Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00073496 (transcript) - C. hemisphaerica

Overview
NameTCONS_00073496
Unique NameTCONS_00073496
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1058

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00073496 ID=TCONS_00073496|Name=TCONS_00073496|organism=Clytia hemisphaerica|type=transcript|length=1058bp
ATTCTTTCTAAGTTGATCGTCTGgcattttaacacaaaataaaaagttaa
aaaatTAGTGAAACTAAAAATATGCCATCAAAAATATGCAAAGGTTGTCA
GTTGAAGATaggatttttcaagaaaaagTTTTCGTGTCAAATATGCCGTG
GTTTCTTCTGCGTCACATGTTCTGGAAGCGTCAAATCAAATGAGGAGCAG
TTACAAGATAAGCTTCTGGTATTGACTGGATTCAATTGTCTTCGATGCAT
CATATTAGAGTTTCGAGAGATAAAAAGAGATCATTTGTATCTCCTACAGA
ATAAACATTTGAATGAATACTTAACCGCTAAAAACATTTCGACAGTATCC
TGTACTGAAAAGTATGATTTGATAGACTTAATTATGGAGTATGCCAAAAC
GCATAACAAACAATCGAGAGAAGATTCAGCAAAAGAATTTCAACATGATC
ACCATTTACAGAACTTAAGACAAGCTGCTGAAGACATGAGAGTACAAGAA
AATGTCAGTAGTCCACAACCATCGAACACTTCTTCCGATGTCAGTGATGG
TACTGGTAATGCAAGACATTCTGGTACAAATTTCTCTTCAACTTCACCTC
ATTCCAGCACGCAAGATGACACTGGAGTCATCAGAGATGAAGCTTCACCA
ACTAGTATTTTTAATGATCACATCACCATTGAAGATTTAGAAGACGATCA
AGACATCCCTGGTGACGAAGCACAGTCACCACAACACGATGAAGAGAATG
CAAACACGACCAATTATTCATCGACCTCCACCACCTTTACAACCTCAcat
catcaacaacaacaacagaatAGACAAACTCAATCACCATCATCAGAAAG
CACTGAAAACTCGACAACGTTTAGCAGGGAGACTTCAGCTTCCTTCACAG
CACGTCAACATCAAACTTCTTCTTCCAGTCCGAGACAAAGTTCAAGTCGT
GACGATAGTCAAGAACAGCCATCATCACCAAGAGAGACCAATACAACCAC
ATCATCCACCACCGACACCACCAGTGGCGAGAATCTAGCTCCACCGCCAT
CCACCANN
Run BLAST on NCBI

protein sequence of TCONS_00073496-protein

>TCONS_00073496-protein ID=TCONS_00073496-protein|Name=TCONS_00073496-protein|organism=Clytia hemisphaerica|type=polypeptide|length=329bp
MPSKICKGCQLKIGFFKKKFSCQICRGFFCVTCSGSVKSNEEQLQDKLLV
LTGFNCLRCIILEFREIKRDHLYLLQNKHLNEYLTAKNISTVSCTEKYDL
IDLIMEYAKTHNKQSREDSAKEFQHDHHLQNLRQAAEDMRVQENVSSPQP
SNTSSDVSDGTGNARHSGTNFSSTSPHSSTQDDTGVIRDEASPTSIFNDH
ITIEDLEDDQDIPGDEAQSPQHDEENANTTNYSSTSTTFTTSHHQQQQQN
RQTQSPSSESTENSTTFSRETSASFTARQHQTSSSSPRQSSSRDDSQEQP
SSPRETNTTTSSTTDTTSGENLAPPPSTX
Run BLAST on NCBI

transcript from alignment at scaffold_93:211384..226130+

Legend: exonfive_prime_UTRCDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00073496 ID=TCONS_00073496|Name=TCONS_00073496|organism=Clytia hemisphaerica|type=transcript|length=14747bp|location=Sequence derived from alignment at scaffold_93:211384..226130+ (Clytia hemisphaerica)
ATTCTTTCTAAGTTGATCGTCTGgcattttaacacaaaataaaaaggtaa gataaattaaataaataaaaatatatgtaaATAAATCACTAAAAGTTAGA AATGCTAGAAATTATACTAGAAATTACTCCTTGTGTTAAGTAAGAGTTAA TTGGAAAAGGCTTCAAGAACGTAAATTGATGCTGACCTGGGAATCAGTGT TAAACGAGCTTGAACTAGGGCCAAGGCAACCTGGGAACGCGAAATGGGAA AGCGAACTAccgatgtctaaacttttcaatatatctccagaaaaaataga ttttttgaaattctgtataAAGGTatagttcctgaatagttttacatgtt ctgtgaaaaaatcataaccatcagtgaaatactcgttcaatctatttaag attgaagacaaaaatttgtgaagaaaaataaaccttgagcacaatttgat cctaaagtgctattttttggatttctagaaagcttacccattcattgtca atatattttttatttgaaagtaattgcttcatggaataaaacagaataaa