Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00073491 (transcript) - C. hemisphaerica

Overview
NameTCONS_00073491
Unique NameTCONS_00073491
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length2461

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00073491 ID=TCONS_00073491|Name=TCONS_00073491|organism=Clytia hemisphaerica|type=transcript|length=2461bp
GTTTTTGTCGTTTTAATGTCCCGTTTTTCCCGAAAGTAATTCCGAAATAA
ATACCGCGAGAACGTTCTGCATCTGCATGTGAAGAAACAAAATGGCGCTC
GTCTGTTCAATAAGCGGTGAAGTACCAGAGAACCCTGTTGTATCACCTGT
ATCAAACCAAGTCTTTGAACGACGActaattgaaaaatttatttctgaGA
ATGGAACTGATCCTGTGACAGGAGATACTCTTTCTGAATCTGAATTGATT
GAAATTAAAACTACTGCCCTCACCAAACCGCGACCACCATCAGCGACAAG
TATTCCTgctattttaaaatctttgcaAGATGAGTGGGATGCAGTCATGT
TGCATAGTTTCACACTGAGACAGCAATTGCAAGCTGCAAGACAAGAATTA
TCACATGCACTTTACCAACATGATGCAGCGTGTCGTGTGATTGCCAGATT
GACCAAAGAAGCCACTGCAGCTCGTGAAGCTTTGGCTACACTCAAACCTC
AAGCCGGCGTCTCTCAACTTACATCAGCAACAACGAATGTTTCTAGTGGT
AATAAGGTTGATGACATGGACATTGTGGAACCTGCGGAAATCGGAATGTC
TGAAGAAGTCCTTCAAAAACTCCAAGATAAGGCAACCGTCTTGACAAGTG
AAAGGAAGAAGAGAGGTAAAAAACCACCAGAGGATCTGACACCCATCGAA
GACATCAAATCATTCAAACAAGTTGCCTCTCATCCCGGTCTCCATAGTGC
CAGTGTTCCTGGAATATTGGCTCTTGACCTTCAAGACAGTGATCCATCAA
AATGCATTACAGGTGGTGTTGACAAAAACGCTGTTGTTTTCAACAAAGAT
AATGAACAGGTTGTGGCAACACTCCGCGGACATACCAAGAAAGTTACATC
AGTCATTTACCATCCATATGAAgaaATCGGTATTACTGCTTCAGCTGACA
ACACAGTTCGTGTCTGGAGCATACCTAACAGCTCTTGTGCCTACACCATC
CGAGCTCACGATGCGGCTGTTACTGGTTTGAGTTTACACGCTACAGGTGA
CTACGTTCTGACATCCTCCATTGACCAGCACTGGGCTTTCTCCGACATCC
AAACTGGCAAAGTTTTGATCAAGAGCATTTCAGACCCAAATGCCAGTCAT
GGTTTGACATGCGCACAATTCCATCCTGACGGTTTGATCTTTGGTACTGG
AACTACCGACAGCTCTATCAAGATTTGGGATTTGAAAGAACGAAAATATG
TTGCCAGTTTCCCGGGACACTCAGGACCGATTACAGCTAttgacttttct
gaaaatggATACTACTTGGCCACAAGCGCTGATGATTCAGTGGTCAAACT
TTGGGATTTACGAAAATTGAAGAACTTCAAAACAATTCCTTTAGATGAGA
ATGACGAGATCAAATCATTGAGCTTCGACAAAAGTGGAAATTATTTGGCT
GTTGCTGGCTCAAACATCCAaatTTACGTTGTCAAACAATGGGACCTTCT
GAGACAAATTAATGATCACACCGGGTTGGTCACTTCAGTCAAGTTTggaa
aaaatgctgatttcttGGCATCTGCCAGTATGGACCGAACCTTGAAATAC
TTTTCACGGTAGAGTGTTGCTTGGGAAATATAAACGTGAAATGTACCTAT
CATTGCACTGTGAGAATGTGCTAGAAAAGACAGATTTTGTGCATCAGATA
AATTGTACTGGACATCAACATCAACTCGCATAGCTTATAAAATAGCGAAA
TATTTCATAAGATTTTAAACGTATCATTTCATTTAACTGAATAACGATCT
TTtgtaaatttattatttttaggaGACAAAGCTAAGAGGAGTTTGTTGAC
CTGTAGCTTGTCCTCCAACATTCCATCATCGGTTGCTGATAGTGTGGTCT
GATACAAAAGTAAAACCATGATTCGCTACTCTATACTCGCTAGCAACACT
GAGCTTTACATAAACCCTAATGGCAGTTTCCCAATCCTGGACAACtaaaa
tctttgattggagtttttttgaaagtgttacCCTGATGGTAGCACTGCTT
AATGGCGATGTAAATGCACCGATACTAGTTGTACTTTTCAGTGAATACTT
GAGATGAGCTTCTTTGCGgtaccactttaaaaaaaactccgatcaaagat
ggtgcATTATAGCTTTGTCCAGATAAGCATCCAAAAGAGAACTGTTTGTT
GTAAAGTTTTGCAGCAAAGCTGATTAAAGCCAAagcttttgatttttact
atcAATTTTGTAAGGAAATTTTCCTTTTAGTATTTTTACGatgaatgtca
tttttaatatGATTAGTTTCATGGTGTAATAAACGGATAATAACTGTCCA
TtttaatttcttcaaaatctCATCTTTCTTGTCAGGGAAAATGTTTCAGC
GTAAATGTTTATGATATATGTTTTCTTAAATAATGAGGTTCCCGATTTTC
GTGACTTCCTG
Run BLAST on NCBI

protein sequence of TCONS_00073491-protein

>TCONS_00073491-protein ID=TCONS_00073491-protein|Name=TCONS_00073491-protein|organism=Clytia hemisphaerica|type=polypeptide|length=506bp
MALVCSISGEVPENPVVSPVSNQVFERRLIEKFISENGTDPVTGDTLSES
ELIEIKTTALTKPRPPSATSIPAILKSLQDEWDAVMLHSFTLRQQLQAAR
QELSHALYQHDAACRVIARLTKEATAAREALATLKPQAGVSQLTSATTNV
SSGNKVDDMDIVEPAEIGMSEEVLQKLQDKATVLTSERKKRGKKPPEDLT
PIEDIKSFKQVASHPGLHSASVPGILALDLQDSDPSKCITGGVDKNAVVF
NKDNEQVVATLRGHTKKVTSVIYHPYEEIGITASADNTVRVWSIPNSSCA
YTIRAHDAAVTGLSLHATGDYVLTSSIDQHWAFSDIQTGKVLIKSISDPN
ASHGLTCAQFHPDGLIFGTGTTDSSIKIWDLKERKYVASFPGHSGPITAI
DFSENGYYLATSADDSVVKLWDLRKLKNFKTIPLDENDEIKSLSFDKSGN
YLAVAGSNIQIYVVKQWDLLRQINDHTGLVTSVKFGKNADFLASASMDRT
LKYFSR
Run BLAST on NCBI

transcript from alignment at scaffold_93:125485..145827+

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00073491 ID=TCONS_00073491|Name=TCONS_00073491|organism=Clytia hemisphaerica|type=transcript|length=20343bp|location=Sequence derived from alignment at scaffold_93:125485..145827+ (Clytia hemisphaerica)
GTTTTTGTCGTTTTAATGTCCCGTTTTTCCCGAAAGTAATTCCGAAATAA ATACCGCGAGAACGTTCTGCATCTGCATGTGAAGAAACAAAATGGCGCTC GTCTGTTCAAGTAAGTTCTTTTATTTTCTAAtatcttttgtattttttgt catGTGTTCTTTTAATCACTCGATATGTAGAGATAATTCGAATCAGCCAT GCGTTATTTATAAGGTTTTGGATGAAAATCAGTTTTCAATCAAGGAATTG CTATCTAAAAGTGAGATTATCTCATGCACATGTTTCTCCAGCAGACTCTC CCAATCGATACAATCATTAATACCAGACAGTACTCATCAataaattcgat tatcgaaATAATCGATAATGATCAAAATAATCGAACAACCACAATTATCG ATTAACAATCAAATTTTGAGTACCAAAACTTAATAAAACTTGTGAACGGG TGCATgtacgaccctgcctatgccccggacagtccggggcaaatgtctgg ggtctgaaaaaaataactttctccaatttttgcgccataaatttaccccg gacgtatatcgCCGAGCACAATTTAAACCCCCGGNgattctataaaaagc gaccgcgcgggctgtctggggcgtccggggtagtctctcaaaaacaaata atacggaccccgggcacgcatcaaaaaaacccctgactgtccggggcata ggcagggtcgtgtGCATGTCAGTctgacactttctagtccgacagtatac tagtccgaatctataaaatgaatttagaatttagaagtctttttttccga cgtcacttttgtccgaaaacgaaagattttagtgTAGAAtgttgaataga ccttttcgcctttccatccgccatcttgaattgtatgcaaaaatagagga acgaaaaagctgtggttggatttagttggaaagtatgcaaaaNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNgcagtaattatgacgtc acacattatcaatgttttgatttgatcatttggcggctctattcccagga gaataatttactgtcagccgaataaggattattttttaccttcgctgatg atttttcagtttgaatttatgtctaattttattgatttttgaagtgcttg ttctaagagatgagcgaatataattatttttagttttcaagagaagcaaa tttaatctttcttctacaagattacacNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNtttgcatactttctaaggg aatttcaccacggcaattcggccaccataatttttgcatacaattcaata tggcggatggaaaggcgaaaaggtctataaggCAAGGGTTTTTCACCAAG ATAATACAGTattccagacgtccgcgctcaataggatcgatggattactt aacaatccggataggagatcgatagaggatcgatactcaagatttcttta agcttatgattagttatcgattatttatNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNAAAATTAATTTCGATGGCTACAGGCCTTTGCAACTGAGAAAGGT cagtgtcacggaaggacaccgtcacggaaggaaaaaattcctatttttca aaatcaacaataGCGTATGAAATGTTGACTGAAACTAGTGGAGTGACACA TCATATCATGAATCATACCCATTTTTACTATTCAGTTCATTTCAAAACCT TGGAACTGTCTTTTTATTGTTCAACCATAGGTGATGATAATTAGGAAATT TTACAGGAAAGATtatatttttaagcaaaaaacgtaagcgagtaagctac ttccaaaggctctaacNggatcaacgaaggatcgatactcaagacttttt aatggctgaatcttccatcgatctcctatccggatcgttaagtaatccat cgatcacatttCGATCCGTCATCAAGCCGTTCCAATGATNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTGAAGCGA tctagagtgtttagaaccggctgggaacagtagttttgccggaaaaccgg tttttaggcctccagagccgcctgggcttaagctgtaagcttacagcttt gTACTGgacccttagttaagcttattctgagctccatacagggctgagct ggttcctaatggtcataaacctcgtaggacactcctctgcaatggattag acccattgaagtccagcgaagtgggcagaaccgacgaatcttcactaaaa tagcttaacaacgcttaaaaagctctatttcagcgtttttgaggcttttt taagcaaaaaacgtaaaaacgtgaccttgcaatcaagtgagctacttcca aaggctctaattagcatatttccatggtgttgaagcgattttgagggttt agaactggctgggaacagtagttttgccagaaaaccggtttttaggcctc cagagttgctgtaagcttacagcgctgtactggagccttagttaagctta ttctgagctccatacagggctgagctggttcccaatggttctaaacctcg taggacactctccggaaatggattagacccattgaagtccaagatttcta aaaataacaagataTTTTGAATCCGTCAGGGAAGGACAAGGTGAaagtgt cacggaaggacaataATTTCAGACCTTGTAAGTGAATGTGAAGGAGGTTG CTTTGGAatccaatttcattttttgttaggGGGTACCAATAGTTAGAACT TGCAATAATATCAAGAATAGTGTACTTGCACAAAActggtgaaaaaactt tttgtcttgaAATTGTCACGGGAGGAATTcgatatataaaaaaagtttct gcttgcagtccttttttgttgtttgacttatttcaaaatgaataaacCTA TTAAACTAACTAGGGTATGTACTTGTTTTAAAAcacatttcatttttgat taatcattttatttttcaaaagaaggtccattatattttaacacttgtcc ttccgtgacaaaCCTCACTAGTTGTGTTTCGATATAATCACCTGGTTACA GAGTCTAAAAGTGCGACTCGGTTtatttaaaagttgaaattggaaaattt aagggttatatttaaaaaaaatcacagttacttattttgtttgtaagatt tttgattttgtgttttggttgacCACTTTTCAATTTAGCcctgatcgatc ctatcgagcgcggacgtctggagtattaataaaagttcattttgggagtg ctcaatgaaatcagagccaagtaaaataaagataatttatagcaaaaaga atgcactgcctttaagggtccctttttgtATGTTCAGAATTATGCCATAA GGGTTGTAAATCACGCACACTTTGATTCCAGCCCCCTCCCAAAaggcgat gggaatttgatgttctgtttaccgtcgcgttgcaaaaaatatttgatacg gcaaaatttcattattcattattcattattcctacCTGGTGCTTCCCATC TCCAACGAAGTTGAATTCCACCGTGAAATCGAGCTGCTTTCACTTTCAGA ATCAAAATGACATGCACGAGAATTCAAACGCGTTCGAGACGAGTCTAAAA CGCAAATTTCTAAAACGCCCTTGTAGCCGCCCACTGCTTAAAAAAATGCC TGTCCCATTCGCGGACGTGATTGGAACCATGTCTTTTACTCGAGGCGCAC ATTTTGTTAGCaaagatgttatttttgattcactttgagtgttttggata gcttggcacaggaaaagaagaaaataatttttaagtttttaagaaataat gaacttttttgagcggtGGCTCTAGAGCATGTGGGCGGtcgacggtaaac agaacatcaaattccaaTCGCcaaagaagggtcgtaaaaacagctaaatc caatttcttgactcttgaaagcctaattctaataagcttcccaaaattta agaaaagtcgggtttaggggCCCAACTTCTTTGGAGcacgtggttgctta taaaagatgtgcctcttcttcggcgattcatatttcgttttatatgtttt tttgacTCATTGTCGATTGTCAGAATACTGACGCATTTGTCAAATCCAAC GTCAGGCATTTTTACTGtaggactagaaagtgtcggactactgacgacct