Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00073488 (transcript) - C. hemisphaerica

Overview
NameTCONS_00073488
Unique NameTCONS_00073488
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1683

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00073488 ID=TCONS_00073488|Name=TCONS_00073488|organism=Clytia hemisphaerica|type=transcript|length=1683bp
TTTTACACCCACCGTTTCATCTATAAGAACGAGATAGGAGTTCCTTGGTG
TGGCGCTTGTTGGAGCTCATCTGACAAAAAGCAAACTATTGGTTCTGTCA
agcaaaaatcatTCGAAATTCGGACACGGGATGTTTTTATGGACAGGACA
TTTTGCAAACCATCGGACAGATATTGGTGATGATTATGACATTCAACATG
ATACTAAACTCACCCCTTTACCTACAGATAAATTCAAAGCAGTACCCAGT
CTTAATCGCGAGTTGACGGACGCAGTATCGTTCCAATATATCAAGCGCAA
TGGATGGTACATCACTTGTAAAAACAGATTGTGTCACATCGAACCGAAAC
GAAGGACTATGAATTTTGAGCGCCAAAGTTCCTTTTATCCATTGGTCAAT
TTATGGTATGACGGTTATACGGCGTTCGAATCGACAGTGAAGGCTGGTTT
CTATCTCCGTTGCAACCAACATCGTCTAGTGGTCGACCAATATGATGGAT
CGGAAATTTTTAAACAAGAAGCAAGCTTCAAAACACATAAAATCATTCAA
GgCTTTGAGAATGGTTCATGCAACGGTAACATATCTACGCATTCACCACT
GACGTCACTTCACGAAAATTTCCGTCACATGAACGGCGGTGACGGAGGAA
GAGGCGACATGTCGTCACTTACGTCATCACCGTTGCTATGTCCCTGTTGT
CATGGGAATAATACTATCCAATCAGATGGCGGATTCACTTTGAGTGTCAA
TTCACTGTATTCATTTAATGAATCGAACAGTGAGACAAACTTTGACGGAT
AAAGTTATCATTTACTCTCTTGGCGTTGGTACTCAATAAATAAAGTTAAG
TTCCCTAACTCGACCTCTGGCAGTAAATGTAATTTGTCtgaattgaagaa
aaaacaacaaaaagtatttattcGAGTTTTTCCTCTGAGTTTCTCCTTTA
TTGAGAACTGAAAACTACATTTGTTGTTCGGATTATAAAGATATTCGGAT
ACTAGGATCTACTTATACGAAATGCAAGTAAAAACTGACGAATCAACCTT
CCCCCCTTTTATTTTATTCGTTTTAATCAATTTAACGTTTTCGGGTTAAT
TCTTGGAATATCAAGCCCTAGCAAGAAATAAATTAAAGAGCCGATTTACA
CACCCCCTTCTTACAGACCCGCAggatttttttagccagtggCGGTAAAA
ATGACGGACTGAAACACAATGGAGATTgatattccaaaatttttttgcag
cgaggattggtttatttgattattttcagtggacaAAAATTGGGGGATAA
cttcccactggggacgatattttggccaaattttgcagtgggaagggttc
ccagtgggtctctgagaagggggtgtatttacaaaaattagttctcgcca
aaaatAAGATATCGCGTCACttcaaatagttttttttttgtcagagGACT
CAGACAAACGTCTCGTCCTTCCTTCACCCATGGTGAAGGGTATTATTATA
GAATCTCATATGAAAAAtaagatattattttttaaatctaaatttgtAAA
AACGTAAATGACTTTTATTTCGTAAAATATCTTTAACTCGTTATGTTTTA
TACACAACTTTAAAGAACTTTATTTCAGGATATTCCTCTTCGTTTCtatt
atacagttgacgctctctaattcgatcttcaag
Run BLAST on NCBI

protein sequence of TCONS_00073488-protein

>TCONS_00073488-protein ID=TCONS_00073488-protein|Name=TCONS_00073488-protein|organism=Clytia hemisphaerica|type=polypeptide|length=223bp
MFLWTGHFANHRTDIGDDYDIQHDTKLTPLPTDKFKAVPSLNRELTDAVS
