Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00073483 (transcript) - C. hemisphaerica

Overview
NameTCONS_00073483
Unique NameTCONS_00073483
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length2694

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00073483 ID=TCONS_00073483|Name=TCONS_00073483|organism=Clytia hemisphaerica|type=transcript|length=2694bp
AAAAAATGGAATGGCTAGCATTTTGTATAGTCCCTACAACACTGTAAGAT
ATAAAATAACACcagaaaaataccttaaaagtTATAAGTAGATATCAAGG
TTAGAAAACACTTTGAATATACCTGTAAAACTGTAAAACTTTTGGTCtgt
tggttttttttttggttttttttatcGGTTCTGCTTCTTTCTGACAGTAC
GGCACTGGCTGTTTGGACTTTCCAAATTATTCTGAGGCGCCATATCTTTA
AAATATTAGCATTACGTAATATTACGTTTTGATAGGCCAATCAAAATGCT
TCACAGGAATTCCGAGAACTGAAAAAACTGTTATAGCTGAGATGGCGCCT
TATAATTTCACATGTAAACAATATGGCGGAAATTCCTAACTGGAAAACCA
CAGGAAGACAAAAAGCAATTTGGGGATGATTCTTCGTGGATTTTGGAAGA
GATGGACTCTGCTTTTATTCTTTGTTATCGTTCTAATCATATTGATTTTC
CAGCTATCTCAGAATAAGGAAACTACTCCTGCCACTGTCAACTCAAAATT
TACATGGCTTCATTCTTTTAATACTTCATCCCTCAAACACTGTCGAAATT
CAAAGCAAGGACCAAACCTTATCACAGATGAAAAAGGGTATATATGTCGA
CTTCAAGATGTCCAATATAATGGATGTTGTAATAAAAAGTCAAACTTCAC
AGAACAGTATTCTTGTTTGAGTTGCCAAAACAACCGATGTTGTAAGGTTT
ATGAGAATTGCATCTCATGCTGCTTGCATCCGCATAAGAGAAAATTATTG
GAGTTGGTATTACAGCATGCGCAAACAGTACACAATCCGTTGTTGAGCTC
AGTGCAAGATAATTTCGAATTGTGTTTACATAAATGTCGAACATCTTCAA
CGTGTGCAATTCAGGATGTCAACGAACATTCAAGAAATTGGGTTGTTTTG
CATTCCAAGAAGAAACCACTCCGAACCTGTTGATCACTGATCTGGTGGCC
AATGAATTCACTTCTTCAGGGATACTTATTGACCAGTCCAAGGATCTAGA
GGCTTCCATTTTGAGCTTATTATGCAGATGTCTCACCAAAACTAAAGCCA
TGGGCTACACCATCTTTGGACTAACCAATCGTGGTCAATGCCATGCTGGT
AACCAGGAAACCAAACTAAACAAGCTTGCTAAAGATGGTAGATTTGCTCC
GCCTCTTGCATGTTCGAATACCAATAAAGGTTTATGCAACGTTTTAAATG
AAACGGAAAATTGTTTTGGCAAAGATATGCATTCATTTTATTATCAGGTC
ATGAAGACAGTCGATGGTCAATGGGGTTCTTGGTCCCTCTTCACGAAATG
TAATACGACGTGTGGAAAGGCTTTTAAAACGCGTCAACGATCGTGTGACC
AACCTAAACCTCTGTATGGGGGCAAGATGTGCCAAGGGCCTTCTGTTGAA
GTCCAAGAATGTCATTTGGGTGGATGTCCAAGAGACGGTGGATATACAAG
TTGGTCAACTTTCAGTTCATGCACTTTATCTTGCGGTGGAGGTGTTCAAA
GCAGAACACGTTCTTGCACTCAACCACCACCTTTGAATGGAGGGAAGAAA
TGCTCTGGTCCTTCCAGTGAAACCAAGGCTTGTAATACACAACCTTGCCC
AGCACCTTGGACTTGCCAACAGAAAACTACGCAATGGGATGTAGATGGAA
ATGGAGATGCTCGTTATTTCGATCGCCATCAATTGAAATGTCCTTCTGCA
ACCGCTATCAACCTCCTTCGTCTCGAACGAGATAGCACTCTCACCAAATA
TCGATTTGTATACAAGTGCTGTTCCATTGGAGCGACAGCATGCAACTCTA
CAAAATTGACACGCAACAGCTTTTCATATGATGGTACAGGGAGTGCGCGG
TATTTAGATCGCCAATATGTCGAGTGTAACAAGCATTTGATCTCTTCTTT
ACGTCTTGAAACCAATCTATTGAATTTCCAAGGTGACAAAATTCGTTATG
TCTACAACTGCTGTCAAGCACCCAATCAACACCGAACATGTTACTCGGCC
ATGACGAAATTCTCCGACGATGGAGGTGGCAGTGCCATTTATCTTGATCG
ACAAAAGATCGAATGTAACCGAGAATTTTCGTTGTCGGCATTTCGTCTGG
TGAGGGATACAAACACAATGAAACATTGGAGTTATAAATACACTTGTTGT
AAAACAACACCTAAGTCTTTGGTCAAAACTGTTGTTTAACACATCAATCC
TCTATGATATTTTATAATACATATGAAGAAGTAATTTTCTTGTTCTCATC
TTGAACCTTTATAACTCGATTGTCTACTAATAAACTTAACAAGTTTTCTA
TCTATTCCGGTTAGTTAACAAAAACTTATAAACCTTAATCCatgtttcga
attttcaatAACTCGAACATATTTCAcggttccccgtgcgtgttcgagtt
atgggaCTCAtctgtatttttttgtattctCTTGAAATTTCTCTCGAAAT
TTCTCTCGAGTGCGCTTCCAgtaattcttcatttttctttccatATGATT
TACTAAATTCTCATAACGAAAGACGATTGCACTGTATagttttttaagtt