tcCCTTCACAcaggtttttcttttgatcCTAAGAGACCAGGCAGTTGTCT TTCAGGAACAGAAGAGTTGGAGGCCAGATAATGTTgggatttttatgaaa attgggctaaagttggtacttttttgagacctaaTTGGCTTTTCAGGCCT CTAGGTGGCAGTAGGGCcagaattttttattgcaatcacttcTAATGAAT AGAGCAGGGACTGAAGTAtcagaaattattattttgagcaggaacaAACT CCCTTGGGacaggtcagatggctctaaaatacccctaaaatcaaatttgt agtgtttttgtgacTGATGTCATAactccagctaccattttgaaaattat gatttttttttgaaaattgtatagtttaccggccatagtttcagaatcgC CAAAAACCAActcatcattttgatttgagaaagcatggttctatataaaa aaactttttaagtgcaatgcccaaaaatgtcaaaaacttccAATTGGAAT TAAATCCGCCATTAGCTAACCTGATagcagctgttcataattttcttgcG CGCACACAAGCCTGGCCATGAACGAAACCTTGCGTGTGACAAAGTAGCAC TCCATAAAAAATATGTCACAGATTATGGTGTGCTATTAGCATTCACAAAG GGAATTTTGTACATTCTTGAATATTTTAGGAGTGCTATTTTGGCACTCGC AAATCACTTTAGGCGTGTGCCAGCGTGTGCGAGTGCAATAGCACGCCATA CACAGCCAAGCCTGCGCacagtaaacctctgaaggcgcttgaaaatgata catctgaggaaaattgtCCTCCcgtggaaaattctacaacaagaatcttg ttgtgcgccggaaagttaaaaactgatacagcgccctattcataaacaca attacgcaactttgttgtcgttcctagtccttttatACGAATGCAGTCCT TAcaatttcgagattgcatattcgtcagattgttgctccggcctaggagc ctttaattctctcttccgacaacaACGACGGtcaagatatttttgtttgt ttatctaatccgatgatctattccgatttaataaaaacggattatctgga tttcgataatattgcgaaagtatttagaaaaagatggctgccNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTGAAAGAt agtgatcattttcatcattattcatgatgttttggacatgatttatgaga agtttgatgcatactggtctaacaatgtggaaagactttggaggaatttt ggccatgaatcgtcagctgctcgagtgcttaaatcttgcatatagCTAAA CTTCTCTAGCTAGTTTTATGGACGCACAaaaaaaaccataaaactctgta acttgacaatggaataaaactttcaaacacacatccattggaattcgaaa gagaatactaaaattacaatattacagtgcaaatttgaaaacgatctgag cagtttttgtggtgtatgtcgttatgtgtatggctgaaaatgatcctgtt ttgtattcatcattttttgactgggcgaccgttccttttgatttttcaaa cccaacacagatattttacaaactatCACtgtgagaattcagtaaaggat acaaataaacaattcctgtgtaaatttaaacaagattggagtaattttca cagtgttatggctgaaaatgatcgtttttggactttgtcgtaatttcatc gcggctggcgaccgNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN CGACCgttcctttgatttttcaaacccgacacagattttttacaaacata tcactatgagaattcagtaaaggatactaaaacacaattccagtgtaaat ttgaacaagatcggagaaattttcacagtgttataactgaaaatgttatt tttggactttgtcgtaatttcattggctggggcgaccgttccttttgaag atttttcaaacccgaaacaggttttttctactaaatataccactatttat tacatacacactattgtaccattttatttggtttatcctactctccctca agtattatcccaacagaaaaaaataatgcttagctaaaaacccgtggcct ctaatttaggctatttttctccccgaaattttatctggacaatcaaatca agaacttggagatattgacttctaaatgttaatctcctttagctccaatt ttgaactttttagtcgaggatgagtgggcggggtggggttggttctttag gcaagaaagtgcatgNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNttttattcgttaagattatttctcatactcgc tctgcaatagaattattactgggctttctgatctgttctgattagcagtt tgtgggcaacgttttaacacaactaactcaacaagctcatctttcacatc ttttaatctcttaagccggagcttccagcgcagctggtttattatgtttt cacacatccctttagaacaaccgaaaaaaaacgaagcTTCAAAAAGTTGC gcatttccagtgagtaaacgattctgacaattaacaaaattgatgatgat gatttttttttggtccGGCAAATGTCTTGTATTGGGGgccctaagcctac gcgagattgaagcgtttgggtaaacgagacaaaacttgaaaaaagctggt gttttgaagcgcttccgtgcgatcgaaatattGCTCTTTGTGACGGACTG ATTTGGGATTTTCAGCCCAGTCTTAGGGGACCACGGAAGTAATTAAATTG GTTATTAAAGTTATCGAAAATAATCAAAGACCAAAGTACTTGGTTATAGA GTCTTTGAAGAGGGACGAAAAGAGGGttggattttactcagttcatttTA CTTAAAAACATACAGGTATATGTACCACAAAACCCACAGATACCTCAAAa ccaacaatttcatttcaggaGTTCNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNGGTTTTGAGGTACATCTATTGTGGGTTCTG TGGTGTAATAGGTAATTCTATTGAGActaacttatcaacatatgaaTAGT TCTACAACAAACTTACCTAGATGTACAGGTGCAAATTTTTACCTTGATTG ACCCAGTGGATTTAAAGATATTGTCAATAATATAAatgtgggttttgagg tacgtattcaaaaaaagcaaaaattttaaaaagcaatgatataaaaacaa tctaacatataacattgaaaaatatCAGGAAGAACTCTTTTCATGGGACT CTTCGCACCATCAAACAATTTACTTGATAAAGGCAgcccaaaaaataatt atttaggtCAGAAATTTAGTGTGGGTTTTGTGGTACATATACCTGTatcc taaaatgaaaaaaatctaagtttcaaactattgggaCTGCCCCAAACTGC CCCATTCTTAATAAAACTGGCTCTTAACAACCCTCTTTTCGTCCCTCTTC AAAGACTCTATAACCAAGTACTTTGATTATTTTCGATAACTTTAATAACC AATTTAATTACTTCCGTGGTCCCCAGTCCCCTAAGATCCCAGCTGTTTGG TTTGGAAACACagatgtctaaacttttcactaTATCTCTAGAACTataaa acagattttttgaaattctgtaaaaaagtCCAAGCTCCTAAATAGTTTTA TATGTTCcgtaaaaaaatcataaccatcagttaAATACGCGTTCACCTAT AAGCAATGTTCCTCGGGTCTGCCAACATTGCCTGTAGAATCATGCTTAAA GCTGCTTAAAGTCTCAAATTATAACAACATAAACCAACAGCAAACCACAA ACCAATCCCGAACAAAGAGCATGTGTTATATCCATTTTAAAATGTCATGA CTCAATACACTGAGACTCTGGAATCAAAACAGGAGCATAAGGGTCTTTGC AAGTTACTCGCTCCAATATATTGCAGATGTGATATTCAATGTTCCATTAA AAATCTTTCCTTTATTGATTACAACTCTTGGCAAGTGGTATGAAATAAGC AaCTCTCAATTTAATCTTTacgaatagcattctttttcttcaacagttca attcttccaCGACAACAAGTGAAGCTCTCATAAGTCTTgagaactttttt attttctttaatgtTGTCATCTCTCCttgtaaaagattttcagaATATAA CCGaaggaaaatatttcaatatttttctttctacgaGTTCCATCTTGTAG CTGTATTTCTAGCTGTTTTCTGATGAAATAATTACAGATATCCATCGCTT ACGAACCGTGACCGgttctgaccaatcagaagcctaCCGAAAGCTGCGTT TATATTATGAACGCGTGCTTTCCCTAagccagtattccaaggcaaactta aaatccgtaaatataaaaaatcttaagTTCCAATTCAGAAggatagattt ttttaaacattgctCAAATTCACCATCATCATTAATGGCTAGAAAGTCGT CCATTAAGCGGAAATTATGTCAAAACCGCCTGGCTGTAAAAATTTCTTCT TTTTTATCTTTTTGACATAAGCTGACTCATAGTAGTATAAAAAGATTGGC CATCAATGGGATTGGATCCAAACTCACCGGAATAACAATCTTTTGTCTTT AAATAGAGGAAAACTCCTGTCAAAAGGCAAAATAAATGAATTTATGAAAT AATAATAAAGACTTTGTTTGGCGTGTAATAGGAAGCCCCTAGAACAAGCT TTCACTAGTTCAAAAACCTAGGACAAAGACCAAAAAAATGTCTATTCTGT CTATACTTTCTGATGACTGGACGACAGACCAGAATTAGATAATGTATTAT ATCAAAAATCCCAACATTTTGTAGAGGTCATACCTGTGAAATATAATTCT AAGAATAACATTAAATTACTAAACATACATTATTAAACATACATTATTTG TCTTCAGCCATTACAAATGGGTAAAAGAACTATTTTTCTATCAGGCAACA GTTGTCTTGGAAAGGCAAAtcaattaccttatcggcctttTTTATGCCCA CCCTAATTTAACACTGTTTGAACCCTTAttccgccacagcctaattttgg gcttgcGGCAATTAGGGctgtaaataacgccaaaacttgtaaaaatcgct attcaggcttcaaaacagtaagtattaactaaaatttacattaaaatgtc acctttcagtattaaactgttgaaaattccattgaaaatcattgattttc gtgaagttttggatatagagtaaaaagatggatagttttcatcctttaaa attaacgccgcttttaggtagaaattgcaaaattttggcccttttaacAC GCCCTttttattacgccacgagcccaaaagtaacgccaataagggctgAT AAGGTAGATAGATGATTTTACCATTAAATAAATTTATGCTGCAGGACCCT TGTGACTGCCTCAACAACTATCGAAAATATCTCATTTCTTATTTTAGTAA GCGGTGAAGTACCAGAGAACCCTGTTGTATCACCTGTATCAAACCAAGTC TTTGAACGACGActaattgaaaaatttatttctgaGAATGGAACTGATCC TGTGACAGGAGATACTCTTTCTGAATCTGAATTGATTGAAATTAAAAGTA AGAGTctattttcttaatattttgaaaatctttctcaAGGCAATCTTCCA TGCTGAGATAATACATTTGTCTGCGAAATGGAACGATTGAGCATCAACAT TAAGAAACAAAGAACATTctataacttgaaatttttgagCATAATTATTG TTTATTTAGCAGATTTGATATCCTTTTAACAAATTTCTTCTGGAAAGTCA AAgtctttttaaatgttttaacatttttaatgagGCCTTTGAATTATTCT TTTAGCTACTGCCCTCACCAAACCGCGACCACCATCAGCGACAAGTATTC CTgctattttaaaatctttgcaAGATGAGTGGGTAGGATAACTTTCTTTT GTCAATGAAAGTCTTATTTGCTTTGTTTTTACTTGATTATGGAACATTAA TGACACTTTTCGTATACCAGTAGAATGACTCCAATACAGTAATGGGAAGA AAGTGTTAGAAAAcctttcgttttttttaaagcaCTTTTTCAACATATTT AATTAGTTTCTGTACATAATGATTTAGGATGCAGTCATGTTGCATAGTTT CACACTGAGACAGCAATTGCAAGCTGCAAGACAAGGTACTGTTTTTTCTT AACAATTTTCTATAAACTCTCAGCTCCTTACCAAGGTGTGTGCTTTCTGT TAATACTGTATGTTTTTGTCAGTTTTCTGCccaaaatttgaataattttt acatttttcctattcttttgttattttgttccaTTCATTGTTTTACCATT GACTAATTTTTGTTTATAGAATTATCACATGCACTTTACCAACATGATGC AGCGTGTCGTGTGATTGCCAGATTGACCAAAGAAGCCACTGCAGCTCGTG AAGCTTTGGCTACACTCAAACCTCAAGCCGGCGTCTCTCAACTTACATCA GCAACAACGAATGTTTCTAGTGGTAATAAGGTAGATGAAACAGAAATACC AGATTTTTTGAGAAACAACTACGATGTTTCATTGATGTTGTTTCTATTAG CTTTTCACTAATAAGAATTTGTAGTTTCACTCTTTTGATGAGGAATTTAT TCACACATACACCCCTCATTAAGTTAGATTCTTCCTTAGATGGACGAGAC CAACATCCTTCTTTTTAGTAGACCTGCTTCAATCTTATTACAATCAGGTC GCAAAAACCTTCTAACATGATTTGTATTTCATTCTTTCTTTATTCTAAGG TTGATGACATGGACATTGTGGAACCTGCGGAAATCGGAATGTCTGAAGAA GTCCTTCAAAAAGTATGCCGTGAATTGTTTATTTGTACAAAGAATTTTAA ACAATGAACTACATGAGTCACAATACTTGGAACATTAAGAAAAGTCAGAG AAAAGttatacaaaaaaatatccagagacaacaataaaaataatatcatt actttttATCTTTACAGCTCCAAGATAAGGCAACCGTCTTGACAAGTGAA AGGAAGAAGGTGAGACTGATTGGAACTAATATTTACATTCCTACTTTCAT CTTTGCTTGTTGTACTTTGTTTTCTTTGTATTAAGTCCTTTtacagtgtt aaaagttcttccgtctcagacagATTTCCGTCTCAGAGAAGTATATAGAG Agacttttccgtctcaaaatcctgcataattcaccaaaagttcaagaata tgtgctaatttgctgtgtaaaatccattttccgtctcagacgaaaatctt gctttgaccactgcttTTACTCTGTACCATTTGACCAAGTGAAATTTCTC ATCTAGAGAGGTAAAAAACCACCAGAGGATCTGACACCCATCGAAGACAT CAAATCATTCAAACAAGTTGCCTCTCATCCCGTAAGTTCTACACAGTAAA TCCCTGTGTCAAACTAatcacttaattttttttttttttttaagtcaacA TGTCTGATAATCGATCTTTGGCCAAGTGATTGAATAGAGCGCAATTGGAT GCTAGATATCTCTAATTGATACTGCATGATTGTTTATAATTGTATTGTTA ATTTTGTAGACTCAGTTTTTAAATGTCTCATTTTCTGATTTTGTAGGGTC TCCATAGTGCCAGTGTTCCTGGAATATTGGCTCTTGACCTTCAAGACAGT GATCCATCAAAATGCATTACAGGTGAGATAAACTGTAATAAACCTTTTAT CTCTTTTTGTCTAAGAGGGGAAAAAGATCCCGCCAAACAAACTTTACTTA ACTGACCTTTAGATAGATTGCAGGGGTGCATATCTAAAACAGGAAACTAT CCATTTAAATTTCCAGAATGCCTTTATAATTTCTCCTTGCTCTCTTTCAG GTGGTGTTGACAAAAACGCTGTTGTTTTCAACAAAGATAATGAACAGGTG AAGCAACCGGTGTTCTCCATATTTATCAAACTTTTAAACTTGCTAAGCTA