Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00073469 (transcript) - C. hemisphaerica

Overview
NameTCONS_00073469
Unique NameTCONS_00073469
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length2585

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00073469 ID=TCONS_00073469|Name=TCONS_00073469|organism=Clytia hemisphaerica|type=transcript|length=2585bp
CTCTGAAGGAGGTCAATCATTTTACCATTATTTTGCACCACCTCTTCCAA
AGAATGTTATCATGTTTGCAACAAACAACAATTCAATCCAAGAACAGTTT
GAAGTGAGAGTTAGTATTGATCCCAGTGTAGAGGATAAGAAAATCGGCGA
ATTCTCAAGAGATAAAGATTGTTTTGTATGGAAAGTTGACTTGACAGAGG
AAGAAGTGGATGCAacaaataaagttttaaaaatggATCGATTACTTAAA
ATTAGTGTGACCAAACAAGGAGCTGATGAAGGATTCTCTTCTCAAGACAA
AGATGAAGAAGATTTAGTTTTTGATAACGACAATGATGATATcacagaat
ttgaaaaaagtttagaaaaattTGAAGACGACTTCAAGGAAAACCAATCA
GCCATCAAAACACTTCATAAAAAGGTTGCTTCTCTACCAACCAAATCATC
AACTAAAAAGAAAGTATCCGATTTCTTCAAACCtaaacaacagaaaaaaa
attctgatttcaaagctaaaacaataaCCAGTAAAGAAACTGTTCTGACA
GAAACTAAAGATAAAGTCAATGACTCTGATGGTGATAAAGAACAAAAGGG
AAAAAGACCACACCCATTTGTCGACTCCCCTGAATCTAAACCAAAGAAAG
CAATGATGCAAGCCAAACCTTCCAAAACACCAGAGATGGCTAAGAGAAGA
GTCATAAGGAAATCTGGGAAGTCACCAGCAGCTAAATTTTCTGATCTCAT
TTCTCATGAAAATCCTACAGGACGGTGGGGTCATGGATGCTGCAAGATTT
GTCATGATAAAGCAATAGTCATTGGTGGTCAAACCAAACAACAGATGAAT
ACTGATTCTATGTGGCTTCTTGACTTGAAAACCCGAAAATGGGAGTTACA
AAAGTCCGATAATTCTACAATTGATCGTCGTGTCGGACATAGTGTCGTAT
ATGACGAAAAAAGAAACCTCGTTTTTGTTTATGGTGGATCAAAACCGAAG
AAATGGTATAGTGATGTTTATTCACTGAATCTTGCCACTTTCGAATGGGA
AAAATCAGAGACCATTGGTAAAGCCCCAACAAGAGCTTATCACTCATGCA
ACAAATTTCACGACGAACTTTTTGTATTTGGGGGTGTTTACCCAAACCCT
GACCCTGACCCTGATGGTTGCAGCAATGAACTCGTCATTTATGATATTGC
AAATAAAAGTTGGTACACACCTATCATTAGCGGTGATATTCCGAATCCTC
GATCGGATCATTCAGCAGTGATGATTGGTTCCAAATTGTACATTTTCGGT
GGCTGGGATGCGCCGACCTGTCATGATGATATCTATTGTCTCGATATAGT
CATAATGAAGTATACGAGATTGAAACCTATTGGTGAAGGTCCGTCTGCCC
GTACTTGGCATTCCACCTCTGTTCTATCAAATCCAAATCAATTTTGTATT
TATGGTGGCTTCGATGGCAACGACAGTTTGAATGATCTTTTTGTTTTCGA
TTCAGTCAAAACGTGTTGGAGCAAGATACATAACGAGCATAATTCCATTT
TACGTGCTGGTCATACATCACTGTTGATGACGTCACCATATAgtgatgat
gacgtcacaaaagcCAACAACAAAAGTCAGGTGTTAATTTTCGGAGGCGG
TGATAACGCCGGACAATTTTATAACGATGTCATTCTACTGGATGTGAAAT
AGCAAAAGTGTCGTTTACTATATTTCgtgttttttaatattttttttttg
gtatttttatttaGTATGATTCTTATGTTTATCTCTTTTAGGCGAGATTA
GGTAAAGAATATTATCATTTAAGATTCTCCATATTTGTGGTAGTGTATAT
Agaattaaagggacataaaagtactgacgaaattagtaaacaaaccatat
gtggcgggatacaaaatcaaaacaaatgtcacatgtcaaaatcaaaaatc