tattttagGAACCTTAGAAAAATAGTCGAATATGATGACTCATAATGTAA
CTATTTTGATGATTTCCAAATGAATAATAAATTGTTCTAACCGT
Run BLAST on NCBI

transcript from alignment at scaffold_93:18647..33364+

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00073483 ID=TCONS_00073483|Name=TCONS_00073483|organism=Clytia hemisphaerica|type=transcript|length=14718bp|location=Sequence derived from alignment at scaffold_93:18647..33364+ (Clytia hemisphaerica)
AAAAAATGGAATGGCTAGCATTTTGTATAGTCCCTACAACACTGTAAGAT ATAAAATAACACcagaaaaataccttaaaagtTATAAGTAGATATCAAGG TTAGAAAACACTTTGAATATACCTGTAAAACTGTAAAACTTTTGGTCtgt tggttttttttttggttttttttatcGGTTCTGCTTCTTTCTGACAGTAC GGCACTGGCTGTTTGGACTTTCCAAATTATTCTGAGGCGCCATATCTTTA AAATATTAGCATTACGTAATATTACGTTTTGATAGGCCAATCAAAATGCT TCACAGGAATTCCGAGAACTGAAAAAACTGTTATAGCTGAGATGGCGCCT TATAATTTCACATGTAAACAATATGGCGGAAATTCCTAACTGGAAAACCA CAGGAAGACAAAAAGCAATTTGGGGATGATTCTTCGTGGATTTTGGAAGA GATGGACTCTGCTTTTATTCTTTGTTATCGTTCTAATCATATTGATTTTC CAGCTATCTCAGAATAAGGTAATTGTTTCTTTTAAAACAACTTGCTTGCT TGTGTGTTTTAAccttagttttttttttcattttatagctacactctttt cttttttatatatagAACCAGTACTACTTTTACCCTTTTACCCCTAACGA CCCCTAAgttgcttgaaattttcagactcaGCATTGTTGTTaaaacttgt tcttatttttttgacaattttcagcCACTTTGGCTCTCTTGGGGGAGCTT AGTCTGTATGtaaacttacaccacataagcaaaaatcccgcgagtatggt atttttgaccctgtttgaatttgtttacatttggtttgaattttgtGCCA AAAAAGCTGTTGATAAGGTTAGCAAATCAGGTTCGTGCACTTCCAATTGA AACAACATATCACGTGATTTCAGCAAatgtttaacagccaatagaattct gcgaaAAGAttatttggcatctacaaaaatacccagCTAACTCTTTTAAC GACCCTGGACACTGCCGTACATTGCACGGTGGAGTCCGGTGGGCGTCCGA TGGGTGTACGGTGGTATTTTAGGTTAGATCGAAAACACCGTACAACCCCA CCGTACAGAATCCCACCGTACACGGAATTGCCACCGTACGATTGTCCGGt ggatgtatgcatgctcacaAGGGTGTTGTGGTCAGTCGGAGTCAAGGAAA AATTTGTAATCTTTCCGAAAAATAATTTAGTTTGTGTGAGCACAGAACGC TAGTTCTATATCTCAAAAGAAGAAGCatgtgttttgaaaaagttcgaaac aaacaAAGCTGTGGTGAAAATATCTGGCGTCTAATCAGTAGACGTCGAAA AGCCGATAGTTACGCTGGGAATGAAGTTGATGAAATACTTTCCATTCGCT CGGCTTTTGTTTCGACATTCGaggagtttttcttttagtttttgaCNTTT TGTTTCGACATTCGaggagtttttcttttagtttttcttttagtttttga tCGTTCGGCGATTGAGGGAATCAGAGAAAACACGCACCTAGTCCGCCCTT ATTCCGCCTAAGGTGTATACAAGAAGGCCGCCTGACATATTTTGTACGGT GGGAATTCAGAAACCTGATCGACTTCccaccgtacaatgtacggcggtAT ATTTCGTGTACANGGCTTAACTTTAGTTTTTTTAGTATACCTTGCTTATT GGTAttaaaaatttcgcgattcgctATTTTTTTTCGAGGAAATGTATTTT GTGTGTATTAATTTAGCGATTGCcagtttttggaaatttttgcgTGTATT AGATTTCTTTGCAATTTACTAAATTTGGCATTCTCAAAAAGCGGGaataa agcaagaaaatgactgatttcgCTTGAAACTCAACGTATTAGGTGGAAAC ATaccaaaaatagtaacaaaactagtgacaaaatagtacacaagtgtttc aaccggtattccaacgaagccatattttggttggtACAGAAATTTCACCC GCTCAAAatccaaaacaacaaaatggtcaatctcactaaagcaaaacatt gcggccacggcatttccctggataaaaattctggtcacgtgaccatccgt gattttagaccaatgaaaacgcttcatatccccggattaaagttgtgtct acactaacacacgggaaatggctagaaaaagagagaaaaagagagaaaaa accgggggtcaaattaaatttttctcccttcttgcagCACATACAGTATG AAAggctttaagaggccatttatttaagaataAGGGGTGTTacatcataa ataaattatgtaagtaagtgatattttaagtaaaatgatcattaacaatt ttattttgaagtttgtttttaaaaacaaaacccccgtgctagatgatagt ctcattttcttaacttatggacccatttggaagtctttgtaatacagatc atttggcagtgtagttgcagcctacagtatacaagaattggaatctaaag tctgaagtcgtaactccttgccagtgaccctgcagagaaatttttagttg gcagacactgactttaggttggtttggaaatcgttttattttgaaatgta