AAGGGGTTGAATAGATTTCTGTATGAAATCTTGTTCTGCAggtatatcaa aatcaaaagaaaaagctatgtttttagtttttaacGAAACCCTTTCTTCA TTTGAATATATTAACCATTTCATGTTTTTCAGGTTGTGGCAACACTCCGC GGACATACCAAGAAAGTTACATCAGTCATTTACCATCCATATGAAGTATG TTTCTGATTCTGATATTTTATTCAACCTTTAATGatatttaataatttat tttacTTTCAGAGCTCCCTAGCACATTTTATTNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNcaacccttccctctccccttatcaacaatcaatgatgaatttat tgcgttatgcattttcgctaaacgctatattttctgactgattttttctc ctcgcattgctatctaactttcatcatcaggtaggtccattcagcatcta gcttgttttttttgtctttagTTCCAGCTTCAAGTATCAAGCAAATTGAG ATTTCTATTCTAGTTGATTATTGTTTAAGCTAGACTTATTAAGCAACAAC TTAACTTGAATTGAATTTCGTTTGGtaatttttgataaacttttttcttt ttaggaaATCGGTATTACTGCTTCAGCTGACAACACAGTTCGTGTCTGGA GCATACCTAACAGCTCTTGTGCCTACACCATCCGAGTAAGTTTTCTATTA GTAAATGGGTTTTTTTGTAGATAAATTTTATTTACCCTTATAAATATATA AGGCTTGATGTTGCAAAAACGGTAGTGGATTCTCACGCCTCCTTGAAtta gtaaaaattaaaataagatAACCTTTTGATATatcaatttctttctttca cAGGCTCACGATGCGGCTGTTACTGGTTTGAGTTTACACGCTACAGGTTT GACTTGATAAAAATTGAATCCCATAAATAGTGTTGAAAATCCTTAGCCAT AAATAAATCACTTGGCATTCCCATAACATTTGAAAAACCTGACTTTTTTC GtgtttagaaaattattttttggttaCTAATATTGGCTTAGCATAAAATC ACGAAGCATATGGTTATTTGGTGGTTGATTTGCATCCCTTATAACAAATT AATCAAAGTGATGCTGATGAGAAATAAATACAGGGAAATAGATTGAAAGT GAAATTTATATTGTGCTTGCTTCATCTTTTGACTGTCAAgtaaaaagtaa attaaattttttgtatcTTTCATTGTTTAGGTGACTACGTTCTGACATCC TCCATTGACCAGGTAAGGTAAATAGTGAATTATGGTTGcttcaaattcat tttttgcttttttttatcttaGAGATAAAcgattttttctttgtcatgTT AAGTCATGTGTTTACTTttcaaccaacaaaatttttaaaagtattaTTGC AAGGGGAAGAACAAGTGGAGAATAGAATTTTTGCTAAGTTAAACCATAGT TCCTTTGCACCCCAGTTATGACAGCATCTCGTGGCAAAGAATGCTTCTTC AGTTTGCTGGTTTGCTGACGGCTCTATTTTTATCTTAAGCTTTCTGAATT GTTACCACTCTGCATGTTTTCTATCACAGCACTGGGCTTTCTCCGACATC CAAACTGGCAAAGTTTTGATCAAGAGCATTTCAGACCCAAATGCCAGTCA TGGTAAGGATGGTTTGTCAATTTTCTGTTTGTGCTACTCGATCATGTCCT AAAAACCATGTTGAACCAGAAcacctttttgtaattttgtctCAAGGACC AAACCAGGGTGGCCTGAATGTCAAAgtgtccaaaaaaaataagaattagt acacatgtactaataTACCAATTCTCTAAATTTGGTTGGTGGTGTGTTTG CAAAAGGTTCTCTGAAACCTTTTTGGTACTAAAACATGTAGTttgatttt gagtaattttcataGGTTAGTTATTCTGTATTTCCTCCAATATAGATGtc gattttaaaatttgattctCACAGGTTTGACATGCGCACAATTCCATCCT GACGGTTTGATCTTTGGTACTGGAACTACCGACAGGTAAGgtattttctg aaatttaaaGAGAAAATAGCTCATTCTCGTTGATATTGACTTCACCATAT GAAATTTTATCTGTCCTAAAGCACAGTTGTTAGCATTCGAATTTTTTGGA AAGTGTTGACAAAATCTCTAAAAGTCTACGTTGTGTAATCTGTTATGACT TCACATACTTTTAAACTACTTGTTGGTTAACAGTAACAAAACAAAATACG TTCTTCCCTTTCAGCTCTATCAAGATTTGGGATTTGAAAGAACGAAAATA TGTTGCCAGTTTCCCGGGACACTCAGGACCGATTACAGCTAttgactttt ctgaaaatggGTATGATGTTATTATATGAGCTTTTTTCATCATGAAGCTC GGTCCACGAAAGATTGCATAAGCTTGATCAATATTCTTGAACATTCCCTC TCTTATTAGGCTGCATAGGCATACACAGTTCTCTACTTCTCAAGTTCTAG AGAAGTGAATAATAATTCATTTTAGTCATATTTACTTGTtctgtttgtat ttttttacttttctttgaaATGTTTAGATACTACTTGGCCACAAGCGCTG ATGATTCAGTGGTCAAACTTTGGGATTTACGAAAATTGAAGAACTTCAAA ACAATTCCTTTAGATGAGAATGACGAGGTAATTCACATTCTTCACCTCAC TCACATGTTAATTTTTAACCAATTTTATGTTGTGTCTGGTATTCACTTCA CCAAGTTATGGGTGATGATGGAATCTTTTTGCACAGGAAAAAGTTGAATT AGATGTGATAAGTGAAAGTTTTATGGCACACTTTGGAGCATGAATGGAAT GTGGATGGCATTGTACTTTCAAACTACTTTTTCCGAAGGGAAATACTTGG ATTCGTTTAAAAACTTAGAGTTTTAGAAGAACGTTTGTGAAATATGATTA CGattttcatttcaatgaatACTCTGGTGAATTAATTACCCATCATTACT TTATGTTGCTTTTACTTTCCAGATCAAATCATTGAGCTTCGACAAAAGTG GAAATTATTTGGCTGTTGCTGGCTCAAACATCCAGTAAGTATTTTGCTAT ACTTTCAACTTGCGCATTGGCATCATAAGCTTTTTCACAGCTAAGCACAT GTCGTCCTGATTCATTTAAATGAGGCTTTCCACTTGGATAAgcttttatt gtatttttaaaaataaaagaccCTTAACAACTTCCAAATGTTTAGTTTAG GTTTACGCtcttgattttaaaaatgtctCTCATGTCtcaatttgtttttt ctttcagaatTTACGTTGTCAAACAATGGGACCTTCTGAGACAAATTAAT GGTAAATCTGCAtttttatcttgaaaatattatcTTGACTTAAGTTCATG TTTTAAGTGACGCTAGTCATAGTAAACTAAAATGGAAAGAAACTGATAGA GAGAGAGCGCATACACTCAATGGAGTGAAAAGACGACTAGCAACATTGAT ATAAAATTCCTTACATTTTCTTTCGAAGACAAACTAGCGCTAGATTACTG CATTGTTATTTGACCTTTATATGTGATAAACTTACCTTCTCTTTAGATCA CACCGGGTTGGTCACTTCAGTCAAGTTTggaaaaaatgctgatttcttGG CATCTGCCAGTATGGACCGAACCTTGAAATACTTTTCACGGTAGAGTGTT GCTTGGGAAATATAAACGTGAAATGTACCTATCATTGCACTGTGAGAATG TGCTAGAAAAGACAGATTTTGTGCATCAGATAAATTGTACTGGACATCAA CATCAACTCGCATAGCTTATAAAATAGCGAAATATTTCATAAGATTTTAA ACGTATCATTTCATTTAACTGAATAACGATCTTTtgtaaatttattattt ttaggaGACAAAGCTAAGAGGAGTTTGTTGACCTGTAGCTTGTCCTCCAA CATTCCATCATCGGTTGCTGATAGTGTGGTCTGATACAAAAGTAAAACCA TGATTCGCTACTCTATACTCGCTAGCAACACTGAGCTTTACATAAACCCT AATGGCAGTTTCCCAATCCTGGACAACtaaaatctttgattggagttttt ttgaaagtgttacCCTGATGGTAGCACTGCTTAATGGCGATGTAAATGCA CCGATACTAGTTGTACTTTTCAGTGAATACTTGAGATGAGCTTCTTTGCG gtaccactttaaaaaaaactccgatcaaagatggtgcATTATAGCTTTGT CCAGATAAGCATCCAAAAGAGAACTGTTTGTTGTAAAGTTTTGCAGCAAA GCTGATTAAAGCCAAagcttttgatttttactatcAATTTTGTAAGGAAA TTTTCCTTTTAGTATTTTTACGatgaatgtcatttttaatatGATTAGTT TCATGGTGTAATAAACGGATAATAACTGTCCATtttaatttcttcaaaat ctCATCTTTCTTGTCAGGGAAAATGTTTCAGCGTAAATGTTTATGATATA TGTTTTCTTAAATAATGAGGTTCCCGATTTTCGTGACTTCCTG

Coding sequence (CDS) from alignment at scaffold_93:125485..145827+

>TCONS_00073491 ID=TCONS_00073491|Name=TCONS_00073491|organism=Clytia hemisphaerica|type=CDS|length=31941bp|location=Sequence derived from alignment at scaffold_93:125485..145827+ (Clytia hemisphaerica)
ATGGCGCTCGTCTGTTCAATAAGCGGTGAAGTACCAGAGAACCCTGTTGT
ATCACCTGTATCAAACCAAGTCTTTGAACGACGActaattgaaaaattta
tttctgaGAATGGAACTGATCCTGTGACAGGAGATACTCTTTCTGAATCT
GAATTGATTGAAATTAAAACTACTGCCCTCACCAAACCGCGACCACCATC
AGCGACAAGTATTCCTgctattttaaaatctttgcaAGATGAGTGGGATG
CAGTCATGTTGCATAGTTTCACACTGAGACAGCAATTGCAAGCTGCAAGA
CAAGAATTATCACATGCACTTTACCAACATGATGCAGCGTGTCGTGTGAT
TGCCAGATTGACCAAAGAAGCCACTGCAGCTCGTGAAGCTTTGGCTACAC
TCAAACCTCAAGCCGGCGTCTCTCAACTTACATCAGCAACAACGAATGTT
TCTAGTGGTAATAAGGTTGATGACATGGACATTGTGGAACCTGCGGAAAT
CGGAATGTCTGAAGAAGTCCTTCAAAAACTCCAAGATAAGGCAACCGTCT
TGACAAGTGAAAGGAAGAAGAGAGGTAAAAAACCACCAGAGGATCTGACA
CCCATCGAAGACATCAAATCATTCAAACAAGTTGCCTCTCATCCCGGTCT
CCATAGTGCCAGTGTTCCTGGAATATTGGCTCTTGACCTTCAAGACAGTG
ATCCATCAAAATGCATTACAGGTGGTGTTGACAAAAACGCTGTTGTTTTC
AACAAAGATAATGAACAGGTTGTGGCAACACTCCGCGGACATACCAAGAA
AGTTACATCAGTCATTTACCATCCATATGAAgaaATCGGTATTACTGCTT
CAGCTGACAACACAGTTCGTGTCTGGAGCATACCTAACAGCTCTTGTGCC
TACACCATCCGAGCTCACGATGCGGCTGTTACTGGTTTGAGTTTACACGC
TACAGGTGACTACGTTCTGACATCCTCCATTGACCAGCACTGGGCTTTCT
CCGACATCCAAACTGGCAAAGTTTTGATCAAGAGCATTTCAGACCCAAAT
GCCAGTCATGGTTTGACATGCGCACAATTCCATCCTGACGGTTTGATCTT
TGGTACTGGAACTACCGACAGCTCTATCAAGATTTGGGATTTGAAAGAAC
GAAAATATGTTGCCAGTTTCCCGGGACACTCAGGACCGATTACAGCTAtt
gacttttctgaaaatggATACTACTTGGCCACAAGCGCTGATGATTCAGT
GGTCAAACTTTGGGATTTACGAAAATTGAAGAACTTCAAAACAATTCCTT
TAGATGAGAATGACGAGATCAAATCATTGAGCTTCGACAAAAGTGGAAAT
TATTTGGCTGTTGCTGGCTCAAACATCCAaatTTACGTTGTCAAACAATG
GGACCTTCTGAGACAAATTAATGATCACACCGGGTTGGTCACTTCAGTCA
AGTTTggaaaaaatgctgatttcttGGCATCTGCCAGTATGGACCGAACC
TTGAAATACTTTTCACGGTAGATGGCGCTCGTCTGTTCAATAAGCGGTGA
AGTACCAGAGAACCCTGTTGTATCACCTGTATCAAACCAAGTCTTTGAAC
GACGActaattgaaaaatttatttctgaGAATGGAACTGATCCTGTGACA
GGAGATACTCTTTCTGAATCTGAATTGATTGAAATTAAAACTACTGCCCT
CACCAAACCGCGACCACCATCAGCGACAAGTATTCCTgctattttaaaat
ctttgcaAGATGAGTGGGATGCAGTCATGTTGCATAGTTTCACACTGAGA
CAGCAATTGCAAGCTGCAAGACAAGAATTATCACATGCACTTTACCAACA
TGATGCAGCGTGTCGTGTGATTGCCAGATTGACCAAAGAAGCCACTGCAG
CTCGTGAAGCTTTGGCTACACTCAAACCTCAAGCCGGCGTCTCTCAACTT
ACATCAGCAACAACGAATGTTTCTAGTGGTAATAAGGTTGATGACATGGA
CATTGTGGAACCTGCGGAAATCGGAATGTCTGAAGAAGTCCTTCAAAAAC
TCCAAGATAAGGCAACCGTCTTGACAAGTGAAAGGAAGAAGAGAGGTAAA
AAACCACCAGAGGATCTGACACCCATCGAAGACATCAAATCATTCAAACA
AGTTGCCTCTCATCCCGGTCTCCATAGTGCCAGTGTTCCTGGAATATTGG
CTCTTGACCTTCAAGACAGTGATCCATCAAAATGCATTACAGGTGGTGTT
GACAAAAACGCTGTTGTTTTCAACAAAGATAATGAACAGGTTGTGGCAAC
ACTCCGCGGACATACCAAGAAAGTTACATCAGTCATTTACCATCCATATG
AAgaaATCGGTATTACTGCTTCAGCTGACAACACAGTTCGTGTCTGGAGC
ATACCTAACAGCTCTTGTGCCTACACCATCCGAGCTCACGATGCGGCTGT
TACTGGTTTGAGTTTACACGCTACAGGTGACTACGTTCTGACATCCTCCA
TTGACCAGCACTGGGCTTTCTCCGACATCCAAACTGGCAAAGTTTTGATC
AAGAGCATTTCAGACCCAAATGCCAGTCATGGTTTGACATGCGCACAATT
CCATCCTGACGGTTTGATCTTTGGTACTGGAACTACCGACAGCTCTATCA
AGATTTGGGATTTGAAAGAACGAAAATATGTTGCCAGTTTCCCGGGACAC
TCAGGACCGATTACAGCTAttgacttttctgaaaatggATACTACTTGGC
CACAAGCGCTGATGATTCAGTGGTCAAACTTTGGGATTTACGAAAATTGA
AGAACTTCAAAACAATTCCTTTAGATGAGAATGACGAGATCAAATCATTG
AGCTTCGACAAAAGTGGAAATTATTTGGCTGTTGCTGGCTCAAACATCCA
aatTTACGTTGTCAAACAATGGGACCTTCTGAGACAAATTAATGATCACA
CCGGGTTGGTCACTTCAGTCAAGTTTggaaaaaatgctgatttcttGGCA
TCTGCCAGTATGGACCGAACCTTGAAATACTTTTCACGGTAGATGGCGCT
CGTCTGTTCAATAAGCGGTGAAGTACCAGAGAACCCTGTTGTATCACCTG
TATCAAACCAAGTCTTTGAACGACGActaattgaaaaatttatttctgaG
AATGGAACTGATCCTGTGACAGGAGATACTCTTTCTGAATCTGAATTGAT
TGAAATTAAAACTACTGCCCTCACCAAACCGCGACCACCATCAGCGACAA