aaaaNNNNNNNNNNNNNNNNNNNaaaatcaaaacaaatgtcacatgtcaa
aatcaaaaatcaaaacaaatatggctgattttgattgtttcaattgtttt
acaagtttgttttggacacgtgattttaattgttttctttaatgacacgt
ggtttgtgcaatgtttacattttactacttttatgtccctttaagcagGC
AGCAATTATGTGTGATTTCAGGAGTTCTATATGTGCTTTAACCTCCTTTC
AGAGAGATGAGTTAAATAccgaaattcatgatattcatgacgtaatgttt
tctacggaaagaccccggtttttgccagtagtggcacttttttacacctt
ttgtctagtttataagtgccactactggctaaaaccgaggtatttccgta
gaaaacattacgtcatgactATCAAGAAATTAATTCGTAAATGCATGCTC
CTCCCATGCTCCTCTGATCTTACGCGAATTGTATTCACGAATTTTGAATT
GAATGAACATTACttgcaaatttcttttcatatttTAATATATATTAAAA
CTTTAAATCCGAATGTGGTTTTAGAATGATCCAAAATTACTTATACTTTG
TATGACGTCCTGTTGTTATCTATTCATTATTTAAT
Run BLAST on NCBI

transcript from alignment at scaffold_92:259747..269892-

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00073469 ID=TCONS_00073469|Name=TCONS_00073469|organism=Clytia hemisphaerica|type=transcript|length=10146bp|location=Sequence derived from alignment at scaffold_92:259747..269892- (Clytia hemisphaerica)
CTCTGAAGGAGGTCAATCATTTTACCATTATTTTGCACCACCTCTTCCAA AGAATGTTATCATGTTTGCAACAAACAACAATTCAATCCAAGAACAGTTT GAAGTGAGAGTTAGTATTGATCCCAGTGTAGAGGATAAGAAAATCGGCGA ATTCTCAAGAGATAAAGATTGTTTTGTATGGAAAGTTGACTTGACAGAGG AAGAAGTGGATGCAACAAATAAAGTTTTAAAAATGGTATGGAAGGGTTTT TGTTCAAAGAAAGTCTTATAATTACTCCCTCAAGCAGCTTTAGAAGTTTT ATAAACAAAAAAGGAACCTTGTACATTCACACAAAATTTTTACATACTGC TTTTTGTTAACCTGTTTTTGTTGGACTGTAATAAGGGTTTTCAGAAAACC TGAACAAGGATCTATATTTCCTCCCATCTTAGCTTACAAAGTATAGTTAC AATAAAAAGTTTGCAATTTCTTCCTTTGATAACTTATTAACAATTTATTT TTTCTTAGGATCGATTACTTAAAATTAGTGTGACCAAACAAGGAGCTGAT GAAGGATTCTCTTCTCAAGACAAAGATGAAGAAGATTTAGTTTTTGATAA CGACAATGATGATATCACAGAATTTGAAAAAAGTTTAGAAAAATTTGAAG ACGACTTCAAGGAAAACCAATCAGCCATCAAAACACTTCATAAAAAGGTT GCTTCTCTACCAACCAAATCATCAACTAAAAAGAAAGTATCCGATTTCTT CAAACCTAAACAACAGAAAAAAAATTCTGATTTCAAAGCTAAAACAATAA CCAGTAAAGAAACTGTTCTGACAGAAACTAAAGATAAAGTCAATGACTCT GATGGTGATAAAGAACAAAAGGGAAAAAGACCACACCCATTTGTCGAGTT AGTACACTCTATATTCTTTTATGTTTCCATTAGACAACAGTCAGTTGACT TGGGTATCAATGAACTGAGAAGAGAGTAGAGAACTCAATATTATCCAAAA GTTACTTTAGGCATACAAACTTTCGCGGGCAGAAACTTTCGCGATGTCGA AAAATCGCGAAATGTTATTCGCGAGCATAAACTTTCGCAAATCGTTAGAT AAAAATGAGAATTTTCGAATAAAAATTGCCTTAAATTGAAAAATATTCAT TAAATCCACTAAAGACGATTGCTCTTCGATTTTAAAATGGCATTAAAGGA TAATAATATGCCTAAAATTTGATTTCTATTACGATTTCGAGGTTTTTTGA TTTTAAATTTTTTAAGAATATTTCGTGAGCATAAACTTTCGCGAATTGCC CTGTTAATAATTTTCAAAGACATTTACTTTCGCGAAAAAGGCCAAAGTTC GCGAAATTCGCGAAAGTTTCTGCTTGCGAAACTTTTTACGCCTAAAGTAA