atcttcactttagatgaatactttaatttatttggattcatgaaaggttc aaggtttgtttactttttatttcaaattatctcattgaaaaacaaagatt tttgatagctatcagcgtgggcttggccgccattttgaatttcgatttct tTTCTTCTGTagtcggcaatttagaggttgttcgtaatacgcgatttggc ttacgcgtaacacttgtgagTAATTAAGTGTTACAAAtaagtattttcaa ttttcggcctattttgaaaatttttcgcgtgtatttaatttcacaatttt tattttttttagatttaaacagtattaaattttgcaaaatttgaccTAAA AAATTGCCATTACATACTAAATACCATTACAAATATggtatatatacgtt ttttgtttaatttttgtttgggaGAATGTGACAACCTATTATTGTCTCAG TTCTGCATATTAAATAGCTCCATCCATTCAGGCCAGAAATTATCCGCTCC GTATTAAGGAAACGAAACCCTAATACTGCGCAGGAAGATTCACAGTATTA TGTATTGCATGCTGCTAATTTGGGAGAATGCTAGAGTGCcaattttgaac aaaacttattTATAGGTAATGTCTAATTTCCCGCTTGTTTTAATTGACAT CCACTGAAGTGTGGAGTAATTATACTTAAGCCAGTATACATGGATTCTGT GAAAATGTACTCATTTGAGTGTACTTATTTTTTGAATGGTTCTTCTAGAC CTTTCCCTATTTAAGATATTatgttgaatatttttcaattttaatttcaa tttcaatatcttttataatagaaataataataacaaagctttacaggttt gcaggccacaGTGaggacacatgggcctctataaaccgcttgtacttttt acaataatctttttgaaatagagtttttttcgcgggctcccccggacttt ccattttgtgttgtctcctttgattttagcatttttttcggcttccttac accattctttgattatttgtctttcatttttggtcaaatcctctgtcact cggtaaggaaagccttttgcttttgttattgcttgcaacactgtgttcgt gtcctcttcgttcgtaaatttgactttgattggtcggtatctcgctttat cttctctttctttcgtaaatttcccAATCCACTGCGTCTCAGTAGTCTTT ATATTCCTCAGACAGAGCCGCCaaccaataattttgtcatggatAAATTC TACATCCTTGATTTTCGTTTCTTCTTCAGATTCATCTGTTGATTCATCTA TCCCATGAAAAATAAGGTTGCATGCTGTCGATCGAATCAGCTGCTCCTCC tgcttttctttttgaattgcatctccaatgtttttctcgatgtgtttgaa tgtgattttagcgtagctcattggtggtcttccctcttctttcttttcga tgatgTTTTCAATCTTCTTCTCAAGCGTGGTTTTTCTGGTGTcgatagtt tctttcatttcgttgaccataacattgacgtcttgtgctttcaaatggtt tatttcttcgtcctgcttttcattatattctcacaggctttaatttcgtt tttgaattctttaatttttaatgtttcatttgaattatacctttccatta cctgtggtgtgattttggtacagttttgACACTGGAAACTTCTTGATTTG TATGACAAGCATATCTGGATTTGGTAAAGTGGCAGTTCTGTACAAAGATA ATGGACTAAGCGGTGGCACTTCCTGTATTGTAGGGTATCTTTTGGtgcgt tttcttcatttatgatgcactttgacgggctgcaaaagtcgtttattgat ggtgatttttgatttttttcctggatttttttccgccatctttgtgcatt tttcagacGACAACCGTTCAGTTTTGTATTTGACGTCAGAATGAATATAT TAGTTAAGTTAAGTTAAGAATAGGATGGAAGATACAAGCCCATGAATAAA AATATCCCCAGAATGTACCAAAATGACTTTTCAGagatgttttaaaaata tatttttttgcgacatctttgtcaattttaggaatttttggaCCTTATTT CATAAATGACATATTTTTCCCTGATGATTCCAATGATATAGGTTTCGGGA GTAATTTGGGATGAAATATTCCAGAAAATCAAGATTTGCAGATTCTTTAA AAtggttttattttattaaattttcaaatttgaatttcaaagagTAGAAA AGTATGAagaattccaaaatttttgattttgggtGACATTAAAAGTGGAA TATTTCATCCTATCCACTCTTTCGGTGAATATATTGCTATTTTCTGAAAG ATACACTCTTTACTATTACACTTATGTAATTTTCATCCTTAAAATAATAT CCAttagtttttaaaacatttttttggacaacccgttttttatcaatatt tttggaatatctcatCCTTTTCTACTCCTTTCATCATTTTGCTTACATTT TCTAATAATTTATATGGTACACTATCTGAGAGTATAATTTCAAAAGGGAA TCTTTTATAGATAAGGAGTAATTAACTGTGGAATTTCTCATCCATCCGCA AATAAGAAAGCTCTCATCCTAGATTACTCCTAATTTTGTCCTTAAATTGT AGCTGTTCAACTCAACCAATTAAAGCCGgattaaaaaaatcgaaatattt catcatatctctttttctcaaaataaattgaaatactCATGTAAAAGTTT TCATTAAGAAAGGTTGTCTTAAATAGGAGATACCCAAAAAAGACAATTTG NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNtaagaaacaaatgactaattttaatagatcgtcaat atttgtgttctgaatgattgtttaatggtcacgtcacgtagatatcaatt ataaatgtgttaaatgcatatccaggtaggtccataaaagtatcacttgt