GTATTCCTgctattttaaaatctttgcaAGATGAGTGGGATGCAGTCATG
TTGCATAGTTTCACACTGAGACAGCAATTGCAAGCTGCAAGACAAGAATT
ATCACATGCACTTTACCAACATGATGCAGCGTGTCGTGTGATTGCCAGAT
TGACCAAAGAAGCCACTGCAGCTCGTGAAGCTTTGGCTACACTCAAACCT
CAAGCCGGCGTCTCTCAACTTACATCAGCAACAACGAATGTTTCTAGTGG
TAATAAGGTTGATGACATGGACATTGTGGAACCTGCGGAAATCGGAATGT
CTGAAGAAGTCCTTCAAAAACTCCAAGATAAGGCAACCGTCTTGACAAGT
GAAAGGAAGAAGAGAGGTAAAAAACCACCAGAGGATCTGACACCCATCGA
AGACATCAAATCATTCAAACAAGTTGCCTCTCATCCCGGTCTCCATAGTG
CCAGTGTTCCTGGAATATTGGCTCTTGACCTTCAAGACAGTGATCCATCA
AAATGCATTACAGGTGGTGTTGACAAAAACGCTGTTGTTTTCAACAAAGA
TAATGAACAGGTTGTGGCAACACTCCGCGGACATACCAAGAAAGTTACAT
CAGTCATTTACCATCCATATGAAgaaATCGGTATTACTGCTTCAGCTGAC
AACACAGTTCGTGTCTGGAGCATACCTAACAGCTCTTGTGCCTACACCAT
CCGAGCTCACGATGCGGCTGTTACTGGTTTGAGTTTACACGCTACAGGTG
ACTACGTTCTGACATCCTCCATTGACCAGCACTGGGCTTTCTCCGACATC
CAAACTGGCAAAGTTTTGATCAAGAGCATTTCAGACCCAAATGCCAGTCA
TGGTTTGACATGCGCACAATTCCATCCTGACGGTTTGATCTTTGGTACTG
GAACTACCGACAGCTCTATCAAGATTTGGGATTTGAAAGAACGAAAATAT
GTTGCCAGTTTCCCGGGACACTCAGGACCGATTACAGCTAttgacttttc
tgaaaatggATACTACTTGGCCACAAGCGCTGATGATTCAGTGGTCAAAC
TTTGGGATTTACGAAAATTGAAGAACTTCAAAACAATTCCTTTAGATGAG
AATGACGAGATCAAATCATTGAGCTTCGACAAAAGTGGAAATTATTTGGC
TGTTGCTGGCTCAAACATCCAaatTTACGTTGTCAAACAATGGGACCTTC
TGAGACAAATTAATGATCACACCGGGTTGGTCACTTCAGTCAAGTTTgga
aaaaatgctgatttcttGGCATCTGCCAGTATGGACCGAACCTTGAAATA
CTTTTCACGGTAGATGGCGCTCGTCTGTTCAATAAGCGGTGAAGTACCAG
AGAACCCTGTTGTATCACCTGTATCAAACCAAGTCTTTGAACGACGActa
attgaaaaatttatttctgaGAATGGAACTGATCCTGTGACAGGAGATAC
TCTTTCTGAATCTGAATTGATTGAAATTAAAACTACTGCCCTCACCAAAC
CGCGACCACCATCAGCGACAAGTATTCCTgctattttaaaatctttgcaA
GATGAGTGGGATGCAGTCATGTTGCATAGTTTCACACTGAGACAGCAATT
GCAAGCTGCAAGACAAGAATTATCACATGCACTTTACCAACATGATGCAG
CGTGTCGTGTGATTGCCAGATTGACCAAAGAAGCCACTGCAGCTCGTGAA
GCTTTGGCTACACTCAAACCTCAAGCCGGCGTCTCTCAACTTACATCAGC
AACAACGAATGTTTCTAGTGGTAATAAGGTTGATGACATGGACATTGTGG
AACCTGCGGAAATCGGAATGTCTGAAGAAGTCCTTCAAAAACTCCAAGAT
AAGGCAACCGTCTTGACAAGTGAAAGGAAGAAGAGAGGTAAAAAACCACC
AGAGGATCTGACACCCATCGAAGACATCAAATCATTCAAACAAGTTGCCT
CTCATCCCGGTCTCCATAGTGCCAGTGTTCCTGGAATATTGGCTCTTGAC
CTTCAAGACAGTGATCCATCAAAATGCATTACAGGTGGTGTTGACAAAAA
CGCTGTTGTTTTCAACAAAGATAATGAACAGGTTGTGGCAACACTCCGCG
GACATACCAAGAAAGTTACATCAGTCATTTACCATCCATATGAAgaaATC
GGTATTACTGCTTCAGCTGACAACACAGTTCGTGTCTGGAGCATACCTAA
CAGCTCTTGTGCCTACACCATCCGAGCTCACGATGCGGCTGTTACTGGTT
TGAGTTTACACGCTACAGGTGACTACGTTCTGACATCCTCCATTGACCAG
CACTGGGCTTTCTCCGACATCCAAACTGGCAAAGTTTTGATCAAGAGCAT
TTCAGACCCAAATGCCAGTCATGGTTTGACATGCGCACAATTCCATCCTG
ACGGTTTGATCTTTGGTACTGGAACTACCGACAGCTCTATCAAGATTTGG
GATTTGAAAGAACGAAAATATGTTGCCAGTTTCCCGGGACACTCAGGACC
GATTACAGCTAttgacttttctgaaaatggATACTACTTGGCCACAAGCG
CTGATGATTCAGTGGTCAAACTTTGGGATTTACGAAAATTGAAGAACTTC
AAAACAATTCCTTTAGATGAGAATGACGAGATCAAATCATTGAGCTTCGA
CAAAAGTGGAAATTATTTGGCTGTTGCTGGCTCAAACATCCAaatTTACG
TTGTCAAACAATGGGACCTTCTGAGACAAATTAATGATCACACCGGGTTG
GTCACTTCAGTCAAGTTTggaaaaaatgctgatttcttGGCATCTGCCAG
TATGGACCGAACCTTGAAATACTTTTCACGGTAGATGGCGCTCGTCTGTT
CAATAAGCGGTGAAGTACCAGAGAACCCTGTTGTATCACCTGTATCAAAC
CAAGTCTTTGAACGACGActaattgaaaaatttatttctgaGAATGGAAC
TGATCCTGTGACAGGAGATACTCTTTCTGAATCTGAATTGATTGAAATTA
AAACTACTGCCCTCACCAAACCGCGACCACCATCAGCGACAAGTATTCCT
gctattttaaaatctttgcaAGATGAGTGGGATGCAGTCATGTTGCATAG
TTTCACACTGAGACAGCAATTGCAAGCTGCAAGACAAGAATTATCACATG
CACTTTACCAACATGATGCAGCGTGTCGTGTGATTGCCAGATTGACCAAA
GAAGCCACTGCAGCTCGTGAAGCTTTGGCTACACTCAAACCTCAAGCCGG
CGTCTCTCAACTTACATCAGCAACAACGAATGTTTCTAGTGGTAATAAGG
TTGATGACATGGACATTGTGGAACCTGCGGAAATCGGAATGTCTGAAGAA
GTCCTTCAAAAACTCCAAGATAAGGCAACCGTCTTGACAAGTGAAAGGAA
GAAGAGAGGTAAAAAACCACCAGAGGATCTGACACCCATCGAAGACATCA
AATCATTCAAACAAGTTGCCTCTCATCCCGGTCTCCATAGTGCCAGTGTT
CCTGGAATATTGGCTCTTGACCTTCAAGACAGTGATCCATCAAAATGCAT
TACAGGTGGTGTTGACAAAAACGCTGTTGTTTTCAACAAAGATAATGAAC
AGGTTGTGGCAACACTCCGCGGACATACCAAGAAAGTTACATCAGTCATT
TACCATCCATATGAAgaaATCGGTATTACTGCTTCAGCTGACAACACAGT
TCGTGTCTGGAGCATACCTAACAGCTCTTGTGCCTACACCATCCGAGCTC
ACGATGCGGCTGTTACTGGTTTGAGTTTACACGCTACAGGTGACTACGTT
CTGACATCCTCCATTGACCAGCACTGGGCTTTCTCCGACATCCAAACTGG
CAAAGTTTTGATCAAGAGCATTTCAGACCCAAATGCCAGTCATGGTTTGA
CATGCGCACAATTCCATCCTGACGGTTTGATCTTTGGTACTGGAACTACC
GACAGCTCTATCAAGATTTGGGATTTGAAAGAACGAAAATATGTTGCCAG
TTTCCCGGGACACTCAGGACCGATTACAGCTAttgacttttctgaaaatg
gATACTACTTGGCCACAAGCGCTGATGATTCAGTGGTCAAACTTTGGGAT
TTACGAAAATTGAAGAACTTCAAAACAATTCCTTTAGATGAGAATGACGA
GATCAAATCATTGAGCTTCGACAAAAGTGGAAATTATTTGGCTGTTGCTG
GCTCAAACATCCAaatTTACGTTGTCAAACAATGGGACCTTCTGAGACAA
ATTAATGATCACACCGGGTTGGTCACTTCAGTCAAGTTTggaaaaaatgc
tgatttcttGGCATCTGCCAGTATGGACCGAACCTTGAAATACTTTTCAC
GGTAGATGGCGCTCGTCTGTTCAATAAGCGGTGAAGTACCAGAGAACCCT
GTTGTATCACCTGTATCAAACCAAGTCTTTGAACGACGActaattgaaaa
atttatttctgaGAATGGAACTGATCCTGTGACAGGAGATACTCTTTCTG
AATCTGAATTGATTGAAATTAAAACTACTGCCCTCACCAAACCGCGACCA
CCATCAGCGACAAGTATTCCTgctattttaaaatctttgcaAGATGAGTG
GGATGCAGTCATGTTGCATAGTTTCACACTGAGACAGCAATTGCAAGCTG
CAAGACAAGAATTATCACATGCACTTTACCAACATGATGCAGCGTGTCGT
GTGATTGCCAGATTGACCAAAGAAGCCACTGCAGCTCGTGAAGCTTTGGC
TACACTCAAACCTCAAGCCGGCGTCTCTCAACTTACATCAGCAACAACGA
ATGTTTCTAGTGGTAATAAGGTTGATGACATGGACATTGTGGAACCTGCG
GAAATCGGAATGTCTGAAGAAGTCCTTCAAAAACTCCAAGATAAGGCAAC
CGTCTTGACAAGTGAAAGGAAGAAGAGAGGTAAAAAACCACCAGAGGATC
TGACACCCATCGAAGACATCAAATCATTCAAACAAGTTGCCTCTCATCCC
GGTCTCCATAGTGCCAGTGTTCCTGGAATATTGGCTCTTGACCTTCAAGA
CAGTGATCCATCAAAATGCATTACAGGTGGTGTTGACAAAAACGCTGTTG
TTTTCAACAAAGATAATGAACAGGTTGTGGCAACACTCCGCGGACATACC
AAGAAAGTTACATCAGTCATTTACCATCCATATGAAgaaATCGGTATTAC
TGCTTCAGCTGACAACACAGTTCGTGTCTGGAGCATACCTAACAGCTCTT
GTGCCTACACCATCCGAGCTCACGATGCGGCTGTTACTGGTTTGAGTTTA
CACGCTACAGGTGACTACGTTCTGACATCCTCCATTGACCAGCACTGGGC
TTTCTCCGACATCCAAACTGGCAAAGTTTTGATCAAGAGCATTTCAGACC
CAAATGCCAGTCATGGTTTGACATGCGCACAATTCCATCCTGACGGTTTG
ATCTTTGGTACTGGAACTACCGACAGCTCTATCAAGATTTGGGATTTGAA
AGAACGAAAATATGTTGCCAGTTTCCCGGGACACTCAGGACCGATTACAG
CTAttgacttttctgaaaatggATACTACTTGGCCACAAGCGCTGATGAT
TCAGTGGTCAAACTTTGGGATTTACGAAAATTGAAGAACTTCAAAACAAT
TCCTTTAGATGAGAATGACGAGATCAAATCATTGAGCTTCGACAAAAGTG
GAAATTATTTGGCTGTTGCTGGCTCAAACATCCAaatTTACGTTGTCAAA
CAATGGGACCTTCTGAGACAAATTAATGATCACACCGGGTTGGTCACTTC
AGTCAAGTTTggaaaaaatgctgatttcttGGCATCTGCCAGTATGGACC
GAACCTTGAAATACTTTTCACGGTAGATGGCGCTCGTCTGTTCAATAAGC
GGTGAAGTACCAGAGAACCCTGTTGTATCACCTGTATCAAACCAAGTCTT
TGAACGACGActaattgaaaaatttatttctgaGAATGGAACTGATCCTG
TGACAGGAGATACTCTTTCTGAATCTGAATTGATTGAAATTAAAACTACT
GCCCTCACCAAACCGCGACCACCATCAGCGACAAGTATTCCTgctatttt
aaaatctttgcaAGATGAGTGGGATGCAGTCATGTTGCATAGTTTCACAC
TGAGACAGCAATTGCAAGCTGCAAGACAAGAATTATCACATGCACTTTAC
CAACATGATGCAGCGTGTCGTGTGATTGCCAGATTGACCAAAGAAGCCAC
TGCAGCTCGTGAAGCTTTGGCTACACTCAAACCTCAAGCCGGCGTCTCTC
AACTTACATCAGCAACAACGAATGTTTCTAGTGGTAATAAGGTTGATGAC
ATGGACATTGTGGAACCTGCGGAAATCGGAATGTCTGAAGAAGTCCTTCA
AAAACTCCAAGATAAGGCAACCGTCTTGACAAGTGAAAGGAAGAAGAGAG
GTAAAAAACCACCAGAGGATCTGACACCCATCGAAGACATCAAATCATTC
AAACAAGTTGCCTCTCATCCCGGTCTCCATAGTGCCAGTGTTCCTGGAAT
ATTGGCTCTTGACCTTCAAGACAGTGATCCATCAAAATGCATTACAGGTG
GTGTTGACAAAAACGCTGTTGTTTTCAACAAAGATAATGAACAGGTTGTG
GCAACACTCCGCGGACATACCAAGAAAGTTACATCAGTCATTTACCATCC
ATATGAAgaaATCGGTATTACTGCTTCAGCTGACAACACAGTTCGTGTCT
GGAGCATACCTAACAGCTCTTGTGCCTACACCATCCGAGCTCACGATGCG
GCTGTTACTGGTTTGAGTTTACACGCTACAGGTGACTACGTTCTGACATC
CTCCATTGACCAGCACTGGGCTTTCTCCGACATCCAAACTGGCAAAGTTT
TGATCAAGAGCATTTCAGACCCAAATGCCAGTCATGGTTTGACATGCGCA
CAATTCCATCCTGACGGTTTGATCTTTGGTACTGGAACTACCGACAGCTC
TATCAAGATTTGGGATTTGAAAGAACGAAAATATGTTGCCAGTTTCCCGG
GACACTCAGGACCGATTACAGCTAttgacttttctgaaaatggATACTAC
TTGGCCACAAGCGCTGATGATTCAGTGGTCAAACTTTGGGATTTACGAAA
ATTGAAGAACTTCAAAACAATTCCTTTAGATGAGAATGACGAGATCAAAT
CATTGAGCTTCGACAAAAGTGGAAATTATTTGGCTGTTGCTGGCTCAAAC
ATCCAaatTTACGTTGTCAAACAATGGGACCTTCTGAGACAAATTAATGA
TCACACCGGGTTGGTCACTTCAGTCAAGTTTggaaaaaatgctgatttct
tGGCATCTGCCAGTATGGACCGAACCTTGAAATACTTTTCACGGTAGATG
GCGCTCGTCTGTTCAATAAGCGGTGAAGTACCAGAGAACCCTGTTGTATC
ACCTGTATCAAACCAAGTCTTTGAACGACGActaattgaaaaatttattt
ctgaGAATGGAACTGATCCTGTGACAGGAGATACTCTTTCTGAATCTGAA
TTGATTGAAATTAAAACTACTGCCCTCACCAAACCGCGACCACCATCAGC
GACAAGTATTCCTgctattttaaaatctttgcaAGATGAGTGGGATGCAG
TCATGTTGCATAGTTTCACACTGAGACAGCAATTGCAAGCTGCAAGACAA
GAATTATCACATGCACTTTACCAACATGATGCAGCGTGTCGTGTGATTGC
CAGATTGACCAAAGAAGCCACTGCAGCTCGTGAAGCTTTGGCTACACTCA
AACCTCAAGCCGGCGTCTCTCAACTTACATCAGCAACAACGAATGTTTCT
AGTGGTAATAAGGTTGATGACATGGACATTGTGGAACCTGCGGAAATCGG
AATGTCTGAAGAAGTCCTTCAAAAACTCCAAGATAAGGCAACCGTCTTGA
CAAGTGAAAGGAAGAAGAGAGGTAAAAAACCACCAGAGGATCTGACACCC
ATCGAAGACATCAAATCATTCAAACAAGTTGCCTCTCATCCCGGTCTCCA
TAGTGCCAGTGTTCCTGGAATATTGGCTCTTGACCTTCAAGACAGTGATC
CATCAAAATGCATTACAGGTGGTGTTGACAAAAACGCTGTTGTTTTCAAC