TGGCGATCTTGACACTTGTCAACATCCATGAATTATACGTTGTTAATCAC GCCTTAATTCATTCAGCTAAGTTTTTGTCTCGACAGCTCAAATTTAAAAA GTGTAATTATTTCACTAAAGACTGGTCTTAATGATGATTTGTTCTAGCTC CCCTGAATCTAAACCAAAGAAAGCAATGATGCAAGCCAAACCTTCCAAAA CACCAGAGATGGCTAAGAGAAGAGTCATAAGGAAATCTGGGAAGTCACCA GCAGCTAAATTTTCTGATCTCATTTCTCATGAAAGTAAGCATTTGAGAAA TTGCAATTATTGTTTTTGTTAACTGGTTGTTGTTTTTTTTATGCGGTCTG TACGAGATTTTTTTAAGCAATGGAATTGGATCTTTTCGCACGAGGACAGG CTTACACAGCCTGTCTGACAAAAAATCGACAGGAAAATGACACTTTCAAA TTTCTGCTTGATTGATTTAAAGAAGTTATTACATGTGCGTCAAAAGAAGG TAAATTGCATTGTCTTTAAATTGTCGACTTTCTGTCGTCTTTTGTCTAAA ATAAGGGAAGACTAAAAAATGCTTTCAAAACTTTGTATTCAACCTTACAG ATCCTACAGGACGGTGGGGTCATGGATGCTGCAAGATTTGTCATGATAAA GCAATAGTCATTGGTGGTCAAACCAAACAACAGATGAATACTGATTCTAT GTGGCTTCTTGACTTGAGTAAGTAGCATGAAGCAATAATTCAAAATATTG TTGTGGATCAATAGATTATTGTATTTTTTTGCTTGCCTTGATTCATCCCT GAGGTGATTTATTACCATGACAATTTCGTTTCCTCTTCTAAATTCCCTCG ATTAGATAAGGCTGTAACAATAACAAAGGTGCTTGAATTTGACTGAAAAA AGCAATTATAAAAAATTAAAAGTTCTTTTGGGGTTTTAATTATTTAAGTC AGGAGATAATATTATAAAGAAGTGGTATTTTATATTCATTATAGCCTTGT TTTTCACCGATAGACACATCAAAATCTCTAAAAATCGAGTAGTCTTCTAT TTAAAACCTTTTCAGAAACCCGAAAATGGGAGTTACAAAAGTCCGATAAT TCTACAATTGATCGTCGTGTCGGACATAGTGTCGTATATGACGAAAAAAG AAACCTCGTTTTTGTTTATGGTGGATCAAAACCGAAGAAATGGTATAGTG ATGTTTATTCACTGAATCTTGCCACTTTCGAATGGGAAAAATCAGAGGTA TATCTCTTTTTGATTCGAATCTATTATCAGCTCTTAAAAGCAGAACAAAT TAAGTATTGAATGGAGAGCTTCAGCTTAGGAGCTGTTTTAAAAATGGAGG CAAGCTGGCCCAGGTGAGATGGGATGGATAGCTAAAAAAATCATATTGTA TCATATTTCAATTTGATTTAGCATAAAGACATAATCCTGAAAATTTGAAG TCATTTTGTTAAAAATAAATCAAAGGATATTTCACTTTCATTTTCGGTCA GAGTGTGCAAACAGTACTTTTAAAAATCGTTTTGTGTGAAAACAAAATAG TTTTTTATTTGAAATTTTCACAGGTTTGCTTACGCACATTTCTACGTCAC AAATATCAATTTCGTAATTTTTCTAGAGATTTAATGTAGGTACTATTATA TTTCTAGACCATTGGTAAAGCCCCAACAAGAGCTTATCACTCATGCAACA AATTTCACGACGAACTTTTTGTATTTGGGGGTGTTTACCCAAACCCTGAC CCTGACCCTGATGGTTGCAGCAATGAACTCGTCATTTATGATATTGGTAT GTTTTTATATTTCATTAATACAAATTCATCATGTTTTCTGTTGTCATTCC CAAGGAAAATAAAAGATAAAAGAGGCTCTTCTATTGAGCCAAGGGCGGGT ATTTTAAGGTATCCTCAGAACATTTATATCGTGTACATCCTTAAAGTTTT TCGAGATAATTCGCAGAATACGGGCAAATAAAAAAAACCGTGTGTCTGAT TTTCAATCACTTCTTGTTTCTTACATTTTCCTACGAAAATTCACAAACTA TTTCCACAAAAATTTTCTTCTTGACATTTCAGCAAATAAAAGTTGGTACA CACCTATCATTAGCGGTGATATTCCGAATCCTCGATCGGAGTAAGTTCCT CACTCTAGATTTGACAGCATCTCGTCGATCTTTTAATAACACTCCTGTAC TGGTAAGAATGGAATTGTCTTTCATATGTGGGAATTCAGATTCTACCGTG GTTGATCTGGTATTTCGAGGTTTTTGGTTATTTTGCTTTCGGCAGCCGCC TTTTTAAGAGGCGGCCGCCAGTTATAATCCGCGGCCGCCTTTTACAAAGA