tttgtcCTTAAATTGTAGCTGTTCAACTCATCCGATTAAAGCcagactga aaaaatctttttctctaaataaattgaaatactCATGTAAAAGCTTTCAT TAAGAAAGGATATCTTAAACAGGAGTTACCCAAAAAAGACAATTTAGTAC attctaaaaaaacatttatctaGACCAGTTATCCCACAACAcaactagga gaaaaaaaaagcataaaatgataTGAAGtattttatcaataaaagtaaaa aactaaaaatagtATGTGGGGAAAATAAGTTAAGCAAAATTTGTATATAA ATCAGAAAACTATAATAATTATTACTCAGTTTTTAAATCTTTCTTCAAAT GAGTAGAGAAAGCAGAAGGAGTACAATCATCTAATTTATAATGATTCCTA TAGTTCCAGAACTGAGGTCCATGGAACATTCATAGTGGGCAGAGAGCTTG ATCAAAGTTAAAAGTGgcaacattgtttttataattttttctagcgATCA TACAAAGTTCATAGCATAATTTACAGCCTGTAGACCAGAAAAGTCAGCTT TTTGGTGCCGATAAAAGTTATCCCTCacttataaaaaagtaaacatgAAT AAATGAGTGAAGTTTAGAAAAGTTATAGGTAGAACGATCAACTGCTTAAC ATCATCGACTTCTTTCTTTAGGAAACTACTCCTGCCACTGTCAACTCAAA ATTTACATGGCTTCATTCTTTTAATACTTCATCCCTCAAACACTGTCGAA ATTCAAAGCAAGGACCAAACCTTATCACAGATGAAAAAGGTAATAATAGA ATTTCTTTAATACTCTCACAATGACAACAATGATCTTATTTTGCTTTTTC AGCTATTCgggttttttatttatttgattaccTGTTAAAATAATGAAAGC TGAATTTCACaataaaagatagtatttttttacttaatttattagttttt taatcaaattcttcaatttttgacCTAAATACACGGTAATGTGATTTCCA AGTATTCCAAGGGTCAAGTGAATTCGAAACAACGAAAAACAATTTATTTA TCCATATGGGTATATATATATCAGGTCCTGATTCCACTTCCTAATGGACA CCATCAGTAGTGCAGCATATTAACAATTTATGCTCTCattatttgttctt ttttctGCAGGGTATATATGTCGACTTCAAGATGTCCAATATAATGGATG TTGTAATAAAAAGTCAAACTTCACAGAACAGTATTCTTGTTTGAGTTGCC AAAACAACCGATGTTGTAAGGTTTATGAGAATTGCATCTCATGCTGCTTG CATCCGCATAAGGTATAGAAAATAACTTTAACCTTATTTCGGTGTTTAAT AAGTATCTTGATGAAacagtaccttaagggaagaaattttcgtgaAACAa gtttttgcggaatttaattttgcggtttttgaCAATTCCGCAAAACACGA ATATTCTcgagatttaaaaaatcacctccaaaagttgttttttagggcaa aatagaccatattctaaataaaaaattctcttaaccgagaaattaaattc cgtgaaactgccgaattttgagctgtgagtAGCGAAATTagattccgcga aaatttcttccctcaagGTACCGTATTGAACAATTTGAATAAGTTGGTAT TAATAGCATTACAATCTCCAATCTACGGTCAATTATAATCAAAACTAGCC GTATGCacagcgtcgcacgctgcgtgtcccaatccagtgaATTACTACAC ATCTAAAAAAATCTAACGAAAGAAAGATAGGCGCCGattgatgatttgat tttgattataggaaataaaggagaaaaaagataacattgcattgcaattt ttaaccacaattaaataaatagcttagcaaaagtatattttagatCTTCT TAACCATCGTGGCTAGACATCGTGGTTAGACATTtaagggtgactttgaa agacttgaaAAGTtgtgaaagtgatagggagccgctattgtaaacagaaa gttttaaaacgCATCTGAATAAGcattctttaaaatgacaaaaagttttg ggaagaaggttgattttaacccatcaagctccaaactttgtgaatagaaa atagtatcttggggtctcaaagttagtctagtggtaggaaatctgcttaa ggtgcaaagagatgatggttcaacgccatgaagagaaggctttgtagagc tttgttagattttcgaaaactttttacaaaacgttgtaaacacacacgtt taagtgtattaatatatagattagagagacaatttcaaagtgaaagtttg aaagacaCTCTTGCTATACCCTTGAATGAAATAACTAATTTTACGCAAGC GGCTTACTGGTTCAAAAGAAtgcacattcttcaaaaagaccAAAGTTCAA ACCGGGACGAAGTATtatataaaaatcttttaaaaagttttgaaagtgat agggagccgctattgtaaacagaaagttttaaagagcatctgaataagca ttctttaaaatgacaaaaagttttgggaagcaggttgattttaacccatc aagctccaaactttgtgaatagaaaatagtattttggggtctcaaagtta gtctagtggtaggaaatctgcttaaggtgcaaagagatgatggttcaacg ccatgaagaggaggctttgtagaactttgttagattttcgaaaacttttt acaaaacgttgtgaACACACacatttaagcgtattaatatatagattgat ACTTTTAAACAAGGAACTTGTTTTAAACTACACATAGAAATATGAGGAAT GTCGCTGAAGACTGCAAAAGAAAcaactttaaaataatttaagtTCATAT TGAAACTTATTCTATCAATTTCTTTTGACAGAGAAAATTATTGGAGTTGG TATTACAGCATGCGCAAACAGTACACAATCCGTTGTTGAGCTCAGTGCAA