AAAGATAATGAACAGGTTGTGGCAACACTCCGCGGACATACCAAGAAAGT
TACATCAGTCATTTACCATCCATATGAAgaaATCGGTATTACTGCTTCAG
CTGACAACACAGTTCGTGTCTGGAGCATACCTAACAGCTCTTGTGCCTAC
ACCATCCGAGCTCACGATGCGGCTGTTACTGGTTTGAGTTTACACGCTAC
AGGTGACTACGTTCTGACATCCTCCATTGACCAGCACTGGGCTTTCTCCG
ACATCCAAACTGGCAAAGTTTTGATCAAGAGCATTTCAGACCCAAATGCC
AGTCATGGTTTGACATGCGCACAATTCCATCCTGACGGTTTGATCTTTGG
TACTGGAACTACCGACAGCTCTATCAAGATTTGGGATTTGAAAGAACGAA
AATATGTTGCCAGTTTCCCGGGACACTCAGGACCGATTACAGCTAttgac
ttttctgaaaatggATACTACTTGGCCACAAGCGCTGATGATTCAGTGGT
CAAACTTTGGGATTTACGAAAATTGAAGAACTTCAAAACAATTCCTTTAG
ATGAGAATGACGAGATCAAATCATTGAGCTTCGACAAAAGTGGAAATTAT
TTGGCTGTTGCTGGCTCAAACATCCAaatTTACGTTGTCAAACAATGGGA
CCTTCTGAGACAAATTAATGATCACACCGGGTTGGTCACTTCAGTCAAGT
TTggaaaaaatgctgatttcttGGCATCTGCCAGTATGGACCGAACCTTG
AAATACTTTTCACGGTAGATGGCGCTCGTCTGTTCAATAAGCGGTGAAGT
ACCAGAGAACCCTGTTGTATCACCTGTATCAAACCAAGTCTTTGAACGAC
GActaattgaaaaatttatttctgaGAATGGAACTGATCCTGTGACAGGA
GATACTCTTTCTGAATCTGAATTGATTGAAATTAAAACTACTGCCCTCAC
CAAACCGCGACCACCATCAGCGACAAGTATTCCTgctattttaaaatctt
tgcaAGATGAGTGGGATGCAGTCATGTTGCATAGTTTCACACTGAGACAG
CAATTGCAAGCTGCAAGACAAGAATTATCACATGCACTTTACCAACATGA
TGCAGCGTGTCGTGTGATTGCCAGATTGACCAAAGAAGCCACTGCAGCTC
GTGAAGCTTTGGCTACACTCAAACCTCAAGCCGGCGTCTCTCAACTTACA
TCAGCAACAACGAATGTTTCTAGTGGTAATAAGGTTGATGACATGGACAT
TGTGGAACCTGCGGAAATCGGAATGTCTGAAGAAGTCCTTCAAAAACTCC
AAGATAAGGCAACCGTCTTGACAAGTGAAAGGAAGAAGAGAGGTAAAAAA
CCACCAGAGGATCTGACACCCATCGAAGACATCAAATCATTCAAACAAGT
TGCCTCTCATCCCGGTCTCCATAGTGCCAGTGTTCCTGGAATATTGGCTC
TTGACCTTCAAGACAGTGATCCATCAAAATGCATTACAGGTGGTGTTGAC
AAAAACGCTGTTGTTTTCAACAAAGATAATGAACAGGTTGTGGCAACACT
CCGCGGACATACCAAGAAAGTTACATCAGTCATTTACCATCCATATGAAg
aaATCGGTATTACTGCTTCAGCTGACAACACAGTTCGTGTCTGGAGCATA
CCTAACAGCTCTTGTGCCTACACCATCCGAGCTCACGATGCGGCTGTTAC
TGGTTTGAGTTTACACGCTACAGGTGACTACGTTCTGACATCCTCCATTG
ACCAGCACTGGGCTTTCTCCGACATCCAAACTGGCAAAGTTTTGATCAAG
AGCATTTCAGACCCAAATGCCAGTCATGGTTTGACATGCGCACAATTCCA
TCCTGACGGTTTGATCTTTGGTACTGGAACTACCGACAGCTCTATCAAGA
TTTGGGATTTGAAAGAACGAAAATATGTTGCCAGTTTCCCGGGACACTCA
GGACCGATTACAGCTAttgacttttctgaaaatggATACTACTTGGCCAC
AAGCGCTGATGATTCAGTGGTCAAACTTTGGGATTTACGAAAATTGAAGA
ACTTCAAAACAATTCCTTTAGATGAGAATGACGAGATCAAATCATTGAGC
TTCGACAAAAGTGGAAATTATTTGGCTGTTGCTGGCTCAAACATCCAaat
TTACGTTGTCAAACAATGGGACCTTCTGAGACAAATTAATGATCACACCG
GGTTGGTCACTTCAGTCAAGTTTggaaaaaatgctgatttcttGGCATCT
GCCAGTATGGACCGAACCTTGAAATACTTTTCACGGTAGATGGCGCTCGT
CTGTTCAATAAGCGGTGAAGTACCAGAGAACCCTGTTGTATCACCTGTAT
CAAACCAAGTCTTTGAACGACGActaattgaaaaatttatttctgaGAAT
GGAACTGATCCTGTGACAGGAGATACTCTTTCTGAATCTGAATTGATTGA
AATTAAAACTACTGCCCTCACCAAACCGCGACCACCATCAGCGACAAGTA
TTCCTgctattttaaaatctttgcaAGATGAGTGGGATGCAGTCATGTTG
CATAGTTTCACACTGAGACAGCAATTGCAAGCTGCAAGACAAGAATTATC
ACATGCACTTTACCAACATGATGCAGCGTGTCGTGTGATTGCCAGATTGA
CCAAAGAAGCCACTGCAGCTCGTGAAGCTTTGGCTACACTCAAACCTCAA
GCCGGCGTCTCTCAACTTACATCAGCAACAACGAATGTTTCTAGTGGTAA
TAAGGTTGATGACATGGACATTGTGGAACCTGCGGAAATCGGAATGTCTG
AAGAAGTCCTTCAAAAACTCCAAGATAAGGCAACCGTCTTGACAAGTGAA
AGGAAGAAGAGAGGTAAAAAACCACCAGAGGATCTGACACCCATCGAAGA
CATCAAATCATTCAAACAAGTTGCCTCTCATCCCGGTCTCCATAGTGCCA
GTGTTCCTGGAATATTGGCTCTTGACCTTCAAGACAGTGATCCATCAAAA
TGCATTACAGGTGGTGTTGACAAAAACGCTGTTGTTTTCAACAAAGATAA
TGAACAGGTTGTGGCAACACTCCGCGGACATACCAAGAAAGTTACATCAG
TCATTTACCATCCATATGAAgaaATCGGTATTACTGCTTCAGCTGACAAC
ACAGTTCGTGTCTGGAGCATACCTAACAGCTCTTGTGCCTACACCATCCG
AGCTCACGATGCGGCTGTTACTGGTTTGAGTTTACACGCTACAGGTGACT
ACGTTCTGACATCCTCCATTGACCAGCACTGGGCTTTCTCCGACATCCAA
ACTGGCAAAGTTTTGATCAAGAGCATTTCAGACCCAAATGCCAGTCATGG
TTTGACATGCGCACAATTCCATCCTGACGGTTTGATCTTTGGTACTGGAA
CTACCGACAGCTCTATCAAGATTTGGGATTTGAAAGAACGAAAATATGTT
GCCAGTTTCCCGGGACACTCAGGACCGATTACAGCTAttgacttttctga
aaatggATACTACTTGGCCACAAGCGCTGATGATTCAGTGGTCAAACTTT
GGGATTTACGAAAATTGAAGAACTTCAAAACAATTCCTTTAGATGAGAAT
GACGAGATCAAATCATTGAGCTTCGACAAAAGTGGAAATTATTTGGCTGT
TGCTGGCTCAAACATCCAaatTTACGTTGTCAAACAATGGGACCTTCTGA
GACAAATTAATGATCACACCGGGTTGGTCACTTCAGTCAAGTTTggaaaa
aatgctgatttcttGGCATCTGCCAGTATGGACCGAACCTTGAAATACTT
TTCACGGTAGATGGCGCTCGTCTGTTCAATAAGCGGTGAAGTACCAGAGA
ACCCTGTTGTATCACCTGTATCAAACCAAGTCTTTGAACGACGActaatt
gaaaaatttatttctgaGAATGGAACTGATCCTGTGACAGGAGATACTCT
TTCTGAATCTGAATTGATTGAAATTAAAACTACTGCCCTCACCAAACCGC
GACCACCATCAGCGACAAGTATTCCTgctattttaaaatctttgcaAGAT
GAGTGGGATGCAGTCATGTTGCATAGTTTCACACTGAGACAGCAATTGCA
AGCTGCAAGACAAGAATTATCACATGCACTTTACCAACATGATGCAGCGT
GTCGTGTGATTGCCAGATTGACCAAAGAAGCCACTGCAGCTCGTGAAGCT
TTGGCTACACTCAAACCTCAAGCCGGCGTCTCTCAACTTACATCAGCAAC
AACGAATGTTTCTAGTGGTAATAAGGTTGATGACATGGACATTGTGGAAC
CTGCGGAAATCGGAATGTCTGAAGAAGTCCTTCAAAAACTCCAAGATAAG
GCAACCGTCTTGACAAGTGAAAGGAAGAAGAGAGGTAAAAAACCACCAGA
GGATCTGACACCCATCGAAGACATCAAATCATTCAAACAAGTTGCCTCTC
ATCCCGGTCTCCATAGTGCCAGTGTTCCTGGAATATTGGCTCTTGACCTT
CAAGACAGTGATCCATCAAAATGCATTACAGGTGGTGTTGACAAAAACGC
TGTTGTTTTCAACAAAGATAATGAACAGGTTGTGGCAACACTCCGCGGAC
ATACCAAGAAAGTTACATCAGTCATTTACCATCCATATGAAgaaATCGGT
ATTACTGCTTCAGCTGACAACACAGTTCGTGTCTGGAGCATACCTAACAG
CTCTTGTGCCTACACCATCCGAGCTCACGATGCGGCTGTTACTGGTTTGA
GTTTACACGCTACAGGTGACTACGTTCTGACATCCTCCATTGACCAGCAC
TGGGCTTTCTCCGACATCCAAACTGGCAAAGTTTTGATCAAGAGCATTTC
AGACCCAAATGCCAGTCATGGTTTGACATGCGCACAATTCCATCCTGACG
GTTTGATCTTTGGTACTGGAACTACCGACAGCTCTATCAAGATTTGGGAT
TTGAAAGAACGAAAATATGTTGCCAGTTTCCCGGGACACTCAGGACCGAT
TACAGCTAttgacttttctgaaaatggATACTACTTGGCCACAAGCGCTG
ATGATTCAGTGGTCAAACTTTGGGATTTACGAAAATTGAAGAACTTCAAA
ACAATTCCTTTAGATGAGAATGACGAGATCAAATCATTGAGCTTCGACAA
AAGTGGAAATTATTTGGCTGTTGCTGGCTCAAACATCCAaatTTACGTTG
TCAAACAATGGGACCTTCTGAGACAAATTAATGATCACACCGGGTTGGTC
ACTTCAGTCAAGTTTggaaaaaatgctgatttcttGGCATCTGCCAGTAT
GGACCGAACCTTGAAATACTTTTCACGGTAGATGGCGCTCGTCTGTTCAA
TAAGCGGTGAAGTACCAGAGAACCCTGTTGTATCACCTGTATCAAACCAA
GTCTTTGAACGACGActaattgaaaaatttatttctgaGAATGGAACTGA
TCCTGTGACAGGAGATACTCTTTCTGAATCTGAATTGATTGAAATTAAAA
CTACTGCCCTCACCAAACCGCGACCACCATCAGCGACAAGTATTCCTgct
attttaaaatctttgcaAGATGAGTGGGATGCAGTCATGTTGCATAGTTT
CACACTGAGACAGCAATTGCAAGCTGCAAGACAAGAATTATCACATGCAC
TTTACCAACATGATGCAGCGTGTCGTGTGATTGCCAGATTGACCAAAGAA
GCCACTGCAGCTCGTGAAGCTTTGGCTACACTCAAACCTCAAGCCGGCGT
CTCTCAACTTACATCAGCAACAACGAATGTTTCTAGTGGTAATAAGGTTG
ATGACATGGACATTGTGGAACCTGCGGAAATCGGAATGTCTGAAGAAGTC
CTTCAAAAACTCCAAGATAAGGCAACCGTCTTGACAAGTGAAAGGAAGAA
GAGAGGTAAAAAACCACCAGAGGATCTGACACCCATCGAAGACATCAAAT
CATTCAAACAAGTTGCCTCTCATCCCGGTCTCCATAGTGCCAGTGTTCCT
GGAATATTGGCTCTTGACCTTCAAGACAGTGATCCATCAAAATGCATTAC
AGGTGGTGTTGACAAAAACGCTGTTGTTTTCAACAAAGATAATGAACAGG
TTGTGGCAACACTCCGCGGACATACCAAGAAAGTTACATCAGTCATTTAC
CATCCATATGAAgaaATCGGTATTACTGCTTCAGCTGACAACACAGTTCG
TGTCTGGAGCATACCTAACAGCTCTTGTGCCTACACCATCCGAGCTCACG
ATGCGGCTGTTACTGGTTTGAGTTTACACGCTACAGGTGACTACGTTCTG
ACATCCTCCATTGACCAGCACTGGGCTTTCTCCGACATCCAAACTGGCAA
AGTTTTGATCAAGAGCATTTCAGACCCAAATGCCAGTCATGGTTTGACAT
GCGCACAATTCCATCCTGACGGTTTGATCTTTGGTACTGGAACTACCGAC
AGCTCTATCAAGATTTGGGATTTGAAAGAACGAAAATATGTTGCCAGTTT
CCCGGGACACTCAGGACCGATTACAGCTAttgacttttctgaaaatggAT
ACTACTTGGCCACAAGCGCTGATGATTCAGTGGTCAAACTTTGGGATTTA
CGAAAATTGAAGAACTTCAAAACAATTCCTTTAGATGAGAATGACGAGAT
CAAATCATTGAGCTTCGACAAAAGTGGAAATTATTTGGCTGTTGCTGGCT
CAAACATCCAaatTTACGTTGTCAAACAATGGGACCTTCTGAGACAAATT
AATGATCACACCGGGTTGGTCACTTCAGTCAAGTTTggaaaaaatgctga
tttcttGGCATCTGCCAGTATGGACCGAACCTTGAAATACTTTTCACGGT
AGATGGCGCTCGTCTGTTCAATAAGCGGTGAAGTACCAGAGAACCCTGTT
GTATCACCTGTATCAAACCAAGTCTTTGAACGACGActaattgaaaaatt
tatttctgaGAATGGAACTGATCCTGTGACAGGAGATACTCTTTCTGAAT
CTGAATTGATTGAAATTAAAACTACTGCCCTCACCAAACCGCGACCACCA
TCAGCGACAAGTATTCCTgctattttaaaatctttgcaAGATGAGTGGGA
TGCAGTCATGTTGCATAGTTTCACACTGAGACAGCAATTGCAAGCTGCAA
GACAAGAATTATCACATGCACTTTACCAACATGATGCAGCGTGTCGTGTG
ATTGCCAGATTGACCAAAGAAGCCACTGCAGCTCGTGAAGCTTTGGCTAC
ACTCAAACCTCAAGCCGGCGTCTCTCAACTTACATCAGCAACAACGAATG
TTTCTAGTGGTAATAAGGTTGATGACATGGACATTGTGGAACCTGCGGAA
ATCGGAATGTCTGAAGAAGTCCTTCAAAAACTCCAAGATAAGGCAACCGT
CTTGACAAGTGAAAGGAAGAAGAGAGGTAAAAAACCACCAGAGGATCTGA
CACCCATCGAAGACATCAAATCATTCAAACAAGTTGCCTCTCATCCCGGT
CTCCATAGTGCCAGTGTTCCTGGAATATTGGCTCTTGACCTTCAAGACAG
TGATCCATCAAAATGCATTACAGGTGGTGTTGACAAAAACGCTGTTGTTT
TCAACAAAGATAATGAACAGGTTGTGGCAACACTCCGCGGACATACCAAG
AAAGTTACATCAGTCATTTACCATCCATATGAAgaaATCGGTATTACTGC
TTCAGCTGACAACACAGTTCGTGTCTGGAGCATACCTAACAGCTCTTGTG
CCTACACCATCCGAGCTCACGATGCGGCTGTTACTGGTTTGAGTTTACAC
GCTACAGGTGACTACGTTCTGACATCCTCCATTGACCAGCACTGGGCTTT
CTCCGACATCCAAACTGGCAAAGTTTTGATCAAGAGCATTTCAGACCCAA
ATGCCAGTCATGGTTTGACATGCGCACAATTCCATCCTGACGGTTTGATC
TTTGGTACTGGAACTACCGACAGCTCTATCAAGATTTGGGATTTGAAAGA
ACGAAAATATGTTGCCAGTTTCCCGGGACACTCAGGACCGATTACAGCTA
ttgacttttctgaaaatggATACTACTTGGCCACAAGCGCTGATGATTCA