aagataatagtcaaatcttgtagggtcatttttcaaaataattttgccaa aatcaaTGTTCGCATTttgccattttaccctacgcaaacgcacgtgacaT GCCCAGCAGCCTTCAAGAAACATCTGAATTCCTGTGGTTGGTTAGAAATG CAGGAGACAGGACGCAGGAGACAAGATgcaggtcatacaaactacagacc ggaaaattgtAACACACTTGTAACATATAATTcataaaatgtttctaaaa acaTTATACGCAACTGTACGCAATggaaaattttatattataaaaaatac gctatttaaaagatttttaaatgacaagCCATCAATcctaaatattgaca aaatgacatttaaattatgtaaatgatGATGCTAGCACAAAATACAAGGT GTGTACATCAGtttacaacaaaatgttttttcatgctcaataggatgaCG GTGCAAGTAGATAtagatttataaattttaaaaacattaaatgctccaag agagctgttttagagatatgaaaataatgacctaattttcatcaaaaata caagatagggaataaaaatattgatatattaataaaatacaaaccttTGA CACTATTTTAGTTGatttttgttatcatacccaaggtgcgATGCAagaga tataatgagatatgatatagcgactgtgaaatagctattttcctgtcaGG GGGAAGTTTAACGatgagataaatatttttttgtattttgtgtaTAACAT ATGTAACATGTCAatgacattgaaaagataactgctactatacatgcgtg atttatgtgtaatatataatacaagtattacaggtccgtgttatacatgC AAAAGCACATGGCAAGCATGTGGATAGATTTTGATCTTTAAAAaggttct agatcaataaaataccttcagTATGATATTTTTAACGATTacaagtgttt ttcaaacattttctttttcttttacagtaattaaagctgacctgtcagca ctgacctgcgtcctgtgtcctgcctcCTTCCTGGGTCCTgtgtcctgcgt ttcgaaccaaccggAATTTCTGCCATCTTGAAATTTATGATCttgtatga ttttttattatccaACCACGCTTTTTTATTTAACTGTGAATTCTGTCGGC GAGTAACTTGCCAAAAGCTACACACTCATTATTTGTTAATTAAAGGGTGG GCaatctctaattctccaatcagcgtccggtcatttcgaatgaaaacaaa aaaattaaaaagggggcgctatcagtgaaagttatcgtgacaaacttggt ggagttatcaataacaaatttgttgtcaaagagatttaacagtaagtgaa aatacaggccagatatcaacataGAAAGCtaagaaatctaagctagtttg attcagtcactgggataaatctgatggtaagttgtgactgaataactagc ttagggaAAGTAAACTCAGTAGCTTTAGTCCAGGGTAAGTGTGCATCGAT TGTGCGTTTTTGTCTAGAAAGCACCAAATTTGGTACAGAGGTACCTTAGG TGGCAAGGATCATTTTGAGACTCTGACCCACCTCCAGAACACGTGtctgt gtattttacagaccagaatggccctagggtaaaaaaatttttcacccctt caaaacatgtcatattatatattgttggaaagcatttttgatactgattc taaaaaacatcacaacatatatCCGAAAAAGGACTGGGAACGAGTTTTGC ATCAAGGAAGTAATATACTGACCAGAAAGGCTGCcaagcgaaaaaaaaaa tttccgctTCAAAATATGTCATATTATATATCGATGGAAAGCATTTTCGa tactgattctaaaaaatatcacaacatataTTCGAAAAAGGACTGGGAAC AAGTTTTGCCTCAAAGAAGTAATTTGCAGACCAGAATGTCTGCCCAGtga aaaaacactttttctttcaaaacatgTCGTATTATACATTGTTGAAAATC ATTTCTGTTAATACTATCAAAAAACATATCTGAAAATGGGCTAGGAACGA GTCTTTGCACAAAGAAGTAGTTTACAGACCAAAATTACATCGGCTCAATA GCCAAAATAAACTCAAGAACTCAACAGCGATTAAAAAGATTCACTGAATA TAAAACGAAATAAACTAGTCGATAAAATATATTAACTATATGTGTCAcga aaaaaagttgataaaatatatttgcATGTATGTTATATCAAAAACAAGCA AAAGGTTGTTCAAGTTTTCGATGTCATCAACGATCACCACAGTCTCCACC ACATTTACAAAGTTCTGTACATTTTAGGTTAGCCTTTTTACATTTGCATC TACCTTTGCATCCTTTCTCTTTATTACAACCACATTTTACAAGCTCTTTA CAGATCTTTGAGGCTTCAGGCAAAGTTGTCCATTTAACATCATATTTGTT ACCATTATCATTCCAGCCCCAGTTTTCAGGCTTTGGAAGATCTTGCACTG GCACAATCGATTGACCCCAGCAGTAGCCACCTTGATATACCATGCGTTTG ACCTGTTCGAAAAGAGCATCTTGTGTTGGTGGAATACATTCTAACGACCG ACCTTTGATTGCAAACAGGTGTTTTCTCAAGACATTGACCTCCGTATCTT GACTCGTTCGATCGTAAAGAAGGACGATAAACCTTTCGATTGTTGGAAAG GATGATTCAACAACTTGGATCGATGGTTTTCCAATAAGTGATAGAAGACA CGTTGTCAAATCATCGAACTTTTGCCATGTATTCCAAGCATTCTTTTTAC CTCTACCACTGAAAAACGAGACTTGATCACAGCCCGTAAGAGCATGGAAA