FQYIKRNGWYITCKNRLCHIEPKRRTMNFERQSSFYPLVNLWYDGYTAFE
STVKAGFYLRCNQHRLVVDQYDGSEIFKQEASFKTHKIIQGFENGSCNGN
ISTHSPLTSLHENFRHMNGGDGGRGDMSSLTSSPLLCPCCHGNNTIQSDG
GFTLSVNSLYSFNESNSETNFDG
Run BLAST on NCBI

transcript from alignment at scaffold_93:50864..57589+

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00073488 ID=TCONS_00073488|Name=TCONS_00073488|organism=Clytia hemisphaerica|type=transcript|length=6726bp|location=Sequence derived from alignment at scaffold_93:50864..57589+ (Clytia hemisphaerica)
TTTTACACCCACCGTTTCATCTATAAGAACGAGATAGGGTAAGTAACAGC TTCCATTACTCTACTGAAAGATTAGCCATTTTTAAAGCACCTAAAATTCT AAATTGACCATTTATTTTTCAGcaagaatgaaaacaaaaagggAAGAAAG ATGGAAGAATAAGAAAAGATACGAGAGATACAATACACAATACGAAAGAT ATTTCAATAATTTATGAATTGGGACATTTGTGTTTGAATAATTTATACTT TCCCCCTATATACATACTTCTTTCCCCTATCTAAAATGATGTTCACAGCT TCATACTTAGTTATTTTTCTCTGTTTTTTCTGTCTTTGATTATGAACTCT TTGGGAAACTTAGTTGAGGTCTAAAGTTATGTCTCCCTCTCCCTTCACCT TTATTCTTCTGTTTTAGAGTTCCTTGGTGTGGCGCTTGTTGGAGCTCATC TGACAAAAAGCAAACTATTGGTTCTGTCAagcaagtaagtaagtataata tttttttgtcgttATCTCGTCTCATTTGACAAATGTGATCAATCTGTGTT TCTTCAAATTCCGATGCTTGTCTCCCTTCTCAATCAAGGGGCTTTGTATT TATTTCATTTACCCAGTACTCTTTCATTGCGGTAAGCGTTTTGGAAGCAC ATTTATCTACATTATCCACaattatttttcagaaatcatTCGAAATTCGG ACACGGGATGTTTTTATGGACAGGACATTTTGCAAACCATCGGACAGATA TTGGTGATGATTATGACATTCAACATGATACTAAACTCACCCCTTTACCT ACAGGTAACGACTACACGtcttttcataagaatatcctaaatttcggatg ttcttagctttttcagtttttaaagcctaaaaatgttcttaacatgttct tattttcaccattttgggATGTTTTTGAgttcacaaagccttaaaatgtt cttaacttgttcttaacatttttgccaacgaagccttatgttcttagata gtttgttcttataaaaaaacgtgcattgCTCATATTTACGGAGTATTAGT TTAGACTGGATACCCAGAGTCTCAAACAAAGGCCTAGACTAGACTAGAAG TTTAAgtagtttttaaagaaaattaagCATTGGTGCACTACATCGTATCC ATGTACAGAAACTGTAAAATTTACATTCAGTGTGTCGGCTTCAAATAAAA TATGTTATAAATTGAATTGTATCATCGATTTATAGATGTTATTAAAATTG TGTATTGAATTTACTTAAAACCTCATTGTCAGCGTCTTTTGTATTTCAAC ATTTCAAACGAAGAAATGGATAAATTAAAATGAAGTTAAACAGGAGCGTC ACGACCCATAGATGGTTCACACGACGGTTCAACGGAAAGTTCCTTTGGTG TTATAATTATCGTAAAGTTTAATAGGTTCGAGGCTAACAATACCCAGTAA GGGCTGCTAGTATTAGACTATTATGAGCTCAATTTTAAACAGCTTGTTCA AAACGCCCTGTCACTATTTATCGGTGTGCAAGGGTGTACAATCGGTGTAT TAAGAACTTCTTCGTGACCGACTTCTTCGTTGGCTATAATATTAAAACAA GTTAACAACAgcttaaggctttgcggaccctAAAACACCTATTTCCTTAG GAATGaacaaaatactcacaaaatgacgaaaataaggacatcttaagaac atttttagccttaaaattcaaaaagttaagaaaatccgtAGGctctaaaa attttggatgttgttATCAAATAAAACGTGTGGGTACACGTTTAGAATTA