GTGGTCAAACTTTGGGATTTACGAAAATTGAAGAACTTCAAAACAATTCC
TTTAGATGAGAATGACGAGATCAAATCATTGAGCTTCGACAAAAGTGGAA
ATTATTTGGCTGTTGCTGGCTCAAACATCCAaatTTACGTTGTCAAACAA
TGGGACCTTCTGAGACAAATTAATGATCACACCGGGTTGGTCACTTCAGT
CAAGTTTggaaaaaatgctgatttcttGGCATCTGCCAGTATGGACCGAA
CCTTGAAATACTTTTCACGGTAGATGGCGCTCGTCTGTTCAATAAGCGGT
GAAGTACCAGAGAACCCTGTTGTATCACCTGTATCAAACCAAGTCTTTGA
ACGACGActaattgaaaaatttatttctgaGAATGGAACTGATCCTGTGA
CAGGAGATACTCTTTCTGAATCTGAATTGATTGAAATTAAAACTACTGCC
CTCACCAAACCGCGACCACCATCAGCGACAAGTATTCCTgctattttaaa
atctttgcaAGATGAGTGGGATGCAGTCATGTTGCATAGTTTCACACTGA
GACAGCAATTGCAAGCTGCAAGACAAGAATTATCACATGCACTTTACCAA
CATGATGCAGCGTGTCGTGTGATTGCCAGATTGACCAAAGAAGCCACTGC
AGCTCGTGAAGCTTTGGCTACACTCAAACCTCAAGCCGGCGTCTCTCAAC
TTACATCAGCAACAACGAATGTTTCTAGTGGTAATAAGGTTGATGACATG
GACATTGTGGAACCTGCGGAAATCGGAATGTCTGAAGAAGTCCTTCAAAA
ACTCCAAGATAAGGCAACCGTCTTGACAAGTGAAAGGAAGAAGAGAGGTA
AAAAACCACCAGAGGATCTGACACCCATCGAAGACATCAAATCATTCAAA
CAAGTTGCCTCTCATCCCGGTCTCCATAGTGCCAGTGTTCCTGGAATATT
GGCTCTTGACCTTCAAGACAGTGATCCATCAAAATGCATTACAGGTGGTG
TTGACAAAAACGCTGTTGTTTTCAACAAAGATAATGAACAGGTTGTGGCA
ACACTCCGCGGACATACCAAGAAAGTTACATCAGTCATTTACCATCCATA
TGAAgaaATCGGTATTACTGCTTCAGCTGACAACACAGTTCGTGTCTGGA
GCATACCTAACAGCTCTTGTGCCTACACCATCCGAGCTCACGATGCGGCT
GTTACTGGTTTGAGTTTACACGCTACAGGTGACTACGTTCTGACATCCTC
CATTGACCAGCACTGGGCTTTCTCCGACATCCAAACTGGCAAAGTTTTGA
TCAAGAGCATTTCAGACCCAAATGCCAGTCATGGTTTGACATGCGCACAA
TTCCATCCTGACGGTTTGATCTTTGGTACTGGAACTACCGACAGCTCTAT
CAAGATTTGGGATTTGAAAGAACGAAAATATGTTGCCAGTTTCCCGGGAC
ACTCAGGACCGATTACAGCTAttgacttttctgaaaatggATACTACTTG
GCCACAAGCGCTGATGATTCAGTGGTCAAACTTTGGGATTTACGAAAATT
GAAGAACTTCAAAACAATTCCTTTAGATGAGAATGACGAGATCAAATCAT
TGAGCTTCGACAAAAGTGGAAATTATTTGGCTGTTGCTGGCTCAAACATC
CAaatTTACGTTGTCAAACAATGGGACCTTCTGAGACAAATTAATGATCA
CACCGGGTTGGTCACTTCAGTCAAGTTTggaaaaaatgctgatttcttGG
CATCTGCCAGTATGGACCGAACCTTGAAATACTTTTCACGGTAGATGGCG
CTCGTCTGTTCAATAAGCGGTGAAGTACCAGAGAACCCTGTTGTATCACC
TGTATCAAACCAAGTCTTTGAACGACGActaattgaaaaatttatttctg
aGAATGGAACTGATCCTGTGACAGGAGATACTCTTTCTGAATCTGAATTG
ATTGAAATTAAAACTACTGCCCTCACCAAACCGCGACCACCATCAGCGAC
AAGTATTCCTgctattttaaaatctttgcaAGATGAGTGGGATGCAGTCA
TGTTGCATAGTTTCACACTGAGACAGCAATTGCAAGCTGCAAGACAAGAA
TTATCACATGCACTTTACCAACATGATGCAGCGTGTCGTGTGATTGCCAG
ATTGACCAAAGAAGCCACTGCAGCTCGTGAAGCTTTGGCTACACTCAAAC
CTCAAGCCGGCGTCTCTCAACTTACATCAGCAACAACGAATGTTTCTAGT
GGTAATAAGGTTGATGACATGGACATTGTGGAACCTGCGGAAATCGGAAT
GTCTGAAGAAGTCCTTCAAAAACTCCAAGATAAGGCAACCGTCTTGACAA
GTGAAAGGAAGAAGAGAGGTAAAAAACCACCAGAGGATCTGACACCCATC
GAAGACATCAAATCATTCAAACAAGTTGCCTCTCATCCCGGTCTCCATAG
TGCCAGTGTTCCTGGAATATTGGCTCTTGACCTTCAAGACAGTGATCCAT
CAAAATGCATTACAGGTGGTGTTGACAAAAACGCTGTTGTTTTCAACAAA
GATAATGAACAGGTTGTGGCAACACTCCGCGGACATACCAAGAAAGTTAC
ATCAGTCATTTACCATCCATATGAAgaaATCGGTATTACTGCTTCAGCTG
ACAACACAGTTCGTGTCTGGAGCATACCTAACAGCTCTTGTGCCTACACC
ATCCGAGCTCACGATGCGGCTGTTACTGGTTTGAGTTTACACGCTACAGG
TGACTACGTTCTGACATCCTCCATTGACCAGCACTGGGCTTTCTCCGACA
TCCAAACTGGCAAAGTTTTGATCAAGAGCATTTCAGACCCAAATGCCAGT
CATGGTTTGACATGCGCACAATTCCATCCTGACGGTTTGATCTTTGGTAC
TGGAACTACCGACAGCTCTATCAAGATTTGGGATTTGAAAGAACGAAAAT
ATGTTGCCAGTTTCCCGGGACACTCAGGACCGATTACAGCTAttgacttt
tctgaaaatggATACTACTTGGCCACAAGCGCTGATGATTCAGTGGTCAA
ACTTTGGGATTTACGAAAATTGAAGAACTTCAAAACAATTCCTTTAGATG
AGAATGACGAGATCAAATCATTGAGCTTCGACAAAAGTGGAAATTATTTG
GCTGTTGCTGGCTCAAACATCCAaatTTACGTTGTCAAACAATGGGACCT
TCTGAGACAAATTAATGATCACACCGGGTTGGTCACTTCAGTCAAGTTTg
gaaaaaatgctgatttcttGGCATCTGCCAGTATGGACCGAACCTTGAAA
TACTTTTCACGGTAGATGGCGCTCGTCTGTTCAATAAGCGGTGAAGTACC
AGAGAACCCTGTTGTATCACCTGTATCAAACCAAGTCTTTGAACGACGAc
taattgaaaaatttatttctgaGAATGGAACTGATCCTGTGACAGGAGAT
ACTCTTTCTGAATCTGAATTGATTGAAATTAAAACTACTGCCCTCACCAA
ACCGCGACCACCATCAGCGACAAGTATTCCTgctattttaaaatctttgc
aAGATGAGTGGGATGCAGTCATGTTGCATAGTTTCACACTGAGACAGCAA
TTGCAAGCTGCAAGACAAGAATTATCACATGCACTTTACCAACATGATGC
AGCGTGTCGTGTGATTGCCAGATTGACCAAAGAAGCCACTGCAGCTCGTG
AAGCTTTGGCTACACTCAAACCTCAAGCCGGCGTCTCTCAACTTACATCA
GCAACAACGAATGTTTCTAGTGGTAATAAGGTTGATGACATGGACATTGT
GGAACCTGCGGAAATCGGAATGTCTGAAGAAGTCCTTCAAAAACTCCAAG
ATAAGGCAACCGTCTTGACAAGTGAAAGGAAGAAGAGAGGTAAAAAACCA
CCAGAGGATCTGACACCCATCGAAGACATCAAATCATTCAAACAAGTTGC
CTCTCATCCCGGTCTCCATAGTGCCAGTGTTCCTGGAATATTGGCTCTTG
ACCTTCAAGACAGTGATCCATCAAAATGCATTACAGGTGGTGTTGACAAA
AACGCTGTTGTTTTCAACAAAGATAATGAACAGGTTGTGGCAACACTCCG
CGGACATACCAAGAAAGTTACATCAGTCATTTACCATCCATATGAAgaaA
TCGGTATTACTGCTTCAGCTGACAACACAGTTCGTGTCTGGAGCATACCT
AACAGCTCTTGTGCCTACACCATCCGAGCTCACGATGCGGCTGTTACTGG
TTTGAGTTTACACGCTACAGGTGACTACGTTCTGACATCCTCCATTGACC
AGCACTGGGCTTTCTCCGACATCCAAACTGGCAAAGTTTTGATCAAGAGC
ATTTCAGACCCAAATGCCAGTCATGGTTTGACATGCGCACAATTCCATCC
TGACGGTTTGATCTTTGGTACTGGAACTACCGACAGCTCTATCAAGATTT
GGGATTTGAAAGAACGAAAATATGTTGCCAGTTTCCCGGGACACTCAGGA
CCGATTACAGCTAttgacttttctgaaaatggATACTACTTGGCCACAAG
CGCTGATGATTCAGTGGTCAAACTTTGGGATTTACGAAAATTGAAGAACT
TCAAAACAATTCCTTTAGATGAGAATGACGAGATCAAATCATTGAGCTTC
GACAAAAGTGGAAATTATTTGGCTGTTGCTGGCTCAAACATCCAaatTTA
CGTTGTCAAACAATGGGACCTTCTGAGACAAATTAATGATCACACCGGGT
TGGTCACTTCAGTCAAGTTTggaaaaaatgctgatttcttGGCATCTGCC
AGTATGGACCGAACCTTGAAATACTTTTCACGGTAGATGGCGCTCGTCTG
TTCAATAAGCGGTGAAGTACCAGAGAACCCTGTTGTATCACCTGTATCAA
ACCAAGTCTTTGAACGACGActaattgaaaaatttatttctgaGAATGGA
ACTGATCCTGTGACAGGAGATACTCTTTCTGAATCTGAATTGATTGAAAT
TAAAACTACTGCCCTCACCAAACCGCGACCACCATCAGCGACAAGTATTC
CTgctattttaaaatctttgcaAGATGAGTGGGATGCAGTCATGTTGCAT
AGTTTCACACTGAGACAGCAATTGCAAGCTGCAAGACAAGAATTATCACA
TGCACTTTACCAACATGATGCAGCGTGTCGTGTGATTGCCAGATTGACCA
AAGAAGCCACTGCAGCTCGTGAAGCTTTGGCTACACTCAAACCTCAAGCC
GGCGTCTCTCAACTTACATCAGCAACAACGAATGTTTCTAGTGGTAATAA
GGTTGATGACATGGACATTGTGGAACCTGCGGAAATCGGAATGTCTGAAG
AAGTCCTTCAAAAACTCCAAGATAAGGCAACCGTCTTGACAAGTGAAAGG
AAGAAGAGAGGTAAAAAACCACCAGAGGATCTGACACCCATCGAAGACAT
CAAATCATTCAAACAAGTTGCCTCTCATCCCGGTCTCCATAGTGCCAGTG
TTCCTGGAATATTGGCTCTTGACCTTCAAGACAGTGATCCATCAAAATGC
ATTACAGGTGGTGTTGACAAAAACGCTGTTGTTTTCAACAAAGATAATGA
ACAGGTTGTGGCAACACTCCGCGGACATACCAAGAAAGTTACATCAGTCA
TTTACCATCCATATGAAgaaATCGGTATTACTGCTTCAGCTGACAACACA
GTTCGTGTCTGGAGCATACCTAACAGCTCTTGTGCCTACACCATCCGAGC
TCACGATGCGGCTGTTACTGGTTTGAGTTTACACGCTACAGGTGACTACG
TTCTGACATCCTCCATTGACCAGCACTGGGCTTTCTCCGACATCCAAACT
GGCAAAGTTTTGATCAAGAGCATTTCAGACCCAAATGCCAGTCATGGTTT
GACATGCGCACAATTCCATCCTGACGGTTTGATCTTTGGTACTGGAACTA
CCGACAGCTCTATCAAGATTTGGGATTTGAAAGAACGAAAATATGTTGCC
AGTTTCCCGGGACACTCAGGACCGATTACAGCTAttgacttttctgaaaa
tggATACTACTTGGCCACAAGCGCTGATGATTCAGTGGTCAAACTTTGGG
ATTTACGAAAATTGAAGAACTTCAAAACAATTCCTTTAGATGAGAATGAC
GAGATCAAATCATTGAGCTTCGACAAAAGTGGAAATTATTTGGCTGTTGC
TGGCTCAAACATCCAaatTTACGTTGTCAAACAATGGGACCTTCTGAGAC
AAATTAATGATCACACCGGGTTGGTCACTTCAGTCAAGTTTggaaaaaat
gctgatttcttGGCATCTGCCAGTATGGACCGAACCTTGAAATACTTTTC
ACGGTAGATGGCGCTCGTCTGTTCAATAAGCGGTGAAGTACCAGAGAACC
CTGTTGTATCACCTGTATCAAACCAAGTCTTTGAACGACGActaattgaa
aaatttatttctgaGAATGGAACTGATCCTGTGACAGGAGATACTCTTTC
TGAATCTGAATTGATTGAAATTAAAACTACTGCCCTCACCAAACCGCGAC
CACCATCAGCGACAAGTATTCCTgctattttaaaatctttgcaAGATGAG
TGGGATGCAGTCATGTTGCATAGTTTCACACTGAGACAGCAATTGCAAGC
TGCAAGACAAGAATTATCACATGCACTTTACCAACATGATGCAGCGTGTC
GTGTGATTGCCAGATTGACCAAAGAAGCCACTGCAGCTCGTGAAGCTTTG
GCTACACTCAAACCTCAAGCCGGCGTCTCTCAACTTACATCAGCAACAAC
GAATGTTTCTAGTGGTAATAAGGTTGATGACATGGACATTGTGGAACCTG
CGGAAATCGGAATGTCTGAAGAAGTCCTTCAAAAACTCCAAGATAAGGCA
ACCGTCTTGACAAGTGAAAGGAAGAAGAGAGGTAAAAAACCACCAGAGGA
TCTGACACCCATCGAAGACATCAAATCATTCAAACAAGTTGCCTCTCATC
CCGGTCTCCATAGTGCCAGTGTTCCTGGAATATTGGCTCTTGACCTTCAA
GACAGTGATCCATCAAAATGCATTACAGGTGGTGTTGACAAAAACGCTGT
TGTTTTCAACAAAGATAATGAACAGGTTGTGGCAACACTCCGCGGACATA
CCAAGAAAGTTACATCAGTCATTTACCATCCATATGAAgaaATCGGTATT
ACTGCTTCAGCTGACAACACAGTTCGTGTCTGGAGCATACCTAACAGCTC
TTGTGCCTACACCATCCGAGCTCACGATGCGGCTGTTACTGGTTTGAGTT
TACACGCTACAGGTGACTACGTTCTGACATCCTCCATTGACCAGCACTGG
GCTTTCTCCGACATCCAAACTGGCAAAGTTTTGATCAAGAGCATTTCAGA
CCCAAATGCCAGTCATGGTTTGACATGCGCACAATTCCATCCTGACGGTT
TGATCTTTGGTACTGGAACTACCGACAGCTCTATCAAGATTTGGGATTTG
AAAGAACGAAAATATGTTGCCAGTTTCCCGGGACACTCAGGACCGATTAC
AGCTAttgacttttctgaaaatggATACTACTTGGCCACAAGCGCTGATG
ATTCAGTGGTCAAACTTTGGGATTTACGAAAATTGAAGAACTTCAAAACA
ATTCCTTTAGATGAGAATGACGAGATCAAATCATTGAGCTTCGACAAAAG
TGGAAATTATTTGGCTGTTGCTGGCTCAAACATCCAaatTTACGTTGTCA
AACAATGGGACCTTCTGAGACAAATTAATGATCACACCGGGTTGGTCACT
TCAGTCAAGTTTggaaaaaatgctgatttcttGGCATCTGCCAGTATGGA
CCGAACCTTGAAATACTTTTCACGGTAGATGGCGCTCGTCTGTTCAATAA
GCGGTGAAGTACCAGAGAACCCTGTTGTATCACCTGTATCAAACCAAGTC
TTTGAACGACGActaattgaaaaatttatttctgaGAATGGAACTGATCC
TGTGACAGGAGATACTCTTTCTGAATCTGAATTGATTGAAATTAAAACTA
CTGCCCTCACCAAACCGCGACCACCATCAGCGACAAGTATTCCTgctatt