GCGGCCGCCTTTTATGATAAGCGGCCACCTTTTTCCTTCGAAAAAGGAGA CCGCCCTTTATAACTGGCGCCCACTCTTTATAACAGGCGGCCGCCCTTTA AAAACGCGGCCGCTATTTATAAAGGGCGGCCACGTTTTTTAAAAGGCGGC CGCTTCTTTTACCGCCTTTTTCATAATCTGGTCTGTGAAATACAAGAGTC GTCAAAGTTAATCGCGTGGTAAGGATAGGATTAGAGTGTAAATATATATA CACAGTATAATATAATATACAATATACAGTACTGTACAGTACTGTAATCG AGATAATGTTTTTAGAGCCGAACATCAACTTGGGTGTGATTGACCTAGTC AAATCCTTCTCACCACACTCACCACATACATAAAATCACATGGGTAGCTA CCATGTTTGTTTATGTTTAGCCAATACATTTCACAGACCAGATTATGAAA AACGCGGTAAAAAACGCGGCCACCTTTTATAAAACGTGGCCGCCCTTTAT AACTGACGGCCGTCCTTTATAAATAGCGGCCGCGTTTTTAAAGGGCGGCC GCCTGTTATAAAGAGTGGCCGCCTTTTTCGAAGGAAAAGGGTGGCCGCTT ATTATAAAAGGCGGCCGCCAGTATTATAGGCGGTCGCTCTTTGTAAAAGG CGGCCGCGGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTCGAAATACCAG ATCAGCCACGGTAAGATTCTATTGCTTACCCAAAAGATTCAGTTGGGATT CTCAAAGCTTTAGGGTCAGTGAAGAGTAGCTTTCTAATGAAAGAGGGAGA TGGAATTTCAGGGTGTTTCTTAACGCCTGGGATTATTTCTTGAACTGTCC TGAACAGTAATTTTTCCGATAGGTAAATGTAAATGGTTCTGTGACATAGG GGTGTTGAATATTTTGGAGAATTATTTGCTGAATCTAAAAATGCTTTTTG GCATTAGCTGCTTTTCAGTCGTTTATTCATCTATCCAACGATGTAAAAAT AATAGANATTGAGCCAAGGGCGGGTATTTTAAGGTATCCTCAGAACATTT ATATCGTGTACATCCTTAAAGTTTTTCGAGATAATTCGCAGAATACGGAC AAATAAAAAAAACCGTGTGTCTGATTTTCAATCACTTCTTGTTTCTTACA TTTTCCTCCGAAAATTCACAAACTATTTTCCACAAAAATTTTCTTCTTGA CATTTCAGCAAATAAAAGTTGGTACACACCTATCATTAGCGGTGATATTC CGAATCCTCGATCGGGGTAAGTTCCTCACTCTAGATTTGACAACATCTCG TCGATCTTTTAATAACACTCCTGTACTGGTAAGAATGGAATTGTCTTTCA TATGTGGGAATTCAGATTCTACCGTGGCTGATCTGGTATTTCGAGGTTTT TGGTTATTTTGCTTTCGGCAGCCGCCTTTTTAAGAGGCGACCGCCAGTTT TAATCCGCGGCCGCCTTTTACAAAGAGCGGCTGCCTATAATACTGGCGGC CGCCTTTTATGATAAGCGGCCACCTTTTTCCTTCGAAGAAGGAGGCCGCC CTTTATTACGATGGCCCCTAAGGCTCACCACGCACTTCCAGTTCTTATAA AATTTGTGAACTAGAACTGTCTAGGGTCATGGCCCAGAAGGCTCACAAGA CACTGCGCACTTCCGAGTTTTTTTGTGACGACATTGCACACTTCTAAAAA TATTTTAGAAACGTAAAAGTCCCCCTCGAAAGATAGCCGTTCTGGTCAGC AAAATAGATACCGAGTTGTAATAAGTGAGTTGATGATAATAGCGAAGAGG CTCGGAAATCCCGAGTTATTTTCTTGAGTTCAAAAGCCGAGTTAGTTACG AAAAACCGAGTTATGACGTTATTTTTCGGAAATTTCGACGTCATTTTGTA CCTTCTATATGACGTCATTCTCAATTCTGTAGCTCGTTTTTTTTCCTTGC CTTTAAAATTTCGAGTTATCTCTGATGGTATCTAAACTCAAGTAAGTCCT GCCTTTAAATTTTCGAGTCATTTCTCGTTTTTTAACTCGGTTTTGTTTCT TTTAAATTTTCGAGTTATTTTCCTTCCTGTACATTCTCGGATTCTCGAAT TATTTTCACAGCAGAAGGCTCAAAACACACACACACACACACACTTCTAG TTTTCATGCACTTAGGGTGGTCCTATGGCGGAAAATACCAGCGGCGTGGA GGCAAAAAAACAAAGTTGATATTTGCTCACTTTTTGCTTCCCAGATTTTT GCCACTGGGGGGAATTTTGCAGACCAGGACTTAACTCAGAAATTTTAACC