TTCTTCATGGAGTGAGATTTAGcttatttcttgatttttcgtttttgttg ACAGATAAATTCAAAGCAGTACCCAGTCTTAATCGCGAGTTGACGGACGC AGTATCGTTCCAATATATCAAGCGCAATGGATGGTACATCACTTGTAAAA ACAGATTGTGTCACATCGAACCGAAACGAAGGACTATGAATTTTGGTGAG ACATTCTTTCTtctaaattactctctgtaatccGAATAGAATCTTTCTAT AAGTCCGGGAAAAGGAGACATCTAAAATATCTTCGATTGCCGGGTAtatc attttgatattttgattctCTCTATACGATCTTCAAGTgactaaaaattt aattctcaattatagaaagattctattcggattacagagagtaatttata cCACTCTTCAGCTGAgtggaccaatattttagttcaaaTCAACAGAAAGA ATCGAATAATAGAGGCTCAAAGTAGAGAAACTTGACTGTATATAAAACTT TGAATCTTTTGAAATCACGGTTAAAGTAATGGCCGGAAATTCTTTGGATC TTTTTTTCGTTTGCGTACAGATGCGTTTTTCGCATTTTTTACAGGATAAA TTGTGCTTGCTTACTCATCTTGTTACAGAGcgttttttcgtattttttac AGTTTATAATTCTTCTTAATCATATATTTTCATTCCATTTTGTTACACAt acacacgcaacaaccttctactcagaatcatgttcgaacccGATACTTTT TTattgggacaccctgtagaataGAGTATTTATGTAATCTGTGGATGACC tctaaaaaccaatttttttgaaCTAATAGTTTTGTGATCATTTGAATTAT ATTGTCCCTATCAATTTTTTAACGGTTAATAATGACGTGTTATTATCACA TTATTTTCGCATAATCTCTTTTTTTGGCATTTCTTGTGTTGTTTTGTCGT TGTGTTGGCAACATCCCTTAATTAAGACCCCCTATAAAGCGTTAGTTTCC ATTTACACATCTTGAAATGACTTCTAAAATCACCACATTATTCTCTCCCA ATTTATGACTATTTTAACAAGTGACCATTTATTTCACGAATTCCTCCttc tagcccggggtccacttaagtgctctgaccatagtaaattttttaaattt ttttgtcatgtacaaaatatagatTTGTGCCTGATAcagccaacaaaact atggcattattatacattttctgttaggccaactatttctgaatctgaaa attattTGAATTATATTGCCCCTATGTTGCAATCGAAATTCTTTCTTCGC CACTTAAGAGTTTTTTTTAACGGTTAATAAATGACGTGCTATTATCACAT TATTTTCGAATGATCTCTTTTTTGGCATTTCTTGTGTTGTTTTGTCGTTG TGTTGGCAACATCCCTTAATTAAGATCCCCTTTAAAACATTAGTCTACAT TCACACACCTCGAAATGACCCCTAAATTACCACATTATTCTCTCACAATT TAACGTAAGACAATTATTTTGAAGGCAAATTTTTCGCAAATTCCTCTTTC TCTACCTAGCCTGGGGTCGACTTAAGGCTTTTCGAAAGACTCAACGCTAT CAAACATTATCAAAACACAATGTTCAATCAGAGGTAGACTCTATTCTACT CTTTCATAAGAAGATTACCTGTTAAAACCTTCGAACTTTTGTAATAAGGT GAAAACGTGttcaaaaagaatcaaattttagaaacaggAGCAAGGAAAAG CATAAAATTCTGTATTGCGAATTTTGGCTTCAATTATTCACTAGTGCGAA ACTTTTGTGAAAATGAGACCAAGATAGTGAAGAGAGCGATGAATAATGGC ATGCCAAAGTTTATACCTTAATTTATTAAGCGTTTTAACACCAAAGCAAA ATATTGGTCTGTGCGGAACTCAAGTttgtgaattttcaaatttctaacGA GCGCTTTCAAAGTGCTACTAAgggtttgaatattttttttgaccTCATTT TTCTAAATCAGGTATCACTTTCTGTAAAgctgactctctctaattcgatc ttcaaggaccaaggattcgaaaagtaaagtTCAAATTAGACAAAGTTGAC TGTATTTAATAACTTTTTACTAGAGCGCCAAAGTTCCTTTTATCCATTGG TCAATTTATGGTATGACGGTTATACGGCGTTCGAATCGACAGTGAAGGCT GGTTTCTATCTCCGTTGCAACCAACATCGTCTAGTGGTCGACCAATATGA TGGATCGGAAATTTTTAAACAAGAAGCAAGCTTCAAAACACATAAAATCA