AGTGGGAGGCATCTACTTTTGACATCACCAAGACTTTTACAAATTGAGTG GATTGGTATCATGTGGTGATTCTTACCGACACCGAAAGATATCCACAGCT CCCTTATGCCAAGTTGTGAAAACATTCCAACAGCGATTGTAACCACATCG GTATCAACGGTTCGGATACAAATTTTCTTGATTCCTGAATTACTCGCATC TTTAGCGTGAAGAAACATTCTGGTATCGGCTTCTTCGTGGTTGCAAACGG AGAGAAAAGAACAATCGTGGTGGTTGGAAATTGCAGAATCGTCAATACTG CTGATTATCGCTTTCCTTGTGGAAATTTTGATCGATTCGCGAGCCAAAAA TCTGAAAAGCTCCTCTTTGTTTTTGTCCACTCGTAAGAATGATTGCCAAT TTCCAGGGATTCGTGTATCTTCTAACACCTTTCTCCGAGTTCCTTTACCT AAAAAGCGCAAAATTATtaagattttaagaaatttgaaTGCGTAAGAAAG TTTTTAAGAAATTCGAGGTGTAATAAAACAGAGCAATCCATTAATGTTTA CTTGCTAGTTAAAGTAGAAATAAAATATCTCCAAAATGTAAAAGATTGTT ACAAACCTCTCTTTGTTCTGGCGGAAAGTTTTAGTGATTTCTCGATGTAG ACGTCCCAAACAATATCGAGACGATTGACGCTAGTGATTTGATTTTTGAC GAACTGTGTGAATTCTTTGGAGTATTCGTGAAATGTCGAAGCTCTAGTCG GTTTCAAGATGTTAACAATAGCTGCACCATCAAGGATGAGGCAATCAGTA TCAACTTTTTGTGGACCAGTTTCCGTCACCACTTTACGCAAACATGTCGT TAAATCAGCTTTATTTCCAGATCTTAAATTTCCGTTCTTTGATAGCGATG GTGGAAAAGCTGTGTTCTCAtgggcaaaaaactcgtccaaGTTGCTATCT CGGACTTGACACGCAATGTACAACTGGGAAAATAGGTGGCAACTTTTCTT GAGTGTTGTTAATTCATCTTTGTTGCTTATACTTCTCTGCTTTGGTTGGT TGAAAATGGCTAGCTTGTTCTTTGAGATTGTGTCAAATATACTTTTGTCC TTCCCCTTGATATGATCCTTCACGAAAACATCGAACATTTCTTTTCCTAC CATCTCTGCTTTGTTGAGGTTTATGATGGCTACCTCCTCAGCAACATCTT TTGTGTCTAAGGCGATTAGATCTTGTGTTTCTTCAAGGAATGGATTACCA ATATCTTCAAAACAGGATAAGAAGGTTGACACATGCGTCGCAAATCGTTG TTGCATACCTTCGGTTTGCTCATGATGCTTCGTTTCATCTGTGATTTCCT TAACTTTATTGAAAGGTAGGCTATCTTCGAATTCGTTTACGAATCGAGCT AATTCAGGTCCTGCAACCATCCACTTTAGAAGCTGAGAGGGATTTTCAGT CAATCCAACAGCACCTACAAGGCAACcggttttgaaatttatttatgcCT TTTTCTGAAGATATGGCAATGTTGCTGCATGCTTTTAGTAACAATTACAT AATTGCATAAAGGAACAAAAAAAACAGTCAAGCAAATTAATTTACTATGA AATACTACTTTCAGTTTTATCCCCCCAAAAATGGATTCATACCTCCATCT CCTTTGACACATTTGTTGTTTTGCTCATGGGCGTGGTCGATGCCGATAGA GGAGAATTTTCGTTTTGTTTTGGTAATAACAAATCGACCAGCTTCAAAAT ACTCGTTGACTATCGGGTTGGTTTGGGGCAACTCCAACATATCGTATAGA TGAATCGATAGCCAACGAGCATAGTTTGTATGATCCATCGCAAAAAACCA TGGAAGCAGCTTGCTGATTGACTCTTTATAGAGGGCAAAGTCTGCACTCC TGATGGACCGAACAAACTCTAGTAACAGCAATTCCATTTTGAGTGTTGTC GACCAAAACCGGAATTGAGGGAATTCCTTTTCTTGTGACTTTTTCCAATC TTCAAAATTCCGTGGCACTTTAGTTGAGAACCAGTGTTCTTGATATGACT TATTCATCAGGATGTGAAGCACAGCAGCTGTAACTTCGTGACCGTAACGT GTCCGTTTGACGTGCGATGCGTTGAGAAACGATTCTGCTTTCCCTGAAGT AGCGATATCAGCCTCCGAGATGACGTGGCACCATCCAGCTTCCTCCAGCC AGTCACCTGGAGAAAAGAGTTGGAATAAGAGTTTATTGCAAAATAAATTA TCCAAAAACCCTGTTATTAACAGTGTTAAGGAATTTCCTATTTGTCATAG TTTCAGTTTTATTCAAATGTCAATCATAGTCATACCATTTTGGTTTTGTA TTTTCGTCACAATTTAGTTACGTCTAACGTTTTGTCACCTGTTACTGTCA TTGTCATTAACTTGTTTATAGAGTCATGTCACGTCTTTTCTAAGGAAGAA GATACAAGATTTTAAGTTAAGGTGTACAACTTTAGATCGTCATCGCTGAT GAAGGTGATTGAAATTAAAGGAAAGCGAAATGCTGAAAGTTAGACTTACC AATAACATTCATAAACGCCATTTCAATGTGTAAGGGGCCCATCATGGCAA CAAACTTATCTTCACCGTAATCTTCTTTCCAATTCCACTGAACGAGTTTG GCGTTGGCAAAGAGAGGCTGATCAAACGCGATGACAGGAGATTGATCACC ATTCAAATGCTGGACCGCTTGTTTGATGACGTCCATTCCATGTTTCATCA TCGCGATGGATTTCGAGTCATCGGGAAACAGTGGTAAGAGTGCTGAAATA TCTGTAGGTTTTTCGGTGGTTTCTTCAGCTGCGTTGAAAGCTGACCACGA