GATAATTTCGAATTGTGTTTACATAAATGTCGAACATCTTCAACGGTAAG TAGTATAATTTGTTTCAATAACTTATGTCTTGATCAAGTGTCAACTTTGA TTTCTAGAGCCATGTTGCTCTAAAGCAGTTCAGTGCCCTCCTCTTATTGT AACAGCATAAATTTAAGTGAGAGAGGAAGTTAATCCCTAGTAAAACACCC TTcccacagacccagtaggattttttaagccagtggggtaaaaataacgg actgaaactcgatggggattgatattaccatattttttatggctggggat ttaaattccattgttttaaaTTTAGTGGAGATGTGGAAAATACCACCATT TACTATTTTGgttgattggtttatttgattattttcagtggggacaaaaa tttgagaacaatTTTCCGCTAAGTACGATAATTTAGCCATTTTTCTTctg tgggaaggggtcccataGGGTCTGTTAGAAGAGGGCGTATAGTAAAATCt atgaaatattttgatttacttcgtaaaaaaaatataaaatccaGTGCACT AAGGATTTTACATTGGTATGATATGAACGGTATGTCTTTTTTGTGACACC TTTAATCTACCATTTACAGAGCATTCGACAAGACAACACTTACCGAAATC TTCTTTACAAGTATTGTTTCGGAATGGAATCACCTCATATAACGCATGGT CGAAACAGATGAATTCTGGGGTGGTGTGATGGAATTAAGGCTAAAGAAAA AGGGAGGAGCGGAGGCTTTAATTTGTATGCTGTTGAGACCTGATTTTCAC TTTGATGTGGGTGACTTGCACGATCGATCGAAATAACCAGCTTCGAATCA ACGAATATGAAGAAACTAAatcaaattctgaaaatcgtAAAGAAGCACGA TAACACGGAAACCAACCATTTGAGGAGACTGGAAGTTTCTTACTACGAAT ACAATCCGAATGTTTAAACTATTTATAACCACCCGGCGAAGGAAACGATA GAGAGAACTATAAAATGTTCAACGAAACAACTTTTTTCTGAGCTACTCTC CCGCTTTCAAACATTCTTTTGAAGCTATTTTCGACACTGTAGCGTTTAAT AAGTGCAGCTCTGGAGGCTATACGGACATGGTTATTTAGAATTTGGATAT TCTAGAATACATATAACATTACGCAATGTTAAGTTGTTGGGAAAACAAGG AGGGTAAACAAtgagtcaactctctctaattcgaacctctattattcgaa tctttctctaattcgaactaaaacatcgGTCTCCTCAGCTGGGGAGTGGT ATGAATTTCTCTCTGTAatccgaatctttctctaattcaaagaaaatcgt tggtcccttgaagatcgaattagagagagagtcgGTTGTATCAAGCTCTG ctggaaaaagggaaaattccgCTTACGGATATTGCCAAGGAAAGTCACAA CGAACTGTTTTCATGAGAACATTTTATCCTTTATTGATGCGATTCAATTT TTATGCAAGGTTTCACCTCTTTCTGGGTTGATAATATGTAtggaaaaaat tttgatggttaaaaaaaacaagatattTTGAGCATTAGACATTGGCGTTC GAAAAGAAATAGCTCCAACAATACTGTTTTATGTTTACAAATTCTTGACT TCAAATGACGAACGACCCATTTGAGATGTTTTTTTAATCCATTCGTCCAA AgatattttgacttttcacAAGTACATTACATCTTGAGGCGGTTTTGTAA AATGATAACCTAATCCCTTTAAGAATTGTTTTGAATCAAAATACAGTTCT GTTTGCATCAAAGTCAATTAGCCTAAAAATACTATTTGAACTACTCTTTT AGTTGCGCAACTCTGTTATTTAGATTCAGTTTGGTATTAGCTGGACAGGC CAAAGGATGGCTTATTTTTCTTTAGGGatcttatttttgttaattcCATT TGTCGCAGCTTCAGGTAAAAGTTAAATTCCACTTATTAAATTCCGAACTT TTGGTATGTTTTTTCTTACTCTTGTTTATTTacgaaaatgtttttatttt caaattttcaggcccggcggaagcggggagactggagATTTCAGTCTCCC CACTCTTGAGCAAAATGAggttttttctcaaattcctagcgaattttatc gCATTTTTAGCCTTCAACCTCCTCACTTTTATTGTTGTTCCGCAGGGCCT GattttcatatttattttttccctgtAGTCTTCAGAAAATATTTAAACCG TTGCTAATACCGTTTGTTTTAtagtttcttttcaaaatttgtattcAAAT CACCGGTTCAatacattttttctttattcgATCATCAGTGTGCAATTCAG GATGTCAACGAACATTCAAGAAATTGGGTTGTTTTGCATTCCAAGAAGAA ACCACTCCGAACCTGTTGATCACTGATCTGGTGGCCAATGAATTCACTTC TTCAGGGATACTTATTGACCAGTCCAAGGATCTAGAGGCTTCCATTTTGA GGTAAAGATAAGATGCTACATCTTATAAAATACTGAATTGTTAGATTTAG CTTATTTTTAGCTATTTGTGATTTAGTCCATTTCGGTTAATGTTCACAGG TTTTTTGATATCATTGTCATTTTCCCGTTTTCCTTTTAGCTTATTATGCA GATGTCTCACCAAAACTAAAGCCATGGGCTACACCATCTTTGGACTAACC AATCGTGGTCAATGCCATGCTGGTAACCAGGAAACCAAACTAAACAAGCT TGCTAAAGATGGTAGATTTGCTCCGCCTCTTGCATGTTCGAATACCAATA AAGGTTTATGCAACGTTTTAAATGAAACGGAAAATTGTTTTGGCAAAGAT ATGCATTCATTTTATTATCAGGTCATGAAGACAGGTAACTTTTACCCCtg tacctttttttcatttgaacTATGTTAATCACTACTATATAGTTTTCTAA GAATGTAATATTGTTGAATTATTGCGTTTGTCCAAAAATAAGTCAAAAGG