TTCAAGGTACAATGCCAGTTTCTCGTTTTTAAATTCAcgtttcaaattga aatatgtTAATCCGTGACACCCTGTCACCCTGTCCGATAAGAACTTTTCA TCCAAGGTACAATGCTAAAATTAGTGCCAAAATAGTGATATAATagcatt ttttaggttttttgtgAAATCCCCAATTCTCTAACTTCAATGGTTGGATT TGCTGTTTGGGTGTCTGCAGCCATTGAAATTGGGGTTTGAGGGACAGTGA AATCGAAGTTCTGAAAGTTGTTTTTCAAGGCCTACTGCCAACATATTACT GCACTGATTGTactttctcaaaattttaattGGCGTTTCAAATCGAAATA AGTTAATTCGTGAGACCCTGTCACCCTGTCCGATAAGAACTTTTCATCCA AGGTAAAATGCTAAAATTAGTGCCAAAATAGTGATATAAtagcatttttt agttttttgtgaAATCCCCAATTCTCTAACTTCAATGGTTGGATTTGCTG TTTGGGTGTCTGCAGCCATTGAAATTGGGGTTCGAGGGACAGTGAAATCG AAGCTCTGAAAGTTGTTTTTCAAGGCCTACTGCCAACATATTACTGCACT GATTGTactttctcaaaattttaagtGGCGTTTCAAATTGAAATAAGTTA ATTCGTGAGACCCTGTCACCCTGTCCGATAAGAACTTTTCATCCAAGGTA CAATGCTAAAATTAGTGCCAAAATAGTGATATAAtagcattttttagttt ttttgtgaAATCCCCAATTCTCTAACTTCAATGGTTGGATTTGCTGTTTG GGTGTCTGCAGCCATTGACATTGGGGGTTGAGGGGGAGTAAAATCGAAGT TCTGAAAGTAGTTTTTCAAGGCCTACTGCCAACATATTACTGCACTGATT GTAgtttctcaaatttttaattGGTGTTCCAAATTGAACTAAGTCTCATT GACCCATTTACTACGATTTGAACTTTTCAATCAGATTGATTGAAACTTAA GGATTTAAATATTCACGAATAAAGTTAAAGTGGCGGACGCATCTCATAGT TAATTTCGTCACCCTAATAAATCTttatagctcctgaaataataaatctt tggaattatgataaattttatatgatttgATGCAGAATTTTCGGAAGATT ATTATAGTATGAAATCGCAAATGTAGaaaatcgattttttgaaaaatcaa aaattaaaatcataaatttgTCAAACCAGTTTTTAAATGCTTCTTTTAGA AAAGCATTGAGAAGTCAAGAACAGATATAgataaaaagatcaaaaaagcC ATAATACTTTTGAAACGAGAACTCGTTTTGACGGATTTACTAACAATCAC AAGTGCTGGGGCTCATTCGTATCAATATTTTTGCATTANATACTTTTGAA ACGAGAACTCGTTTTGACGGATGTACTAACAATCACAAGTGACCCCCAGC TCATTCGTATCAATATTATtgcattattttttttatcttttcaggCTTTG AGAATGGTTCATGCAACGGTAACATATCTACGCATTCACCACTGACGTCA CTTCACGAAAATTTCCGTCACATGAACGGCGGTGACGGAGGAAGAGGCGA CATGTCGTCACTTACGTCATCACCGTTGCTATGTCCCTGTTGTCATGGGA ATAATACTATCCAATCAGATGGCGGATTCACTTTGAGTGTCAATTCACTG TATTCATTTAATGAATCGAACAGTGAGACAAACTTTGACGGATAAAGTTA TCATTTACTCTCTTGGCGTTGGTACTCAATAAATAAAGTTAAGTTCCCTA ACTCGACCTCTGGCAGTAAATGTAATTTGTCtgaattgaagaaaaaacaa caaaaagtatttattcGAGTTTTTCCTCTGAGTTTCTCCTTTATTGAGAA CTGAAAACTACATTTGTTGTTCGGATTATAAAGATATTCGGATACTAGGA TCTACTTATACGAAATGCAAGTAAAAACTGACGAATCAACCTTCCCCCCT TTTATTTTATTCGTTTTAATCAATTTAACGTTTTCGGGTTAATTCTTGGA ATATCAAGCCCTAGCAAGAAATAAATTAAAGAGCCGATTTACACACCCCC TTCTTACAGACCCGCAggatttttttagccagtggCGGTAAAAATGACGG ACTGAAACACAATGGAGATTgatattccaaaatttttttgcagcgaggat tggtttatttgattattttcagtggacaAAAATTGGGGGATAActtccca