ttaaaatctttgcaAGATGAGTGGGATGCAGTCATGTTGCATAGTTTCAC
ACTGAGACAGCAATTGCAAGCTGCAAGACAAGAATTATCACATGCACTTT
ACCAACATGATGCAGCGTGTCGTGTGATTGCCAGATTGACCAAAGAAGCC
ACTGCAGCTCGTGAAGCTTTGGCTACACTCAAACCTCAAGCCGGCGTCTC
TCAACTTACATCAGCAACAACGAATGTTTCTAGTGGTAATAAGGTTGATG
ACATGGACATTGTGGAACCTGCGGAAATCGGAATGTCTGAAGAAGTCCTT
CAAAAACTCCAAGATAAGGCAACCGTCTTGACAAGTGAAAGGAAGAAGAG
AGGTAAAAAACCACCAGAGGATCTGACACCCATCGAAGACATCAAATCAT
TCAAACAAGTTGCCTCTCATCCCGGTCTCCATAGTGCCAGTGTTCCTGGA
ATATTGGCTCTTGACCTTCAAGACAGTGATCCATCAAAATGCATTACAGG
TGGTGTTGACAAAAACGCTGTTGTTTTCAACAAAGATAATGAACAGGTTG
TGGCAACACTCCGCGGACATACCAAGAAAGTTACATCAGTCATTTACCAT
CCATATGAAgaaATCGGTATTACTGCTTCAGCTGACAACACAGTTCGTGT
CTGGAGCATACCTAACAGCTCTTGTGCCTACACCATCCGAGCTCACGATG
CGGCTGTTACTGGTTTGAGTTTACACGCTACAGGTGACTACGTTCTGACA
TCCTCCATTGACCAGCACTGGGCTTTCTCCGACATCCAAACTGGCAAAGT
TTTGATCAAGAGCATTTCAGACCCAAATGCCAGTCATGGTTTGACATGCG
CACAATTCCATCCTGACGGTTTGATCTTTGGTACTGGAACTACCGACAGC
TCTATCAAGATTTGGGATTTGAAAGAACGAAAATATGTTGCCAGTTTCCC
GGGACACTCAGGACCGATTACAGCTAttgacttttctgaaaatggATACT
ACTTGGCCACAAGCGCTGATGATTCAGTGGTCAAACTTTGGGATTTACGA
AAATTGAAGAACTTCAAAACAATTCCTTTAGATGAGAATGACGAGATCAA
ATCATTGAGCTTCGACAAAAGTGGAAATTATTTGGCTGTTGCTGGCTCAA
ACATCCAaatTTACGTTGTCAAACAATGGGACCTTCTGAGACAAATTAAT
GATCACACCGGGTTGGTCACTTCAGTCAAGTTTggaaaaaatgctgattt
cttGGCATCTGCCAGTATGGACCGAACCTTGAAATACTTTTCACGGTAGA
TGGCGCTCGTCTGTTCAATAAGCGGTGAAGTACCAGAGAACCCTGTTGTA
TCACCTGTATCAAACCAAGTCTTTGAACGACGActaattgaaaaatttat
ttctgaGAATGGAACTGATCCTGTGACAGGAGATACTCTTTCTGAATCTG
AATTGATTGAAATTAAAACTACTGCCCTCACCAAACCGCGACCACCATCA
GCGACAAGTATTCCTgctattttaaaatctttgcaAGATGAGTGGGATGC
AGTCATGTTGCATAGTTTCACACTGAGACAGCAATTGCAAGCTGCAAGAC
AAGAATTATCACATGCACTTTACCAACATGATGCAGCGTGTCGTGTGATT
GCCAGATTGACCAAAGAAGCCACTGCAGCTCGTGAAGCTTTGGCTACACT
CAAACCTCAAGCCGGCGTCTCTCAACTTACATCAGCAACAACGAATGTTT
CTAGTGGTAATAAGGTTGATGACATGGACATTGTGGAACCTGCGGAAATC
GGAATGTCTGAAGAAGTCCTTCAAAAACTCCAAGATAAGGCAACCGTCTT
GACAAGTGAAAGGAAGAAGAGAGGTAAAAAACCACCAGAGGATCTGACAC
CCATCGAAGACATCAAATCATTCAAACAAGTTGCCTCTCATCCCGGTCTC
CATAGTGCCAGTGTTCCTGGAATATTGGCTCTTGACCTTCAAGACAGTGA
TCCATCAAAATGCATTACAGGTGGTGTTGACAAAAACGCTGTTGTTTTCA
ACAAAGATAATGAACAGGTTGTGGCAACACTCCGCGGACATACCAAGAAA
GTTACATCAGTCATTTACCATCCATATGAAgaaATCGGTATTACTGCTTC
AGCTGACAACACAGTTCGTGTCTGGAGCATACCTAACAGCTCTTGTGCCT
ACACCATCCGAGCTCACGATGCGGCTGTTACTGGTTTGAGTTTACACGCT
ACAGGTGACTACGTTCTGACATCCTCCATTGACCAGCACTGGGCTTTCTC
CGACATCCAAACTGGCAAAGTTTTGATCAAGAGCATTTCAGACCCAAATG
CCAGTCATGGTTTGACATGCGCACAATTCCATCCTGACGGTTTGATCTTT
GGTACTGGAACTACCGACAGCTCTATCAAGATTTGGGATTTGAAAGAACG
AAAATATGTTGCCAGTTTCCCGGGACACTCAGGACCGATTACAGCTAttg
acttttctgaaaatggATACTACTTGGCCACAAGCGCTGATGATTCAGTG
GTCAAACTTTGGGATTTACGAAAATTGAAGAACTTCAAAACAATTCCTTT
AGATGAGAATGACGAGATCAAATCATTGAGCTTCGACAAAAGTGGAAATT
ATTTGGCTGTTGCTGGCTCAAACATCCAaatTTACGTTGTCAAACAATGG
GACCTTCTGAGACAAATTAATGATCACACCGGGTTGGTCACTTCAGTCAA
GTTTggaaaaaatgctgatttcttGGCATCTGCCAGTATGGACCGAACCT
TGAAATACTTTTCACGGTAGATGGCGCTCGTCTGTTCAATAAGCGGTGAA
GTACCAGAGAACCCTGTTGTATCACCTGTATCAAACCAAGTCTTTGAACG
ACGActaattgaaaaatttatttctgaGAATGGAACTGATCCTGTGACAG
GAGATACTCTTTCTGAATCTGAATTGATTGAAATTAAAACTACTGCCCTC
ACCAAACCGCGACCACCATCAGCGACAAGTATTCCTgctattttaaaatc
tttgcaAGATGAGTGGGATGCAGTCATGTTGCATAGTTTCACACTGAGAC
AGCAATTGCAAGCTGCAAGACAAGAATTATCACATGCACTTTACCAACAT
GATGCAGCGTGTCGTGTGATTGCCAGATTGACCAAAGAAGCCACTGCAGC
TCGTGAAGCTTTGGCTACACTCAAACCTCAAGCCGGCGTCTCTCAACTTA
CATCAGCAACAACGAATGTTTCTAGTGGTAATAAGGTTGATGACATGGAC
ATTGTGGAACCTGCGGAAATCGGAATGTCTGAAGAAGTCCTTCAAAAACT
CCAAGATAAGGCAACCGTCTTGACAAGTGAAAGGAAGAAGAGAGGTAAAA
AACCACCAGAGGATCTGACACCCATCGAAGACATCAAATCATTCAAACAA
GTTGCCTCTCATCCCGGTCTCCATAGTGCCAGTGTTCCTGGAATATTGGC
TCTTGACCTTCAAGACAGTGATCCATCAAAATGCATTACAGGTGGTGTTG
ACAAAAACGCTGTTGTTTTCAACAAAGATAATGAACAGGTTGTGGCAACA
CTCCGCGGACATACCAAGAAAGTTACATCAGTCATTTACCATCCATATGA
AgaaATCGGTATTACTGCTTCAGCTGACAACACAGTTCGTGTCTGGAGCA
TACCTAACAGCTCTTGTGCCTACACCATCCGAGCTCACGATGCGGCTGTT
ACTGGTTTGAGTTTACACGCTACAGGTGACTACGTTCTGACATCCTCCAT
TGACCAGCACTGGGCTTTCTCCGACATCCAAACTGGCAAAGTTTTGATCA
AGAGCATTTCAGACCCAAATGCCAGTCATGGTTTGACATGCGCACAATTC
CATCCTGACGGTTTGATCTTTGGTACTGGAACTACCGACAGCTCTATCAA
GATTTGGGATTTGAAAGAACGAAAATATGTTGCCAGTTTCCCGGGACACT
CAGGACCGATTACAGCTAttgacttttctgaaaatggATACTACTTGGCC
ACAAGCGCTGATGATTCAGTGGTCAAACTTTGGGATTTACGAAAATTGAA
GAACTTCAAAACAATTCCTTTAGATGAGAATGACGAGATCAAATCATTGA
GCTTCGACAAAAGTGGAAATTATTTGGCTGTTGCTGGCTCAAACATCCAa
atTTACGTTGTCAAACAATGGGACCTTCTGAGACAAATTAATGATCACAC
CGGGTTGGTCACTTCAGTCAAGTTTggaaaaaatgctgatttcttGGCAT
CTGCCAGTATGGACCGAACCTTGAAATACTTTTCACGGTAG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_045615XLOC_045615Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073491-exon-scaffold_93-1491911889:125485..125594TCONS_00073491-exon-scaffold_93-1491911889:125485..125594Clytia hemisphaericaexon
TCONS_00073491-exon-scaffold_93-1510915933:125485..125594TCONS_00073491-exon-scaffold_93-1510915933:125485..125594Clytia hemisphaericaexon
TCONS_00073491-exon-scaffold_93-1575043694:125485..125594TCONS_00073491-exon-scaffold_93-1575043694:125485..125594Clytia hemisphaericaexon
TCONS_00073491-exon-scaffold_93-1491911889:137732..137881TCONS_00073491-exon-scaffold_93-1491911889:137732..137881Clytia hemisphaericaexon
TCONS_00073491-exon-scaffold_93-1510915933:137732..137881TCONS_00073491-exon-scaffold_93-1510915933:137732..137881Clytia hemisphaericaexon
TCONS_00073491-exon-scaffold_93-1575043694:137732..137881TCONS_00073491-exon-scaffold_93-1575043694:137732..137881Clytia hemisphaericaexon
TCONS_00073491-exon-scaffold_93-1491911889:138140..138216TCONS_00073491-exon-scaffold_93-1491911889:138140..138216Clytia hemisphaericaexon
TCONS_00073491-exon-scaffold_93-1510915933:138140..138216TCONS_00073491-exon-scaffold_93-1510915933:138140..138216Clytia hemisphaericaexon
TCONS_00073491-exon-scaffold_93-1575043694:138140..138216TCONS_00073491-exon-scaffold_93-1575043694:138140..138216Clytia hemisphaericaexon
TCONS_00073491-exon-scaffold_93-1491911889:138412..138469TCONS_00073491-exon-scaffold_93-1491911889:138412..138469Clytia hemisphaericaexon
TCONS_00073491-exon-scaffold_93-1510915933:138412..138469TCONS_00073491-exon-scaffold_93-1510915933:138412..138469Clytia hemisphaericaexon
TCONS_00073491-exon-scaffold_93-1575043694:138412..138469TCONS_00073491-exon-scaffold_93-1575043694:138412..138469Clytia hemisphaericaexon
TCONS_00073491-exon-scaffold_93-1491911889:138654..138814TCONS_00073491-exon-scaffold_93-1491911889:138654..138814Clytia hemisphaericaexon
TCONS_00073491-exon-scaffold_93-1510915933:138654..138814TCONS_00073491-exon-scaffold_93-1510915933:138654..138814Clytia hemisphaericaexon
TCONS_00073491-exon-scaffold_93-1575043694:138654..138814TCONS_00073491-exon-scaffold_93-1575043694:138654..138814Clytia hemisphaericaexon
TCONS_00073491-exon-scaffold_93-1491911889:139084..139146TCONS_00073491-exon-scaffold_93-1491911889:139084..139146Clytia hemisphaericaexon
TCONS_00073491-exon-scaffold_93-1510915933:139084..139146TCONS_00073491-exon-scaffold_93-1510915933:139084..139146Clytia hemisphaericaexon
TCONS_00073491-exon-scaffold_93-1575043694:139084..139146TCONS_00073491-exon-scaffold_93-1575043694:139084..139146Clytia hemisphaericaexon
TCONS_00073491-exon-scaffold_93-1491911889:139302..139343TCONS_00073491-exon-scaffold_93-1491911889:139302..139343Clytia hemisphaericaexon
TCONS_00073491-exon-scaffold_93-1510915933:139302..139343TCONS_00073491-exon-scaffold_93-1510915933:139302..139343Clytia hemisphaericaexon
TCONS_00073491-exon-scaffold_93-1575043694:139302..139343TCONS_00073491-exon-scaffold_93-1575043694:139302..139343Clytia hemisphaericaexon
TCONS_00073491-exon-scaffold_93-1491911889:139641..139715TCONS_00073491-exon-scaffold_93-1491911889:139641..139715Clytia hemisphaericaexon
TCONS_00073491-exon-scaffold_93-1510915933:139641..139715TCONS_00073491-exon-scaffold_93-1510915933:139641..139715Clytia hemisphaericaexon
TCONS_00073491-exon-scaffold_93-1575043694:139641..139715TCONS_00073491-exon-scaffold_93-1575043694:139641..139715Clytia hemisphaericaexon
TCONS_00073491-exon-scaffold_93-1491911889:139931..140006TCONS_00073491-exon-scaffold_93-1491911889:139931..140006Clytia hemisphaericaexon
TCONS_00073491-exon-scaffold_93-1510915933:139931..140006TCONS_00073491-exon-scaffold_93-1510915933:139931..140006Clytia hemisphaericaexon
TCONS_00073491-exon-scaffold_93-1575043694:139931..140006TCONS_00073491-exon-scaffold_93-1575043694:139931..140006Clytia hemisphaericaexon