TGTAACTCTTGATATGAGCAACTCGGAAATTTTAACTCATTTTGCGTAAC TCGACATTCATTTTATAGACCAAAAAAAAAATTGATCGCGCGGGCCGCTC GCTTGGAAATTTCCCGCCCTGACAAAAAGTCAGAAGTGCGCAGTGTCACT TGAGCCTTCTGGGCCATTGACCATAGGCAGTTCTAGTTCACAAATTTTAT AAGAACTGGAAGTGCGTAAAAACTAGAAGTGCGTGTTTTGAGCCTTCTGG GCCATCGTACTAACGGATATAAGGTTGGTTCTTTCCGGACATCTCAGCAA ACCTTTGATAGCTGGTTTGCTATGAAGCCGCTGATATCGTTGTGCCTCAT TGATACGAAACCACCTTTTTTGCACGTCAGGGCATATTCGAGCGAGAACG GAGTTCCACATTTGCAATGGGAAGGTGTACGCTGTGTAATGCCCACCCGT AACGGATTCTGATTAGGTCAACGAAACATTGCTTGTTGAGAATGTATCCT TCGTTTTGAACAGGCAAAGTCGTGAGCCATGCTTAGGCTCTGTGTTGTCG ATTGAGCTCCATCAGCTGGACTTGATTTCTTTGGAGAGTCAGGTCGTTGT GAGGTGAAGAACGATGTTGCTATTTCGTTCCCTCTTTTCATTCTTGATTT TCTTTGTAGGCAGGCGAGGATCAAGTTTATATGCATATTCTTGGCTTACG ATTGTCTCGGATAGATTGGATGTGATGAGTAGTAGTAGTNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGATGTCAAAAA GTGTGTCAAAATCTAGCTAAAAGCATAACACGCACTGCACACAGAGCTTT TTAATAGAGTGCTCATTTCAATAGGAAAACAATGGTTGTTCTCTTGAGAG AAGTGCCTTCTAGAGGTAGTTGGTTATCTATTATTTTTACATCGTTGATC TATCTTTGTAGTCATTCAGCAGTGATGATTGGTTCCAAATTGTACATTTT CGGTGGCTGGGATGCGCCGACCTGTCATGATGATATCTATTGTCTCGATA TAGGTAAATTACAACATTTGTATATCCTTTCAACTCGTATCATTGTTTTC CTTCGGAGACAAATTTCCATTCATTTTCACCGCCTATGGAATAACAATAG GATCCCAAAAGAAAATCATCTCAACTGAAAAGACAACTAAAAAAACTTGT CTTTTAAACTTGTTGGCTATCGAAAAAGATCTTCAATTCATTATATGCAC CACTGCAATGACTTCACGAAATTATGCAACTTTTCTGTTTTTGTTCCACC CAATACGTCACTTTTTCTATTCTTAAAGTGACATATTGGATGGAAAATCT TAAAAGTTCTCAGAAGACTCTTCAGTGGTGCAAATCATGAATATTTTAAT AGAGTAGATATTCAATACTTTTATGCAATAAGTTCCATATTTTAATGCAA GATCATTTTAAAGCCAAGTATTTCTTCCCAGCGACGACTTTACTAAACAA CCACTTTAGTTTGGTCAAATTTAATCGTTTTAACTTTAACTTTCTCTTCA TAGTCATAATGAAGTATACGAGATTGAAACCTATTGGTGAAGGTCCGTCT GCCCGTACTTGGCATTCCACCTCTGTTCTATCAAATCCAAATCAATTTTG TATTTATGGTGGCTTCGATGGCAACGACAGTTTGAATGATCTTTTTGTTT TCGATTCAGGTAAACCGTGCCAAAAAAAGGCTAGGAAATTGAGCTTTTTT TTGACAGGAACTCGTCTTTTTTTACAAGGGAAAACACGTACTCAGGACTC GGGGTTCTGAGGCTGTTTGACTTTAGTCTTCTTTACCTGACTATACCAAA TTTATTTTGTGTTATTAATTTCGCATTGCGAAAGTATTACGATAGCCTTT CGCGGCGGCGGTGTCCTCGGAAAAAAAATTAGAAAACGAAAGTGCTTGAT ACGGTGGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNTTGTTTTGTTTTGAGATTACTTC TTTTCTTCTGTTTTAGTCAAAACGTGTTGGAGCAAGATACATAACGAGCA TAATTCCATTTTACGTGCTGGTCATACATCACTGTTGATGACGTCACCAT ATAGTGATGATGACGTCACAAAAGCCAACAACAAAAGTCAGGTGTTAATT TTCGGAGGCGGTGATAACGCCGGACAATTTTATAACGATGTCATTCTACT GGATGTGAAATAGCAAAAGTGTCGTTTACTATATTTCGTGTTTTTTAATA TTTTTTTTTTGGTATTTTTATTTAGTATGATTCTTATGTTTATCTCTTTT