ctggggacgatattttggccaaattttgcagtgggaagggttcccagtgg gtctctgagaagggggtgtatttacaaaaattagttctcgccaaaaatAA GATATCGCGTCACttcaaatagttttttttttgtcagagGACTCAGACAA ACGTCTCGTCCTTCCTTCACCCATGGTGAAGGGTATTATTATAGAATCTC ATATGAAAAAtaagatattattttttaaatctaaatttgtAAAAACGTAA ATGACTTTTATTTCGTAAAATATCTTTAACTCGTTATGTTTTATACACAA CTTTAAAGAACTTTATTTCAGGATATTCCTCTTCGTTTCtattatacagt tgacgctctctaattcgatcttcaag

Coding sequence (CDS) from alignment at scaffold_93:50864..57589+

>TCONS_00073488 ID=TCONS_00073488|Name=TCONS_00073488|organism=Clytia hemisphaerica|type=CDS|length=2688bp|location=Sequence derived from alignment at scaffold_93:50864..57589+ (Clytia hemisphaerica)
ATGTTTTTATGGACAGGACATTTTGCAAACCATCGGACAGATATTGGTGA
TGATTATGACATTCAACATGATACTAAACTCACCCCTTTACCTACAGATA
AATTCAAAGCAGTACCCAGTCTTAATCGCGAGTTGACGGACGCAGTATCG
TTCCAATATATCAAGCGCAATGGATGGTACATCACTTGTAAAAACAGATT
GTGTCACATCGAACCGAAACGAAGGACTATGAATTTTGAGCGCCAAAGTT
CCTTTTATCCATTGGTCAATTTATGGTATGACGGTTATACGGCGTTCGAA
TCGACAGTGAAGGCTGGTTTCTATCTCCGTTGCAACCAACATCGTCTAGT
GGTCGACCAATATGATGGATCGGAAATTTTTAAACAAGAAGCAAGCTTCA
AAACACATAAAATCATTCAAGgCTTTGAGAATGGTTCATGCAACGGTAAC
ATATCTACGCATTCACCACTGACGTCACTTCACGAAAATTTCCGTCACAT
GAACGGCGGTGACGGAGGAAGAGGCGACATGTCGTCACTTACGTCATCAC
CGTTGCTATGTCCCTGTTGTCATGGGAATAATACTATCCAATCAGATGGC
GGATTCACTTTGAGTGTCAATTCACTGTATTCATTTAATGAATCGAACAG
TGAGACAAACTTTGACGGATAAATGTTTTTATGGACAGGACATTTTGCAA
ACCATCGGACAGATATTGGTGATGATTATGACATTCAACATGATACTAAA
CTCACCCCTTTACCTACAGATAAATTCAAAGCAGTACCCAGTCTTAATCG
CGAGTTGACGGACGCAGTATCGTTCCAATATATCAAGCGCAATGGATGGT
ACATCACTTGTAAAAACAGATTGTGTCACATCGAACCGAAACGAAGGACT
ATGAATTTTGAGCGCCAAAGTTCCTTTTATCCATTGGTCAATTTATGGTA
TGACGGTTATACGGCGTTCGAATCGACAGTGAAGGCTGGTTTCTATCTCC
GTTGCAACCAACATCGTCTAGTGGTCGACCAATATGATGGATCGGAAATT
TTTAAACAAGAAGCAAGCTTCAAAACACATAAAATCATTCAAGgCTTTGA
GAATGGTTCATGCAACGGTAACATATCTACGCATTCACCACTGACGTCAC
TTCACGAAAATTTCCGTCACATGAACGGCGGTGACGGAGGAAGAGGCGAC
ATGTCGTCACTTACGTCATCACCGTTGCTATGTCCCTGTTGTCATGGGAA
TAATACTATCCAATCAGATGGCGGATTCACTTTGAGTGTCAATTCACTGT
ATTCATTTAATGAATCGAACAGTGAGACAAACTTTGACGGATAAATGTTT
TTATGGACAGGACATTTTGCAAACCATCGGACAGATATTGGTGATGATTA
TGACATTCAACATGATACTAAACTCACCCCTTTACCTACAGATAAATTCA
AAGCAGTACCCAGTCTTAATCGCGAGTTGACGGACGCAGTATCGTTCCAA
TATATCAAGCGCAATGGATGGTACATCACTTGTAAAAACAGATTGTGTCA
CATCGAACCGAAACGAAGGACTATGAATTTTGAGCGCCAAAGTTCCTTTT
ATCCATTGGTCAATTTATGGTATGACGGTTATACGGCGTTCGAATCGACA