CATATTCTTTGATCTCTCCTCCTCATCAACTGAAAGTTGCTCTTCGACAT GATCCAACCATCTGAGTagagaaaatttatttatcttattcACCAAATAC TAAATATAAATATTACAAGACTTTCCTAACTTCTCTATAGATTGAAAACA CcatattctaattgttagtaAGTTGTTATACGAACGTTAACCTAGTTCCA AAATTGAATTGAAGTACCTTTTCTCTTGATTGTCAGTTTGAATCGTTGAA TCTTCTTGAGCGCTCGTTGTAGCTTCTTCAGAAGTCGTTGAATCTATTTG AACGTTTGAGTAATCTCTTGTTTCAGGGTGTTGGTTGAAATATGAAACGG GTGTCACCTCCGAATAAGATGTTGGTAGTGAGGCTAGCTTATCACCTTTT TCCAAAGAAGTTCTTCTGTTCTCACTGCTATTATGGTCGTCGGTTTTTCG TTGAAACAATGATATCGCTGTTCCATGAAATGAGCCCTTGGATGTTGACG ATGATGGGTCTATATCCAAGTTATCCAATGCTCCAGCAGTGAACTCGCCT TTCTTTAGATTTCTGGGACTCACAACTTTATCTTCTTTGTATTCCTTCAA TACAGTTGCGCAAAGTGAATCTGTCAAGCTCAAAACACGCCTATGTGGAA TCGAGAGTCCCAATTCGTTAAGCTCTTCGATAAGTCCTTTTTTTCTTGTC TTGGCATGGACCATTAATCCAAGGTAGGTAGACATCGGTGATTCTCGGCT TTTGTTAAAGACACATGAAGTTGAGTCTTTTCGTGTACGTTTTATAGAAT TTTGCACGATGAGTTGTGATACAGTAAGCTTATTTTGCTCCAAGTATTCA TTGTTCTTATTAAAGTTCGTACCATGGAGAAGCATGCCGACAAACGATTC AACAAAGTGTGGTATAAATTTTTTCTGAGAGTCATGAGAAAACGAACCTT GAaagggttgatacttgtccGAAAATATCTCTCTCCGCAANATTGTTCTT ATTAAAGTTCATACCATGGAGAAGCATGCCGACAAACGATTCAGCAAAGT GTGGTAGAAATTTTATCTGACAGTCATGAGAAAACGAACCTTGAAAGGGT GGATACTTTTCCGAAAATATCTCTATCCGCAAAATATGTGCAGCTTTTGC TAAAGTATCATCATCTAGGGAAGTTTCAAAGACTGTTTTCAAAACAGATC CAAGCTCATCATCAAACACTAGGTAAACATGCCTTCCTTCTTTTTTAGAT TCAAGGTTTTCAAAATGTgacaaaagtttgtttttgaatcTTGTCGAGTG AGTTCTCCCAGTCACACTTCCACCCAAATCTGATATCCGTTTCTCGTACA GCTTTATCAAATCATCAAGtttaaaaactttgtttttatcgtCTTCAACA CAATCAAACATGTAGTTTGTAAGCTCAACAAAAGCGGTACAAGATATCTG AGTCTCGACATCGATTTCACTATTCTTACTGTTTTCAACTTCCTTTCCTT TATCATAAAATCTTACAAGACACTCAGAGTGATAAAGAGCTTCCCTAGCC ATCATGTCCCGTTCAGTCAATTTGTTTATAATCTCTACTTCATTCAACAG TCTCGCAGTATTCAGCACTCTATAATGCAGTTTGAAGGTGGTTGCTTCAT GAAGCTTCCCGTGTTCTTCTTGACAAAAAAAGCACAATCGTTTTTTTTCC TCCTCTGGTACCTCTGGCTNTCAGCACTCTATAATGCAGTTTGAAGGTGG TTGCTTCATGAAGCTTTCCGTGTTCTTCTTGACAAAAAAAGCACAATCGT TTTTTTTTCCTCCTCTGGTACCTCTGGCCTATTGATTCTGTCACTTCTCC TACGTTCTGATTGGGTGTCAGTTTGTTCTTCTACCTCATACTGACCTTCA GCCTGTGCTTTCTCAATAGATTTTTCAAGTCTTTCAAGCTTTAGATAGTT TATCTTTAATGAGCATGTTCGATGAAATTTGGCTTTCTGTTCAATGAAAA TGCTTGGTTTGTTAAAGTGGTCGTCCGAAAGGTACACTTTTTCAAAAGGT AAGCTTCTAAGTTCAGCAAATCTGTGCAAATTGGTTAAAATGTCATTATA CGCTTTACCAGGATCGTGATTCTTTCTTTCCATTGCTGCTGGacatgaaa gtttttcttttgactgaTCATTTTGACACAATATACACAACTTCCAATCA ATAGTGCCTTCTGGCACTCTCTTAGTCATTTTTCTGTTACATACTATTCA CTTTTACACTAAAAGACAAAATGTATAATATGTGAATTATAATTAATGAC aacattcaaaaatttgaaCACACACAAACGCATATGTATATATTCTACAT CCAAACCACTCActtagaaaaatattcttatttcatATTCTAGCTGAAAA AGGGAAATATAAACGCTAAAGAATTTCTCTATTCATCCCAATTAAATAGC AAATACAAAGACAGATAATAAATACATTTACTAAATTAGAATTTTCGATC AAAAAAGCTTTCCAGCGATATATGATATGACATATTGAAgaggaaatctt tttttttggttctgCAGCCTTTCTGGTCAGTAAATTACTTCTTTGAGGCG AAACTCGTTCCCAGTCCTTTTTCGGatatatgttgtgatgttttttagaa tcagtatCAAAAATACTTTCCATCGATATATAATATGACATATTTTGAag cggaaattttttttttcgcttgGCAGCCTTTCTGGTCAGTAAATTACTTC CTTGATGCAAAACTCGTTCCCAGTCCTTTTTCGGatatatgttgtgatgt tttttagaatcagtatcaaaaatgctttccaacgatatataatatgacat