AGGCGAGATTAGGTAAAGAATATTATCATTTAAGATTCTCCATATTTGTG GTAGTGTATATAGAATTAAAGGGACATAAAAGTACTGACGAAATTAGTAA ACAAACCATATGTGGCGGGATACAAAATCAAAACAAATGTCACATGTCAA AATCAAAAATCAAAANNNNNNNNNNNNNNNNNNNAAAATCAAAACAAATG TCACATGTCAAAATCAAAAATCAAAACAAATATGGCTGATTTTGATTGTT TCAATTGTTTTACAAGTTTGTTTTGGACACGTGATTTTAATTGTTTTCTT TAATGACACGTGGTTTGTGCAATGTTTACATTTTACTACTTTTATGTCCC TTTAAGCAGGCAGCAATTATGTGTGATTTCAGGAGTTCTATATGTGCTTT AACCTCCTTTCAGAGAGATGAGTTAAATACCGAAATTCATGATATTCATG ACGTAATGTTTTCTACGGAAAGACCCCGGTTTTTGCCAGTAGTGGCACTT TTTTACACCTTTTGTCTAGTTTATAAGTGCCACTACTGGCTAAAACCGAG GTATTTCCGTAGAAAACATTACGTCATGACTATCAAGAAATTAATTCGTA AATGCATGCTCCTCCCATGCTCCTCTGATCTTACGCGAATTGTATTCACG AATTTTGAATTGAATGAACATTACTTGCAAATTTCTTTTCATATTTTAAT ATATATTAAAACTTTAAATCCGAATGTGGTTTTAGAATGATCCAAAATTA CTTATACTTTGTATGACGTCCTGTTGTTATCTATTCATTATTTAAT
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_045598XLOC_045598Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073469-exon-scaffold_92-1575043694:269658..269892TCONS_00073469-exon-scaffold_92-1575043694:269658..269892Clytia hemisphaericaexon
TCONS_00073469-exon-scaffold_92-1575043694:268996..269384TCONS_00073469-exon-scaffold_92-1575043694:268996..269384Clytia hemisphaericaexon
TCONS_00073469-exon-scaffold_92-1575043694:268209..268345TCONS_00073469-exon-scaffold_92-1575043694:268209..268345Clytia hemisphaericaexon
TCONS_00073469-exon-scaffold_92-1575043694:267776..267892TCONS_00073469-exon-scaffold_92-1575043694:267776..267892Clytia hemisphaericaexon
TCONS_00073469-exon-scaffold_92-1575043694:267246..267427TCONS_00073469-exon-scaffold_92-1575043694:267246..267427Clytia hemisphaericaexon
TCONS_00073469-exon-scaffold_92-1575043694:266697..266835TCONS_00073469-exon-scaffold_92-1575043694:266697..266835Clytia hemisphaericaexon
TCONS_00073469-exon-scaffold_92-1575043694:266353..266410TCONS_00073469-exon-scaffold_92-1575043694:266353..266410Clytia hemisphaericaexon
TCONS_00073469-exon-scaffold_92-1575043694:261840..261931TCONS_00073469-exon-scaffold_92-1575043694:261840..261931Clytia hemisphaericaexon
TCONS_00073469-exon-scaffold_92-1575043694:261184..261339TCONS_00073469-exon-scaffold_92-1575043694:261184..261339Clytia hemisphaericaexon
TCONS_00073469-exon-scaffold_92-1575043694:259747..260826TCONS_00073469-exon-scaffold_92-1575043694:259747..260826Clytia hemisphaericaexon
TCONS_00073469-exon-scaffold_92-1510915933:269658..269892TCONS_00073469-exon-scaffold_92-1510915933:269658..269892Clytia hemisphaericaexon