TCONS_00073491-exon-scaffold_93-1491911889:140185..140231TCONS_00073491-exon-scaffold_93-1491911889:140185..140231Clytia hemisphaericaexon
TCONS_00073491-exon-scaffold_93-1510915933:140185..140231TCONS_00073491-exon-scaffold_93-1510915933:140185..140231Clytia hemisphaericaexon
TCONS_00073491-exon-scaffold_93-1575043694:140185..140231TCONS_00073491-exon-scaffold_93-1575043694:140185..140231Clytia hemisphaericaexon
TCONS_00073491-exon-scaffold_93-1491911889:140417..140479TCONS_00073491-exon-scaffold_93-1491911889:140417..140479Clytia hemisphaericaexon
TCONS_00073491-exon-scaffold_93-1510915933:140417..140479TCONS_00073491-exon-scaffold_93-1510915933:140417..140479Clytia hemisphaericaexon
TCONS_00073491-exon-scaffold_93-1575043694:140417..140479TCONS_00073491-exon-scaffold_93-1575043694:140417..140479Clytia hemisphaericaexon
TCONS_00073491-exon-scaffold_93-1491911889:141889..141969TCONS_00073491-exon-scaffold_93-1491911889:141889..141969Clytia hemisphaericaexon
TCONS_00073491-exon-scaffold_93-1510915933:141889..141969TCONS_00073491-exon-scaffold_93-1510915933:141889..141969Clytia hemisphaericaexon
TCONS_00073491-exon-scaffold_93-1575043694:141889..141969TCONS_00073491-exon-scaffold_93-1575043694:141889..141969Clytia hemisphaericaexon
TCONS_00073491-exon-scaffold_93-1491911889:142138..142180TCONS_00073491-exon-scaffold_93-1491911889:142138..142180Clytia hemisphaericaexon
TCONS_00073491-exon-scaffold_93-1510915933:142138..142180TCONS_00073491-exon-scaffold_93-1510915933:142138..142180Clytia hemisphaericaexon
TCONS_00073491-exon-scaffold_93-1575043694:142138..142180TCONS_00073491-exon-scaffold_93-1575043694:142138..142180Clytia hemisphaericaexon
TCONS_00073491-exon-scaffold_93-1491911889:142515..142546TCONS_00073491-exon-scaffold_93-1491911889:142515..142546Clytia hemisphaericaexon
TCONS_00073491-exon-scaffold_93-1510915933:142515..142546TCONS_00073491-exon-scaffold_93-1510915933:142515..142546Clytia hemisphaericaexon
TCONS_00073491-exon-scaffold_93-1575043694:142515..142546TCONS_00073491-exon-scaffold_93-1575043694:142515..142546Clytia hemisphaericaexon
TCONS_00073491-exon-scaffold_93-1491911889:142864..142936TCONS_00073491-exon-scaffold_93-1491911889:142864..142936Clytia hemisphaericaexon
TCONS_00073491-exon-scaffold_93-1510915933:142864..142936TCONS_00073491-exon-scaffold_93-1510915933:142864..142936Clytia hemisphaericaexon
TCONS_00073491-exon-scaffold_93-1575043694:142864..142936TCONS_00073491-exon-scaffold_93-1575043694:142864..142936Clytia hemisphaericaexon
TCONS_00073491-exon-scaffold_93-1491911889:143259..143319TCONS_00073491-exon-scaffold_93-1491911889:143259..143319Clytia hemisphaericaexon
TCONS_00073491-exon-scaffold_93-1510915933:143259..143319TCONS_00073491-exon-scaffold_93-1510915933:143259..143319Clytia hemisphaericaexon
TCONS_00073491-exon-scaffold_93-1575043694:143259..143319TCONS_00073491-exon-scaffold_93-1575043694:143259..143319Clytia hemisphaericaexon
TCONS_00073491-exon-scaffold_93-1491911889:143549..143644TCONS_00073491-exon-scaffold_93-1491911889:143549..143644Clytia hemisphaericaexon
TCONS_00073491-exon-scaffold_93-1510915933:143549..143644TCONS_00073491-exon-scaffold_93-1510915933:143549..143644Clytia hemisphaericaexon
TCONS_00073491-exon-scaffold_93-1575043694:143549..143644TCONS_00073491-exon-scaffold_93-1575043694:143549..143644Clytia hemisphaericaexon
TCONS_00073491-exon-scaffold_93-1491911889:143862..143961TCONS_00073491-exon-scaffold_93-1491911889:143862..143961Clytia hemisphaericaexon
TCONS_00073491-exon-scaffold_93-1510915933:143862..143961TCONS_00073491-exon-scaffold_93-1510915933:143862..143961Clytia hemisphaericaexon
TCONS_00073491-exon-scaffold_93-1575043694:143862..143961TCONS_00073491-exon-scaffold_93-1575043694:143862..143961Clytia hemisphaericaexon
TCONS_00073491-exon-scaffold_93-1491911889:144307..144368TCONS_00073491-exon-scaffold_93-1491911889:144307..144368Clytia hemisphaericaexon
TCONS_00073491-exon-scaffold_93-1510915933:144307..144368TCONS_00073491-exon-scaffold_93-1510915933:144307..144368Clytia hemisphaericaexon
TCONS_00073491-exon-scaffold_93-1575043694:144307..144368TCONS_00073491-exon-scaffold_93-1575043694:144307..144368Clytia hemisphaericaexon
TCONS_00073491-exon-scaffold_93-1491911889:144592..144635TCONS_00073491-exon-scaffold_93-1491911889:144592..144635Clytia hemisphaericaexon
TCONS_00073491-exon-scaffold_93-1510915933:144592..144635TCONS_00073491-exon-scaffold_93-1510915933:144592..144635Clytia hemisphaericaexon
TCONS_00073491-exon-scaffold_93-1575043694:144592..144635TCONS_00073491-exon-scaffold_93-1575043694:144592..144635Clytia hemisphaericaexon
TCONS_00073491-exon-scaffold_93-1491911889:144881..145827TCONS_00073491-exon-scaffold_93-1491911889:144881..145827Clytia hemisphaericaexon
TCONS_00073491-exon-scaffold_93-1510915933:144881..145827TCONS_00073491-exon-scaffold_93-1510915933:144881..145827Clytia hemisphaericaexon
TCONS_00073491-exon-scaffold_93-1575043694:144881..145827TCONS_00073491-exon-scaffold_93-1575043694:144881..145827Clytia hemisphaericaexon
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073491-proteinTCONS_00073491-proteinClytia hemisphaericapolypeptide
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_93supercontigscaffold_93:125485..145827 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
153.947 148.678 301.576 300.769 366.03 293.657 209.853 220.657 144.159 160.541 156.831 148.053 158.471 166.456 118.618 139.296 146.221 142.066 50.4244 57.7424 100.164 105.625 99.3651 100.814 114.256 132.932 74.5043 70.2914 65.8857 64.2945
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR020472G-protein_beta_WD-40_rep
IPR001680WD40_repeat
IPR003613Ubox_domain
IPR013083Znf_RING/FYVE/PHD
IPR015943WD40/YVTN_repeat-like_dom
IPR013915Pre-mRNA_splic_Prp19
IPR019775WD40_repeat_CS
IPR017986WD40_repeat_dom
Vocabulary: Molecular Function
TermDefinition
GO:0005515protein binding
GO:0004842ubiquitin-protein transferase activity
Vocabulary: Biological Process
TermDefinition
GO:0016567protein ubiquitination
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0016567 protein ubiquitination
molecular_function GO:0005515 protein binding
molecular_function GO:0004842 ubiquitin-protein transferase activity
Blast
BLAST of TCONS_00073491 vs. Swiss-Prot (Human)
Match: PRP19 (Pre-mRNA-processing factor 19 OS=Homo sapiens GN=PRPF19 PE=1 SV=1)

HSP 1 Score: 628.246 bits (1619), Expect = 0.000e+0
Identity = 340/509 (66.80%), Postives = 416/509 (81.73%), Query Frame = 2
Query:   92 MALVCSISGXXXXXXXXXXXXXQVFERRLIEKFISENGTDPVTGDTLSESELIEIKTTALTKPRPPSATSIPAILKSLQDEWDAVMLHSFTXXXXXXXXXXELSHALYQHDAACRVIXXXXXXXXXXXXXXXXXXPQAGV----SQLTSATTNVSSGNKVDDMDIVEPAEIGMSEEVLQKLQDKATVLTSERKKRGKKPPEDLTPIEDIKSFKQVASHPGLHSASVPGILALDLQDSDPSKCITGGVDKNAVVFNKDNEQVVATLRGHTKKVTSVIYHPYEEIGITASADNTVRVWSIPNSSCAYTIRAHDAAVTGLSLHATGDYVLTSSIDQHWAFSDIQTGKVLIKSISDPNASHGLTCAQFHPDGLIFGTGTTDSSIKIWDLKERKYVASFPGHSGPITAIDFSENGYYLATSADDSVVKLWDLRKLKNFKTIPLDENDEIKSLSFDKSGNYLAVAGSNIQIYVVKQWDLLRQINDHTGLVTSVKFGKNADFLASASMDRTLKYFS 1606
            M+L+CSIS EVPE+P VSPVSN V+ERRLIEK+I+ENGTDP+    LSE +LI+IK     +P+PPSATSIPAILK+LQDEWDAVMLHSFTLRQQLQ  RQELSHALYQHDAACRVIARLTKE TAAREALATLKPQAG+    +  +S  + V +G  +D  ++V     GM+ E++QKLQDKATVLT+ERKKRGK  PE+L   E++  ++QVASH GLHSAS+PGILALDL  SD +K +TGG DKN VVF+K +EQ++ATL+GHTKKVTSV++HP +++  +AS D T+R+WS+PN+SC   +RAH++AVTGLSLHATGDY+L+SS DQ+WAFSDIQTG+VL K ++D  +   LTCAQFHPDGLIFGTGT DS IKIWDLKER  VA+FPGHSGPIT+I FSENGYYLAT+ADDS VKLWDLRKLKNFKT+ LD N E+KSL FD+SG YLA+ G+++QIY+ KQW  +    +H+GL T V FG +A F+AS  MDR+LK++S
Sbjct:    1 MSLICSISNEVPEHPCVSPVSNHVYERRLIEKYIAENGTDPINNQPLSEEQLIDIKVAHPIRPKPPSATSIPAILKALQDEWDAVMLHSFTLRQQLQTTRQELSHALYQHDAACRVIARLTKEVTAAREALATLKPQAGLIVPQAVPSSQPSVVGAGEPMDLGELV-----GMTPEIIQKLQDKATVLTTERKKRGKTVPEELVKPEELSKYRQVASHVGLHSASIPGILALDLCPSDTNKILTGGADKNVVVFDKSSEQILATLKGHTKKVTSVVFHPSQDLVFSASPDATIRIWSVPNASCVQVVRAHESAVTGLSLHATGDYLLSSSDDQYWAFSDIQTGRVLTK-VTDETSGCSLTCAQFHPDGLIFGTGTMDSQIKIWDLKERTNVANFPGHSGPITSIAFSENGYYLATAADDSSVKLWDLRKLKNFKTLQLDNNFEVKSLIFDQSGTYLALGGTDVQIYICKQWTEILHFTEHSGLTTGVAFGHHAKFIASTGMDRSLKFYS 503          
The following BLAST results are available for this feature:
BLAST of TCONS_00073491 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
PRP190.000e+066.80Pre-mRNA-processing factor 19 OS=Homo sapiens GN=P... [more]
back to top