gttttgaaggggtgaaaaatttttttaccctagggccattctggtctgta aaatacacagaCACGTGTTCTGGAGGTGGGTCAGAGTCTCAAAATGATCC TTGCCACCTAAGGTACCTCTGTACCAAATTTGGTGCTTTCTAGACAAAAA CGCACAATCAAGCATTATTTTTGCACACTTACCCTGGACTACTTATTGTG ATTTGAGATATAAGTATcattataccgggtgcgccacaaaaaagtttctc tctttaaaattaattttctcgaaatctaaaagttttaaaagaaccattcc tatttcattggaaagaagaaagataaacttaaattttggtggatcattta ttgaattcgattcattagatcaaaagttgtactcaattgaataaaaaagt tactttcagaaaatgctcaaaaaccttaaaaatcgacctatcaaattaaa cagaaacaTAGTTATATGATATATCAGTATTtccgtttcagtcattaaaa atgataattagctgtctaaatgacattttgttatttaaaggaaggttgaa gttttttaaaataaggttgaatttcaatgaaaggaagaaaattcgtcaaa aaaggCTAaataatctggtaaaattcataaaaatacatcaaatatgggtt ttgaggtagatccagccttacatagactttatccagtctagaaccaaata TCTAAGAAAAATTCCAGTAAAACCAAATTAGATTAATGTTGATGaggatt ttaaaccctttcgaccctttcgtttcaaaatttatgtgttttgttACAGA AAAATGCTCTTAATTATGTAAAGGCTATTGCAATTTCCAAATTTAAAGTA AAAATTTGATAGGTCGATTTTTGACGTTTTCCAGCACTTTCTgaaagtaa cttttttattcaattgagcataacttttgatctaatgaatcgaattaaat aaatgacccatcaaaatctaagtctatctttcttctttccaacgaAATAG Gagtggttcttttaaaaattttagattttgagaaaattagtttcaaagag agaaacttttttgtggcgcacccggtatatgatttttacaaagctcgTCA GAAAAAATAACCTTCCACTATATAAAAGAAAATTACCTAGGACGTAACTA GATTAAAATActgtatacaaaacaatgtaaatTAATACCAAAAAATCTTG GATTCCTTCATAAAACTGTCACTGTAAATAATGTTCCTTGGGTTTGCCAA CATCTCCTGTAGAATCATGCTTtaaaagtctcaaaatttaaCAACATAAA CCAACAGCAAACCACAAACCAATTCCAAACAAAGAGCATGTATTTATATC CATCATAAAATGTCATGACTCGATACACTGAGACTCTAGAATCAAAACAG CATGAGGGTCTTTGCAAGTTACTCGCTCAAATATATTGCAGATATTATAT TCAATGTTCAATTAAAAATCTTTCCTTTATATTAACTACAACTCTGGACA AAAAATATATAAGCAACTTTCGATTTATTCTTTacgaatagcattctttt tcTTCAACAGTTCAATTCATCCACGAAAACAAGTGAAGCTCTCaagtctt gaaaacttttttatttacttcAATGTTGTCATCTCTCGttgtaaaagatt ttcagaATATAATCGAaggaaaatatttccatatttttctttctactgTA TGAGTGCCATCTCCTTTTAGCTGTTTTCTGATGAAATAATTACAGATAAT AGATATCCATCGCTTAcgaaaattttcgtttttttaccaTGTGACTCGTT CTGACCAATCAGAGGCCTACCGAAAGCTGCGTTCAGATTTTGAACGCGTG CTTTCCCTAAGCCAGTATTTCAAGGCAAATTTAAAATCCgttaatataaa aaaatctttaaagcgccgaaaacgctatattgtcATTAGctgtgtgtcct agccttgtgaataagGGCTTAGTTAGCTAGGCTAATATTAACAGTctcat gttttgaccaatcgtcccaattTAGAGCAGTTAACGGTATGAGATTCTAA AATAATAGAGTAGAGcaagctgcaagcggagctgcttagttcatttgttt tgaaattttgaatatgCGTGTTCCAAAAGGCAAAATAATGGAAATGCATC AATCCGTTCAGCTgcccaaaatgacaaaatggcctgtcaagactttttaa tatcTTTTGGTAAAGCAATCAATGTCAAAAGTATCTTGACAAGGAATAGA TAAGCTTTTCATATAGCCAAACAGAATtaccatagcttttaccaaaagaa aaaacatttgactGCTTGGTTATTTCTATTCTAAGATCATTCTTATATAG AAATATGTGTTGATGCAGTCAGCACTTCCTTGgtctttttttattagttt tgatagAGTTAAAAGTTCCTAATCGACACAACTAGGCATTTCACTCTCTT ACTTCACAGTGTTGAATTGATGTTGACATAATTATGCCTTAATCAATACC ATGCATATTTTTTGTATGggtatttttaaaataaaaaagatgagaaaaca taaatttatttACTGCAAGTACGACTTAGATAACCACACCtttcttattc attatctacgAATTGAAGCAGGCCAAGGCAAACATGCGGGttcattttaa aaaaagatgaaacttaattttcaattattttgaaaaatcaattttatcga ATTTCTAAATTATATACCTTAAGGCCATAATAATTTGCATATTTTTACCT TTAAATAAGTCTTTATCTCATAccttaatttattattttatgttTCCTAG AGGTGGGGTTCCTAGAAATGTAGCTGGGCTCTGTTttcttcagccccccc