GTGAAGGCTGGTTTCTATCTCCGTTGCAACCAACATCGTCTAGTGGTCGA
CCAATATGATGGATCGGAAATTTTTAAACAAGAAGCAAGCTTCAAAACAC
ATAAAATCATTCAAGgCTTTGAGAATGGTTCATGCAACGGTAACATATCT
ACGCATTCACCACTGACGTCACTTCACGAAAATTTCCGTCACATGAACGG
CGGTGACGGAGGAAGAGGCGACATGTCGTCACTTACGTCATCACCGTTGC
TATGTCCCTGTTGTCATGGGAATAATACTATCCAATCAGATGGCGGATTC
ACTTTGAGTGTCAATTCACTGTATTCATTTAATGAATCGAACAGTGAGAC
AAACTTTGACGGATAAATGTTTTTATGGACAGGACATTTTGCAAACCATC
GGACAGATATTGGTGATGATTATGACATTCAACATGATACTAAACTCACC
CCTTTACCTACAGATAAATTCAAAGCAGTACCCAGTCTTAATCGCGAGTT
GACGGACGCAGTATCGTTCCAATATATCAAGCGCAATGGATGGTACATCA
CTTGTAAAAACAGATTGTGTCACATCGAACCGAAACGAAGGACTATGAAT
TTTGAGCGCCAAAGTTCCTTTTATCCATTGGTCAATTTATGGTATGACGG
TTATACGGCGTTCGAATCGACAGTGAAGGCTGGTTTCTATCTCCGTTGCA
ACCAACATCGTCTAGTGGTCGACCAATATGATGGATCGGAAATTTTTAAA
CAAGAAGCAAGCTTCAAAACACATAAAATCATTCAAGgCTTTGAGAATGG
TTCATGCAACGGTAACATATCTACGCATTCACCACTGACGTCACTTCACG
AAAATTTCCGTCACATGAACGGCGGTGACGGAGGAAGAGGCGACATGTCG
TCACTTACGTCATCACCGTTGCTATGTCCCTGTTGTCATGGGAATAATAC
TATCCAATCAGATGGCGGATTCACTTTGAGTGTCAATTCACTGTATTCAT
TTAATGAATCGAACAGTGAGACAAACTTTGACGGATAA
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_045613XLOC_045613Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073488-exon-scaffold_93-1491911889:50864..50901TCONS_00073488-exon-scaffold_93-1491911889:50864..50901Clytia hemisphaericaexon
TCONS_00073488-exon-scaffold_93-1510915933:50864..50901TCONS_00073488-exon-scaffold_93-1510915933:50864..50901Clytia hemisphaericaexon
TCONS_00073488-exon-scaffold_93-1575043694:50864..50901TCONS_00073488-exon-scaffold_93-1575043694:50864..50901Clytia hemisphaericaexon
TCONS_00073488-exon-scaffold_93-1491911889:51281..51347TCONS_00073488-exon-scaffold_93-1491911889:51281..51347Clytia hemisphaericaexon
TCONS_00073488-exon-scaffold_93-1510915933:51281..51347TCONS_00073488-exon-scaffold_93-1510915933:51281..51347Clytia hemisphaericaexon
TCONS_00073488-exon-scaffold_93-1575043694:51281..51347TCONS_00073488-exon-scaffold_93-1575043694:51281..51347Clytia hemisphaericaexon
TCONS_00073488-exon-scaffold_93-1491911889:51546..51667TCONS_00073488-exon-scaffold_93-1491911889:51546..51667Clytia hemisphaericaexon
TCONS_00073488-exon-scaffold_93-1510915933:51546..51667TCONS_00073488-exon-scaffold_93-1510915933:51546..51667Clytia hemisphaericaexon
TCONS_00073488-exon-scaffold_93-1575043694:51546..51667TCONS_00073488-exon-scaffold_93-1575043694:51546..51667Clytia hemisphaericaexon