TCONS_00073469-exon-scaffold_92-1510915933:268996..269384TCONS_00073469-exon-scaffold_92-1510915933:268996..269384Clytia hemisphaericaexon
TCONS_00073469-exon-scaffold_92-1510915933:268209..268345TCONS_00073469-exon-scaffold_92-1510915933:268209..268345Clytia hemisphaericaexon
TCONS_00073469-exon-scaffold_92-1510915933:267776..267892TCONS_00073469-exon-scaffold_92-1510915933:267776..267892Clytia hemisphaericaexon
TCONS_00073469-exon-scaffold_92-1510915933:267246..267427TCONS_00073469-exon-scaffold_92-1510915933:267246..267427Clytia hemisphaericaexon
TCONS_00073469-exon-scaffold_92-1510915933:266697..266835TCONS_00073469-exon-scaffold_92-1510915933:266697..266835Clytia hemisphaericaexon
TCONS_00073469-exon-scaffold_92-1510915933:266353..266410TCONS_00073469-exon-scaffold_92-1510915933:266353..266410Clytia hemisphaericaexon
TCONS_00073469-exon-scaffold_92-1510915933:261840..261931TCONS_00073469-exon-scaffold_92-1510915933:261840..261931Clytia hemisphaericaexon
TCONS_00073469-exon-scaffold_92-1510915933:261184..261339TCONS_00073469-exon-scaffold_92-1510915933:261184..261339Clytia hemisphaericaexon
TCONS_00073469-exon-scaffold_92-1510915933:259747..260826TCONS_00073469-exon-scaffold_92-1510915933:259747..260826Clytia hemisphaericaexon
TCONS_00073469-exon-scaffold_92-1491911889:269658..269892TCONS_00073469-exon-scaffold_92-1491911889:269658..269892Clytia hemisphaericaexon
TCONS_00073469-exon-scaffold_92-1491911889:268996..269384TCONS_00073469-exon-scaffold_92-1491911889:268996..269384Clytia hemisphaericaexon
TCONS_00073469-exon-scaffold_92-1491911889:268209..268345TCONS_00073469-exon-scaffold_92-1491911889:268209..268345Clytia hemisphaericaexon
TCONS_00073469-exon-scaffold_92-1491911889:267776..267892TCONS_00073469-exon-scaffold_92-1491911889:267776..267892Clytia hemisphaericaexon
TCONS_00073469-exon-scaffold_92-1491911889:267246..267427TCONS_00073469-exon-scaffold_92-1491911889:267246..267427Clytia hemisphaericaexon
TCONS_00073469-exon-scaffold_92-1491911889:266697..266835TCONS_00073469-exon-scaffold_92-1491911889:266697..266835Clytia hemisphaericaexon
TCONS_00073469-exon-scaffold_92-1491911889:266353..266410TCONS_00073469-exon-scaffold_92-1491911889:266353..266410Clytia hemisphaericaexon
TCONS_00073469-exon-scaffold_92-1491911889:261840..261931TCONS_00073469-exon-scaffold_92-1491911889:261840..261931Clytia hemisphaericaexon