ATGGTGTATTCTTAATGACTCatgaccactgacctttatataccctggac aaagcttctcaatcccagccaagcaaaatctttgatcggtgttttttcaa aattggtaccctaatgtcgacactactcgatagcggtgtaaatgcattga gagcgctaggtctacttttcctcaaattcttttgatgatgtagcggcgtt agacgttaatttttagcattgcaatggcttctccttgggtaccaattcta aaaaaactccaatcaaagatggcagatattgcttggtccagggttatata aaggtcagtgctcaTGACTGAAAGGTTTGGGTGACGTCTTATCTTCAAGC AGATTCTGCGGCGCAATGCACTTATCCACTCTAAAGGCCATagctccgta agagaatctcCCAAGGTTGGCGCACCGCTTTGAACTTTTTGATCCAGTTT TGGGATAAATACTtaaaatgagcttttgagccAAAAACACGTCAATTATT AACagaaacattagaacccagtcgctttcggTTTCGTGTTTAAGTAAAAA GCGACTATTGAATGTTTTTGCTGAACAACTCAGGTCAGATCATCACAATC GCCATATTCCTTTAAAGCTGAGCGCGGTATGCGCCGATTGAacgatctgt tatgagattagaGGGGTAACGCCCAACTCTTTTGTTAAACTTCagacaag aaataaaaagtGTGATTTGATACCTTTAAAACATTCCAAAACTTATTGAT GTCGCTAAAAGATAAACCTTGCCGAAAGAAAGCTTCCCAAATATCCTTCA GTAGTAAAGTCTCATTTTATACATTTTCTTTACAGTCGATGGTCAATGGG GTTCTTGGTCCCTCTTCACGAAATGTAATACGACGTGTGGAAAGGCTTTT AAAACGCGTCAACGATCGTGTGACCAACCTAAACCTCTGTATGGGGGCAA GATGTGCCAAGGGCCTTCTGTTGAAGTCCAAGAATGTCATTTGGGTGGAT GTCCAAGTAAGTTAATACCGAATATAGCTCAGTGGGAGTTTAATAAATGG AGAATAAATGAACGGGTTGAATGACTACGAGAATATAAACCACCGGTCTG AGTCAGAATTTCAAATTCTACTcttcataactcaaaattttagtGTCTTC CAGTGTTTTTGGTGGTTCTCAACTTTTTAACCGTAGGCTAAGCTGCTTTG CTGTAAAAAATCTCTTCGTCAaagtttcgcgattttcgccTCATTGCCTC ATCCATTGCTTCGAGAAGCTATTTTCATATTCCAGCAATTGATTGTAATT GTTAATAGGTAGGGGGTTGATCTGCGCAAAGGTGGTTAGTATTCTTTAAA TTTGCACTCTTTAACACTTTATCATTCTTTCCAGGAGACGGTGGATATAC AAGTTGGTCAACTTTCAGTTCATGCACTTTATCTTGCGGTGGAGGTGTTC AAAGCAGAACACGTTCTTGCACTCAACCACCACCTTTGAATGGAGGGAAG AAATGCTCTGGTCCTTCCAGTGAAACCAAGGCTTGTAATACACAACCTTG CCCAGGTATTTCTACATaatattttttcagttttaattccgatcaaattt gaaatctgTGTTGTATAAAATGTATGAAAAGATTCTATCAATTTACAACA TTTATCCAAGCCAAATTCTTTCTATTTTATGCTAGTGGTTTCGTACCAGA AAGCCTTTAGGacaaaactttggaaaatctttttacCTAAAAAGCACATA AAGGTTTTTTGGAAAGCTGTGCCTTAAGCGTCAAATATTCTCCCTGTACT ACACTGCAACTTATCAAACTTTTTAGCACCTTGGACTTGCCAACAGAAAA CTACGCAATGGGATGTAGATGGAAATGGAGATGCTCGTTATTTCGATCGC CATCAATTGAAATGTCCTTCTGCAACCGCTATCAACCTCCTTCGTCTCGA ACGAGATAGCACTCTCACCAAATATCGATTTGTATACAAGTGCTGTTCCA TTGGAGCGACAGCATGCAACTCTACAAAATTGACACGCAACAGCTTTTCA TATGATGGTACAGGGAGTGCGCGGTATTTAGATCGCCAATATGTCGAGTG TAACAAGCATTTGATCTCTTCTTTACGTCTTGAAACCAATCTATTGAATT TCCAAGGTGACAAAATTCGTTATGTCTACAACTGCTGTCAAGCACCCAAT CAACACCGAACATGTTACTCGGCCATGACGAAATTCTCCGACGATGGAGG TGGCAGTGCCATTTATCTTGATCGACAAAAGATCGAATGTAACCGAGAAT TTTCGTTGTCGGCATTTCGTCTGGTGAGGGATACAAACACAATGAAACAT TGGAGTTATAAATACACTTGTTGTAAAACAACACCTAAGTCTTTGGTCAA AACTGTTGTTTAACACATCAATCCTCTATGATATTTTATAATACATATGA AGAAGTAATTTTCTTGTTCTCATCTTGAACCTTTATAACTCGATTGTCTA CTAATAAACTTAACAAGTTTTCTATCTATTCCGGTTAGTTAACAAAAACT TATAAACCTTAATCCatgtttcgaattttcaatAACTCGAACATATTTCA cggttccccgtgcgtgttcgagttatgggaCTCAtctgtatttttttgta ttctCTTGAAATTTCTCTCGAAATTTCTCTCGAGTGCGCTTCCAgtaatt cttcatttttctttccatATGATTTACTAAATTCTCATAACGAAAGACGA TTGCACTGTATagttttttaagtttattttagGAACCTTAGAAAAATAGT CGAATATGATGACTCATAATGTAACTATTTTGATGATTTCCAAATGAATA ATAAATTGTTCTAACCGT
