Clytia hemisphaericaexon
TCONS_00073510-exon-scaffold_93-1575043694:194..1007TCONS_00073510-exon-scaffold_93-1575043694:194..1007Clytia hemisphaericaexon
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073510-proteinTCONS_00073510-proteinClytia hemisphaericapolypeptide
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_93supercontigscaffold_93:194..1007 .
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0.389895 0.0571841 0.470146 0.54024 0.404708 0.438471 0.705884 0.963231 0.205419 0.191736 0 0.165988 3.4735 3.58618 1.50842 1.44814 0.969253 1.34249 7.4277 10.414 3.06433 2.83223 1.73786 3.7425 3.31684 4.03463 0.567238 0.209353 0.209722 0.0741001
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR013320ConA-like_dom
Blast
The following BLAST results are available for this feature:
BLAST of TCONS_00073510 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 0
Match NameE-valueIdentityDescription
back to top