TCONS_00073469-exon-scaffold_92-1491911889:261184..261339TCONS_00073469-exon-scaffold_92-1491911889:261184..261339Clytia hemisphaericaexon
TCONS_00073469-exon-scaffold_92-1491911889:259747..260826TCONS_00073469-exon-scaffold_92-1491911889:259747..260826Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_92supercontigscaffold_92:259747..269892 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0.00196615 1.98372e-06 1.1948 0.023368 0.38924 0 0.767995 5.28916e-05 0.641355 0.968016 1.07538 0.193244 0.375702 0.269753 0 0 0 0 0 0.00019744 0.00034154 0.0149446 0 0 0.333019 0.667742 3.33896e-08 1.0559 4.83948e-10 0.972111
Blast
BLAST of TCONS_00073469 vs. Swiss-Prot (Human)
Match: RABEK (Rab9 effector protein with kelch motifs OS=Homo sapiens GN=RABEPK PE=1 SV=1)

HSP 1 Score: 106.686 bits (265), Expect = 1.685e-24
Identity = 90/386 (23.32%), Postives = 161/386 (41.71%), Query Frame = 2
Query:  647 KAMMQAKPSKTPEMAKRRVIRKSGKSPAAKFSDLISHENPTGRWGHGCCKICHDKAIVIGGQTKQQMNTDSMWLLDLKTRKWELQKSDNSTIDRRVGHSVVYDEKRNLVFVYGGSKPKKWYSDVYSLNLATFEWEKSETIGKAPT-RAYH-SCNKFHDELFVFGGVYPNPDPDPDGCSNELVIYDIANKSWYTPIISGDIPNPRSDHSAVMIGSKLYIFGGWDAPTCHDDIYCLDIVIMKYTRLKPIGEGPSARTWHSTSVLSNPNQFCIYGGFDGNDSLNDLFVFDSVKTCWSKIHNEHNSILRAG---HTSLLMTSPYS------DDDVTKANNKSQ-------------------------VLIFGGGDNAGQFYNDVILLDV 1696
            K +   +P   P  A    +   G SP A+     S+  P G    G       K  ++GG    +  +D +  +DL   +W+L       + R    S +     + ++V+GG+      + +  LN  T  W   E     P+ R +H S     ++L+VFGG      P  D    +L ++D    +W  P   G+ P+PR  H  V  G+KL+I GG      +DD++C+DI  MK+ +L P G  P+    HS   +       I+GG     +L+ ++ + + +  W+ +  + +++L  G   H+  ++  P +      D +    N++++                          L+FGG +  G+ Y+D I+  V
Sbjct:    2 KQLPVLEPGDKPRKATWYTLTVPGDSPCARVGHSCSYLPPVGNAKRG-------KVFIVGGANPNRSFSD-VHTMDLGKHQWDLDTC-KGLLPRYEHASFIPSCTPDRIWVFGGANQSGNRNCLQVLNPETRTWTTPEVTSPPPSPRTFHTSSAAIGNQLYVFGGGERGAQPVQD---TKLHVFDANTLTWSQPETLGNPPSPRHGHVMVAAGTKLFIHGGLAGDRFYDDLHCIDISDMKWQKLNPTGAAPAGCAAHSAVAMG--KHVYIFGGMTPAGALDTMYQYHTEEQHWTLL--KFDTLLPPGRLDHSMCIIPWPVTCASEKEDSNSLTLNHEAEKEDSADKVMSHSGDSHEESQTATLLCLVFGGMNTEGEIYDDCIVTVV 371          
The following BLAST results are available for this feature:
BLAST of TCONS_00073469 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
RABEK1.685e-2423.32Rab9 effector protein with kelch motifs OS=Homo sa... [more]
back to top