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_045611XLOC_045611Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073483-exon-scaffold_93-1491911889:18647..19164TCONS_00073483-exon-scaffold_93-1491911889:18647..19164Clytia hemisphaericaexon
TCONS_00073483-exon-scaffold_93-1510915933:18647..19164TCONS_00073483-exon-scaffold_93-1510915933:18647..19164Clytia hemisphaericaexon
TCONS_00073483-exon-scaffold_93-1575043694:18647..19164TCONS_00073483-exon-scaffold_93-1575043694:18647..19164Clytia hemisphaericaexon
TCONS_00073483-exon-scaffold_93-1491911889:25218..25335TCONS_00073483-exon-scaffold_93-1491911889:25218..25335Clytia hemisphaericaexon
TCONS_00073483-exon-scaffold_93-1510915933:25218..25335TCONS_00073483-exon-scaffold_93-1510915933:25218..25335Clytia hemisphaericaexon
TCONS_00073483-exon-scaffold_93-1575043694:25218..25335TCONS_00073483-exon-scaffold_93-1575043694:25218..25335Clytia hemisphaericaexon
TCONS_00073483-exon-scaffold_93-1491911889:25707..25858TCONS_00073483-exon-scaffold_93-1491911889:25707..25858Clytia hemisphaericaexon
TCONS_00073483-exon-scaffold_93-1510915933:25707..25858TCONS_00073483-exon-scaffold_93-1510915933:25707..25858Clytia hemisphaericaexon
TCONS_00073483-exon-scaffold_93-1575043694:25707..25858TCONS_00073483-exon-scaffold_93-1575043694:25707..25858Clytia hemisphaericaexon
TCONS_00073483-exon-scaffold_93-1491911889:27428..27541TCONS_00073483-exon-scaffold_93-1491911889:27428..27541Clytia hemisphaericaexon
TCONS_00073483-exon-scaffold_93-1510915933:27428..27541TCONS_00073483-exon-scaffold_93-1510915933:27428..27541Clytia hemisphaericaexon
TCONS_00073483-exon-scaffold_93-1575043694:27428..27541TCONS_00073483-exon-scaffold_93-1575043694:27428..27541Clytia hemisphaericaexon
TCONS_00073483-exon-scaffold_93-1491911889:29835..29997TCONS_00073483-exon-scaffold_93-1491911889:29835..29997Clytia hemisphaericaexon
TCONS_00073483-exon-scaffold_93-1510915933:29835..29997TCONS_00073483-exon-scaffold_93-1510915933:29835..29997Clytia hemisphaericaexon
TCONS_00073483-exon-scaffold_93-1575043694:29835..29997TCONS_00073483-exon-scaffold_93-1575043694:29835..29997Clytia hemisphaericaexon
TCONS_00073483-exon-scaffold_93-1491911889:30136..30380TCONS_00073483-exon-scaffold_93-1491911889:30136..30380Clytia hemisphaericaexon
TCONS_00073483-exon-scaffold_93-1510915933:30136..30380TCONS_00073483-exon-scaffold_93-1510915933:30136..30380Clytia hemisphaericaexon
TCONS_00073483-exon-scaffold_93-1575043694:30136..30380TCONS_00073483-exon-scaffold_93-1575043694:30136..30380Clytia hemisphaericaexon
TCONS_00073483-exon-scaffold_93-1491911889:31332..31502TCONS_00073483-exon-scaffold_93-1491911889:31332..31502Clytia hemisphaericaexon
TCONS_00073483-exon-scaffold_93-1510915933:31332..31502TCONS_00073483-exon-scaffold_93-1510915933:31332..31502Clytia hemisphaericaexon
TCONS_00073483-exon-scaffold_93-1575043694:31332..31502TCONS_00073483-exon-scaffold_93-1575043694:31332..31502Clytia hemisphaericaexon
TCONS_00073483-exon-scaffold_93-1491911889:31881..32051TCONS_00073483-exon-scaffold_93-1491911889:31881..32051Clytia hemisphaericaexon
TCONS_00073483-exon-scaffold_93-1510915933:31881..32051TCONS_00073483-exon-scaffold_93-1510915933:31881..32051Clytia hemisphaericaexon