cccccccccctaaaaaaggggggggggggggccctccccccccccccccc cctaaaaaaggggggggggggggccctccccccccccccccccgcctgAA AATAGCTGGGGGTAGTGGACCCATCTGCACATCTGCACTCAATGAAATTC TGCAAACCCCCTCTTTGCATAGAAAAGAAAAAGCTTccataaaatattga aattgaaaatatctATGTTTGTAAACTCTTTTTGTATTTGTAAGAACTTT TTCCGACACTATGTTGCCAATAGACTTTTTGACCTTTTGCAACTCAGGAT ACTGTATACTTTTTGGTCTGGTGTGCAGACGCTTTGTTTAATAATAGTTA AAGATGGAAAATAAACCCATGGTATTTTGATCTACCAAGGTATATAATGT TTGGATGCATTCAAGCTTTAGCCAAGAGTATAATTTCCTCTGTTAACAGT GTTtgaatcattttctttttttcagttaaaaaatTAGTGAAACTAAAAAT ATGCCATCAAAAATATGCAAAGGTTGTCAGTTGAAGATaggatttttcaa gaaaaaggtAAGTTACATACAGTCACCCATCTTTTCTTTAAGGCATAAGG GGGTCCAAAAGGCTAATAGGGGATGGTTGGACTTTTTATAAGGGGGCCTG ATCTTTTAGTAGGGCTCCAATAAAGGTCAGGGTTAACAATAATTTGGGTA TTATTTCTCATTGGTTGAATATTTAAAATTTGTGAATGGCAAAACTTTTG CCTGTGCTTCTATTTACACTCAGCTACTGTGGAAATTAGAAGTTTAGCTT TATATATTATTATTTAAAAGGATTGTAAACTACCACCACAGTAAATTGTG CAAGTTCgtgagattttgaaaataggaTAGGAATAGGAATGGGAGACGAA ACCCCTCTGCAGTTAGATATTAATTTGTTTGGTTAGTATATTAACGAATT TAGCAATACAAGGTTTCTTAACAAATTGAAAAGTTGTCATTGAGGTAAAT CAAACATTACATGATCTAGATACTTTGTAATGCAAGGTTCATAAAGAAAT TGGGAAAGGGAGTGTTTATAGACTAAGAATTCAAAACATGAATGAACTTA TTGTCTTCTTTTCCTCTTGTACTTAAATCTGTACATTATAAACtcttact ttttgattttaagtttgaaaactaaaaacctaGAAATGCATGCCAAATTC AATCCatgaaatatgatttttttaccAACGTGTCAAATAATTGACTTCTT TCATTTCTAGTTTTCGTGTCAAATATGCCGTGGTTTCTTCTGCGTCACAT GTTCTGGAAGCGTCAAATCAAATGAGGAGCAGTTACAAGATAAGCTTCTG GTATTGACTGGATTCAATTGTCTTCGATGCATCATATTAGAGTTTCGAGA GATAAAAAGAGATCATTTGTATCTCCTACAGAATAAACATTTGAATGAAT ACTTAACCGCTAAAAACATTTCGACAGTATCCTGTACTGAAAAGTATGAT TTGATAGACTTAATTATGGAGTATGCCAAAACGCATAACAAACAATCGAG AGAAGATTCAGCAAAAGAATTTCAACATGATCACCATTTACAGAACTTAA GACAAGCTGCTGAAGACATGAGAGTACAAGAAAATGTCAGTAGTCCACAA CCATCGAACACTTCTTCCGATGTCAGTGATGGTACTGGTAATGCAAGACA TTCTGGTACAAATTTCTCTTCAACTTCACCTCATTCCAGCACGCAAGATG ACACTGGAGTCATCAGAGATGAAGCTTCACCAACTAGTATTTTTAATGAT CACATCACCATTGAAGATTTAGAAGACGATCAAGACATCCCTGGTGACGA AGCACAGTCACCACAACACGATGAAGAGAATGCAAACACGACCAATTATT CATCGACCTCCACCACCTTTACAACCTCAcatcatcaacaacaacaacag aatAGACAAACTCAATCACCATCATCAGAAAGCACTGAAAACTCGACAAC GTTTAGCAGGGAGACTTCAGCTTCCTTCACAGCACGTCAACATCAAACTT CTTCTTCCAGTCCGAGACAAAGTTCAAGTCGTGACGATAGTCAAGAACAG GTTTGTCATTTAAAACATCAATTAACTTTTCAAAGGTGGCTCACTTTTTG GGAAAACATTTTATCAAAAGAGATTCGAGATTTCCCgaatatttcagaaa aattttttgtctCTTTGAAATTCTCTTTAAATTGATTTCTTATCGTAAAA CTCACAAATAGCTCCTAAATTTACGAAACTAAATGATCGTGAAAATTAGG GATTTAAACTTGAGGAGGTAAAGTAAAAGTAATATGTGTCATCTCATATT TGTTAAAGAAATTTGCATTTGCTAGCTAAAGGGCAATGTAAATTGCATAA TTTTTACATGCGGTGCCCTCTTTCACTCGACACTCATTGCGTATTCGAAC GAATGGTAATGGTAATCGTAAGTTTTGAAGGAGGGGTTTACATGACATCG ATTAAGTATAAATGAGGGGGGTATGACCAGAAAGACAATCTGACATAATT AACAACACATGAAACCTATTCTAACATTCCTATAATACTTTTCCAAGTAT TAGCAAAAAAAGTGATAACGATCTACCAGGGTATTGAGCATTCTTTTGGA TTTAAAGTCAGTCATACAACATGAAACCTTTTCAATGCTTGTTTTTTTCC CTATCAGCCATCATCACCAAGAGAGACCAATACAACCACATCATCCACCA CCGACACCACCAGTGGCGAGAATCTAGCTCCACCGCCATCCACCANN

Coding sequence (CDS) from alignment at scaffold_93:211384..226130+