TCONS_00073488-exon-scaffold_93-1491911889:52718..52858TCONS_00073488-exon-scaffold_93-1491911889:52718..52858Clytia hemisphaericaexon
TCONS_00073488-exon-scaffold_93-1510915933:52718..52858TCONS_00073488-exon-scaffold_93-1510915933:52718..52858Clytia hemisphaericaexon
TCONS_00073488-exon-scaffold_93-1575043694:52718..52858TCONS_00073488-exon-scaffold_93-1575043694:52718..52858Clytia hemisphaericaexon
TCONS_00073488-exon-scaffold_93-1491911889:54787..54969TCONS_00073488-exon-scaffold_93-1491911889:54787..54969Clytia hemisphaericaexon
TCONS_00073488-exon-scaffold_93-1510915933:54787..54969TCONS_00073488-exon-scaffold_93-1510915933:54787..54969Clytia hemisphaericaexon
TCONS_00073488-exon-scaffold_93-1575043694:54787..54969TCONS_00073488-exon-scaffold_93-1575043694:54787..54969Clytia hemisphaericaexon
TCONS_00073488-exon-scaffold_93-1491911889:56458..57589TCONS_00073488-exon-scaffold_93-1491911889:56458..57589Clytia hemisphaericaexon
TCONS_00073488-exon-scaffold_93-1510915933:56458..57589TCONS_00073488-exon-scaffold_93-1510915933:56458..57589Clytia hemisphaericaexon
TCONS_00073488-exon-scaffold_93-1575043694:56458..57589TCONS_00073488-exon-scaffold_93-1575043694:56458..57589Clytia hemisphaericaexon
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073488-proteinTCONS_00073488-proteinClytia hemisphaericapolypeptide
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_93supercontigscaffold_93:50864..57589 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0 0 0.190869 0 0.250477 0.351825 2.52679 1.97945e-05 4.16184 3.01547 2.68477 1.51057 6.54449 6.73984 3.9537 2.20633 2.84987 3.74124 10.4344 9.74796 5.0823 7.6104 0.61959 3.32566 0.0680256 5.50724e-06 0 0 0 0.0755725
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR007934AbfB_ABD
Vocabulary: Biological Process
TermDefinition
GO:0046373L-arabinose metabolic process
Vocabulary: Molecular Function
TermDefinition
GO:0046556alpha-L-arabinofuranosidase activity
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0046373 L-arabinose metabolic process
molecular_function GO:0046556 alpha-L-arabinofuranosidase activity
Blast
The following BLAST results are available for this feature:
BLAST of TCONS_00073488 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 0
Match NameE-valueIdentityDescription
back to top