TCONS_00073483-exon-scaffold_93-1575043694:31881..32051TCONS_00073483-exon-scaffold_93-1575043694:31881..32051Clytia hemisphaericaexon
TCONS_00073483-exon-scaffold_93-1491911889:32323..33364TCONS_00073483-exon-scaffold_93-1491911889:32323..33364Clytia hemisphaericaexon
TCONS_00073483-exon-scaffold_93-1510915933:32323..33364TCONS_00073483-exon-scaffold_93-1510915933:32323..33364Clytia hemisphaericaexon
TCONS_00073483-exon-scaffold_93-1575043694:32323..33364TCONS_00073483-exon-scaffold_93-1575043694:32323..33364Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_93supercontigscaffold_93:18647..33364 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0 0.0452686 0 0 0 0.0459146 0.0847533 0.0824031 0.062575 0 0.725167 0.979473 10.6452 22.4358 0 0.151864 0.0638924 0 17.4353 15.7584 0.127049 0 0 0.0875934 0 0 0 0 0 0
Blast
BLAST of TCONS_00073483 vs. Swiss-Prot (Human)
Match: SEM5A (Semaphorin-5A OS=Homo sapiens GN=SEMA5A PE=1 SV=3)

HSP 1 Score: 127.872 bits (320), Expect = 7.116e-30
Identity = 54/119 (45.38%), Postives = 78/119 (65.55%), Query Frame = 2
Query: 1307 TVDGQWGSWSLFTKCNTTCGKAFKTRQRSCDQPKPLYGGKMCQGPSVEVQECHLGGCPRDGGYTSWSTFSSCTLSCGGGVQSRTRSCTQPPPLNGGKKCSGPSSETKACNTQPCPAPWT 1663
            TV+G W +W+ +++C+  C +  + R+R C+ P+P YGG  C GPS+E QEC++  CP DG ++ WS ++ C+ +CGGG   RTRSC+ P P  GG  C G  +E   CNTQPCP  W+
Sbjct:  782 TVNGAWSAWTSWSQCSRDCSRGIRNRKRVCNNPEPKYGGMPCLGPSLEYQECNILPCPVDGVWSCWSPWTKCSATCGGGHYMRTRSCSNPAPAYGGDICLGLHTEEALCNTQPCPESWS 900          

HSP 2 Score: 105.145 bits (261), Expect = 6.401e-23
Identity = 68/192 (35.42%), Postives = 98/192 (51.04%), Query Frame = 2
Query: 1313 DGQWGSWSLFTKCNTTCGKAFKTRQRSCDQPKPLYGGKMCQGPSVEVQEC--HLGGCPRDGGYTSWSTFSSCTLSCGGGVQSRTRSCTQPPPLNGGKKCSGPSSETKACNTQPCPAPWTCQQKTTQW------DVDGNGDARYFDRHQLKCPSATA-INLLRLERDSTLTKYRFVYKCCSIGATACNSTKLT 1861
            +G W  W+ ++ C+TTCG  F+ RQRSC  P P +GG++C G + E + C  HL  CP    +T W  +  CT  CGGG+Q+R R C        G  C+G + E ++CNT PCP      +KTT W      ++  NG   Y  R +  C +  A  NLL + R     +Y     C S G + C++  L+
Sbjct:  595 NGGWTPWTSWSPCSTTCGIGFQVRQRSCSNPTPRHGGRVCVGQNREERYCNEHLL-CPPHMFWTGWGPWERCTAQCGGGIQARRRIC------ENGPDCAGCNVEYQSCNTNPCPE----LKKTTPWTPWTPVNISDNG-GHYEQRFRYTCKARLADPNLLEVGRQRIEMRY-----CSSDGTSGCSTDGLS 769          

HSP 3 Score: 99.7525 bits (247), Expect = 3.343e-21
Identity = 50/113 (44.25%), Postives = 68/113 (60.18%), Query Frame = 2
Query: 1307 TVDGQWGSWSLFTKCNTTCGKAFKT---RQRSCDQPKPLYGGKMCQGPSVEVQECHLGGCPRDGGYTSWSTFSSCTLSCGGGVQSRTRSCTQPPPLNGGKKCSGPSSETKACN 1636
            TVDG +G WS +T C  T G A  +   R RSCD P P  GG  C+GP +E+       C R+GG+T W+++S C+ +CG G Q R RSC+ P P +GG+ C G + E + CN
Sbjct:  538 TVDGHFGVWSPWTPCTHTDGSAVGSCLCRTRSCDSPAPQCGGWQCEGPGMEI-----ANCSRNGGWTPWTSWSPCSTTCGIGFQVRQRSCSNPTPRHGGRVCVGQNREERYCN 645          
The following BLAST results are available for this feature:
BLAST of TCONS_00073483 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
SEM5A7.116e-3045.38Semaphorin-5A OS=Homo sapiens GN=SEMA5A PE=1 SV=3[more]
back to top