>TCONS_00073496 ID=TCONS_00073496|Name=TCONS_00073496|organism=Clytia hemisphaerica|type=CDS|length=2961bp|location=Sequence derived from alignment at scaffold_93:211384..226130+ (Clytia hemisphaerica)
ATGCCATCAAAAATATGCAAAGGTTGTCAGTTGAAGATaggatttttcaa
gaaaaagTTTTCGTGTCAAATATGCCGTGGTTTCTTCTGCGTCACATGTT
CTGGAAGCGTCAAATCAAATGAGGAGCAGTTACAAGATAAGCTTCTGGTA
TTGACTGGATTCAATTGTCTTCGATGCATCATATTAGAGTTTCGAGAGAT
AAAAAGAGATCATTTGTATCTCCTACAGAATAAACATTTGAATGAATACT
TAACCGCTAAAAACATTTCGACAGTATCCTGTACTGAAAAGTATGATTTG
ATAGACTTAATTATGGAGTATGCCAAAACGCATAACAAACAATCGAGAGA
AGATTCAGCAAAAGAATTTCAACATGATCACCATTTACAGAACTTAAGAC
AAGCTGCTGAAGACATGAGAGTACAAGAAAATGTCAGTAGTCCACAACCA
TCGAACACTTCTTCCGATGTCAGTGATGGTACTGGTAATGCAAGACATTC
TGGTACAAATTTCTCTTCAACTTCACCTCATTCCAGCACGCAAGATGACA
CTGGAGTCATCAGAGATGAAGCTTCACCAACTAGTATTTTTAATGATCAC
ATCACCATTGAAGATTTAGAAGACGATCAAGACATCCCTGGTGACGAAGC
ACAGTCACCACAACACGATGAAGAGAATGCAAACACGACCAATTATTCAT
CGACCTCCACCACCTTTACAACCTCAcatcatcaacaacaacaacagaat
AGACAAACTCAATCACCATCATCAGAAAGCACTGAAAACTCGACAACGTT
TAGCAGGGAGACTTCAGCTTCCTTCACAGCACGTCAACATCAAACTTCTT
CTTCCAGTCCGAGACAAAGTTCAAGTCGTGACGATAGTCAAGAACAGCCA
TCATCACCAAGAGAGACCAATACAACCACATCATCCACCACCGACACCAC
CAGTGGCGAGAATCTAGCTCCACCGCCATCCACCANNATGCCATCAAAAA
TATGCAAAGGTTGTCAGTTGAAGATaggatttttcaagaaaaagTTTTCG
TGTCAAATATGCCGTGGTTTCTTCTGCGTCACATGTTCTGGAAGCGTCAA
ATCAAATGAGGAGCAGTTACAAGATAAGCTTCTGGTATTGACTGGATTCA
ATTGTCTTCGATGCATCATATTAGAGTTTCGAGAGATAAAAAGAGATCAT
TTGTATCTCCTACAGAATAAACATTTGAATGAATACTTAACCGCTAAAAA
CATTTCGACAGTATCCTGTACTGAAAAGTATGATTTGATAGACTTAATTA
TGGAGTATGCCAAAACGCATAACAAACAATCGAGAGAAGATTCAGCAAAA
GAATTTCAACATGATCACCATTTACAGAACTTAAGACAAGCTGCTGAAGA
CATGAGAGTACAAGAAAATGTCAGTAGTCCACAACCATCGAACACTTCTT
CCGATGTCAGTGATGGTACTGGTAATGCAAGACATTCTGGTACAAATTTC
TCTTCAACTTCACCTCATTCCAGCACGCAAGATGACACTGGAGTCATCAG
AGATGAAGCTTCACCAACTAGTATTTTTAATGATCACATCACCATTGAAG
ATTTAGAAGACGATCAAGACATCCCTGGTGACGAAGCACAGTCACCACAA
CACGATGAAGAGAATGCAAACACGACCAATTATTCATCGACCTCCACCAC
CTTTACAACCTCAcatcatcaacaacaacaacagaatAGACAAACTCAAT
CACCATCATCAGAAAGCACTGAAAACTCGACAACGTTTAGCAGGGAGACT
TCAGCTTCCTTCACAGCACGTCAACATCAAACTTCTTCTTCCAGTCCGAG
ACAAAGTTCAAGTCGTGACGATAGTCAAGAACAGCCATCATCACCAAGAG
AGACCAATACAACCACATCATCCACCACCGACACCACCAGTGGCGAGAAT
CTAGCTCCACCGCCATCCACCANNATGCCATCAAAAATATGCAAAGGTTG
TCAGTTGAAGATaggatttttcaagaaaaagTTTTCGTGTCAAATATGCC
GTGGTTTCTTCTGCGTCACATGTTCTGGAAGCGTCAAATCAAATGAGGAG
CAGTTACAAGATAAGCTTCTGGTATTGACTGGATTCAATTGTCTTCGATG
CATCATATTAGAGTTTCGAGAGATAAAAAGAGATCATTTGTATCTCCTAC
AGAATAAACATTTGAATGAATACTTAACCGCTAAAAACATTTCGACAGTA
TCCTGTACTGAAAAGTATGATTTGATAGACTTAATTATGGAGTATGCCAA
AACGCATAACAAACAATCGAGAGAAGATTCAGCAAAAGAATTTCAACATG
ATCACCATTTACAGAACTTAAGACAAGCTGCTGAAGACATGAGAGTACAA
GAAAATGTCAGTAGTCCACAACCATCGAACACTTCTTCCGATGTCAGTGA
TGGTACTGGTAATGCAAGACATTCTGGTACAAATTTCTCTTCAACTTCAC
CTCATTCCAGCACGCAAGATGACACTGGAGTCATCAGAGATGAAGCTTCA
CCAACTAGTATTTTTAATGATCACATCACCATTGAAGATTTAGAAGACGA
TCAAGACATCCCTGGTGACGAAGCACAGTCACCACAACACGATGAAGAGA
ATGCAAACACGACCAATTATTCATCGACCTCCACCACCTTTACAACCTCA
catcatcaacaacaacaacagaatAGACAAACTCAATCACCATCATCAGA
AAGCACTGAAAACTCGACAACGTTTAGCAGGGAGACTTCAGCTTCCTTCA
CAGCACGTCAACATCAAACTTCTTCTTCCAGTCCGAGACAAAGTTCAAGT
CGTGACGATAGTCAAGAACAGCCATCATCACCAAGAGAGACCAATACAAC
CACATCATCCACCACCGACACCACCAGTGGCGAGAATCTAGCTCCACCGC
CATCCACCANN
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_045618XLOC_045618Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073496-exon-scaffold_93-1491911889:211384..211429TCONS_00073496-exon-scaffold_93-1491911889:211384..211429Clytia hemisphaericaexon
TCONS_00073496-exon-scaffold_93-1510915933:211384..211429TCONS_00073496-exon-scaffold_93-1510915933:211384..211429Clytia hemisphaericaexon
TCONS_00073496-exon-scaffold_93-1575043694:211384..211429TCONS_00073496-exon-scaffold_93-1575043694:211384..211429Clytia hemisphaericaexon
TCONS_00073496-exon-scaffold_93-1491911889:223809..223890TCONS_00073496-exon-scaffold_93-1491911889:223809..223890Clytia hemisphaericaexon
TCONS_00073496-exon-scaffold_93-1510915933:223809..223890TCONS_00073496-exon-scaffold_93-1510915933:223809..223890Clytia hemisphaericaexon
TCONS_00073496-exon-scaffold_93-1575043694:223809..223890TCONS_00073496-exon-scaffold_93-1575043694:223809..223890Clytia hemisphaericaexon
TCONS_00073496-exon-scaffold_93-1491911889:224594..225433TCONS_00073496-exon-scaffold_93-1491911889:224594..225433Clytia hemisphaericaexon
TCONS_00073496-exon-scaffold_93-1510915933:224594..225433TCONS_00073496-exon-scaffold_93-1510915933:224594..225433Clytia hemisphaericaexon
TCONS_00073496-exon-scaffold_93-1575043694:224594..225433TCONS_00073496-exon-scaffold_93-1575043694:224594..225433Clytia hemisphaericaexon
TCONS_00073496-exon-scaffold_93-1491911889:226041..226130TCONS_00073496-exon-scaffold_93-1491911889:226041..226130Clytia hemisphaericaexon
TCONS_00073496-exon-scaffold_93-1510915933:226041..226130TCONS_00073496-exon-scaffold_93-1510915933:226041..226130Clytia hemisphaericaexon
TCONS_00073496-exon-scaffold_93-1575043694:226041..226130TCONS_00073496-exon-scaffold_93-1575043694:226041..226130Clytia hemisphaericaexon
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073496-proteinTCONS_00073496-proteinClytia hemisphaericapolypeptide
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_93supercontigscaffold_93:211384..226130 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
8.44111 8.06842 5.0153 4.58266 19.6109 15.096 17.8366 21.376 12.6769 14.8737 15.8762 11.1878 10.2273 11.92 10.5591 9.3963 7.87383 9.26009 8.48446 10.6447 11.1511 11.5286 9.10346 10.4979 14.4916 16.1367 8.19379 6.84894 10.3894 10.8686
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR013083Znf_RING/FYVE/PHD
IPR003034SAP_dom
IPR011011Znf_FYVE_PHD
Blast
The following BLAST results are available for this feature:
BLAST of TCONS_00073496 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 0
Match NameE-valueIdentityDescription
back to top