Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00073459 (transcript) - C. hemisphaerica

Overview
NameTCONS_00073459
Unique NameTCONS_00073459
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length2415

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00073459 ID=TCONS_00073459|Name=TCONS_00073459|organism=Clytia hemisphaerica|type=transcript|length=2415bp
AACTTGATTCCGCCATTCAAAAATGCAAAATCATAAAAGGGTTTTCATCG
TCCATAAGGGTGACACGCAACACGCAACCAAGAGTTCTAAACAATCTAAA
CAATCTTAATCTGTTTCTTTCATTGATTAAATCCAACTAACACTTTCCTC
CTTTTCAGCGGCGTTACGATTTTGTCGTCGCATCATCCAACACAAGGACG
ATATGTACAACAAATACATTATTGTCGGCCGACTCTTCAAACCCATTGTG
CAAGCTTTCCTTGTCAATGGACAACGATACAATCTTCTCAACTCCGCCAT
CTTAGAACTTTTCCAATTCATTTTAAATGAGGACATAAAAAGTCTGGTAG
CCTACATAGTTGAAAATCATATTCAAGCATTTCGAGATATCACGTATGTT
GACACGTTCGCGGCACTTGCTGTCCGCTATGAACATCAAAACCAAGAGAA
ACGAAGGCTGGATGATTCCCAAGACAGAGATTCTGGGTACGCTTACGGTG
GCGGTGGTATTATTCACGATCAGCCTTCATCACGCGAGAAACGTGACGAT
CGAACGATGGACTCGTACGAAGAAGCTTGGTTTCGTTctgacgatgatga
tgatgaactACCAGAACTTCCGACCGATCAAACCATTCCCCCTTCTACTG
AGATCGCCGATGGCGCCACCACCAAACCGCTCAGTGCCAAACTCAAAGAT
GTCGAACTTTTAGATAACAAGAACTCTTCTGAGACTCACAATGCTACAAA
TGGACCATCAAGTCCTGTACATAATAATAATTCCCCGATTACCGATCATA
TAAACAGCCAACCAAATCATAATTCCGATACGGAAAAATCGGATTCAGTA
TTTTCTACGAATAACAAGACATTTAATAATAAACCCTTGATGAATAATCG
TTTGATTCAGAACAAGTTTCAGATCAAAATCAACTCCACTATATCTTCGT
TGGCGAATCACGCGGACGAACTTAAGAATGGCGATACACCGAAAACGACC
GGCGATCAGCCGATGGAGGTCGACGACGCCTCGCCTACTGCTAAAACGAA
ACCGTTGTTGGGAGGTCTGGTAGATTATCCCAGTGATGATGATGACGAGG
ATGAAGAATCCCGCCTTCAAAACAACACGCCCACCGCTACCCCGCCCATC
GAAAACGAAGTCCCTATTTCACCGGCAAAGAAGCAGCGTATAAGTTCCAG
TTGAATAGAGATCAGTGTTGTGGCCATTGGTTGAAAGGCATTTCTTTCTC
GAGCGATCGGTCGCTGGAATCGACGTAAAGTTCGCCTTAGTACGATAGCT
TTCTTCAGGTTAGAAAGCTCTGGACAATTCTTGTCCGTAGAAGGATCCTT
GATATTtgggaaattttaaaagaatggaATTTTCTTGTGGATATAACTCT
TTGAcgaatgttttttatttgtgcTTCAAAAAACGAGAATTGATACCCAC
CCGCGCTCGCCCGCTCAAACGCCGCCCGTCAGAAGGATGTACCCTTACTG
CTGTCGAATGATTGATATAATGAAACGAAATGGAATTTTTGATATGATTT
TGAAATTGGTGGCAAAAAATTGAACAatgtttttacgttttctgtAAAAA
ATGCGGAATGTTTTTAATCTCACGACTGTTTCTCCTGTTCTAATGATACT
CAAGGATATTTTATCTTGGTTTTAGCTCCCCTCAGTCCCGAAATTTAGTT
AGGGAACAACTGACCctgattttttattcaatttttcatgttttcaaagT
AGGTCAAGTGTGACAAAGTAGACTGGTTCCGTCATCCTGTATATCGACGA
GATCACTCCCTATACCTGGCGCCGTCTTCTAGTAGAACTTCTTTTGTTAT
TCTTTCTGGGGAGTGAATTGTCGGTTGGTATCCATGGTGATATACGTTAT
CATACTTGATCTCTCTTTAATGATCGATCAGCCGAAAGACGTTTGCTCTA
CTAAATGATCTACAGTAAACTCTCGGTTATTCTTACCCCATCTTAAAAAT
TAGATTTGAGCGATCGACCAACTAATTCGACTAAATAACGTCCTCTATAC
AttcaaaaattcgaaacaaCTGTATGTTACATAGGGGATCTCTCGATCTC
ATGTTTTGGCTCTAATTTTAAcgactttaaaaagaaaaatgggaaaagaa
cattttttgacaAGATTGATTTGCCCAACGGAGTAagttttctagatttt
catatATGCTTCATTCTCGTCGACTTGGTCTCTTAGAGTTCTACCAAAAA
GCGCCATCAGTGTCTTTTCTGAAAGGTGAACCGTCTCCTCGGCTGTCCAT
TGTTTTTATATCATGTTATTAGACAAATAGACAGACAGATGTAAATATGT
AAtgtttttacttcttttttccACTGAAAACGTCAGATAATGCGAAAAAT
ACaatcgaaaaaaag
Run BLAST on NCBI

protein sequence of TCONS_00073459-protein

>TCONS_00073459-protein ID=TCONS_00073459-protein|Name=TCONS_00073459-protein|organism=Clytia hemisphaerica|type=polypeptide|length=333bp
MYNKYIIVGRLFKPIVQAFLVNGQRYNLLNSAILELFQFILNEDIKSLVA
YIVENHIQAFRDITYVDTFAALAVRYEHQNQEKRRLDDSQDRDSGYAYGG
GGIIHDQPSSREKRDDRTMDSYEEAWFRSDDDDDELPELPTDQTIPPSTE
IADGATTKPLSAKLKDVELLDNKNSSETHNATNGPSSPVHNNNSPITDHI
NSQPNHNSDTEKSDSVFSTNNKTFNNKPLMNNRLIQNKFQIKINSTISSL
ANHADELKNGDTPKTTGDQPMEVDDASPTAKTKPLLGGLVDYPSDDDDED
EESRLQNNTPTATPPIENEVPISPAKKQRISSS
Run BLAST on NCBI

transcript from alignment at scaffold_92:131343..135510-

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00073459 ID=TCONS_00073459|Name=TCONS_00073459|organism=Clytia hemisphaerica|type=transcript|length=4168bp|location=Sequence derived from alignment at scaffold_92:131343..135510- (Clytia hemisphaerica)
AACTTGATTCCGCCATTCAAAAATGCAAAATCATAAAAGGGTTTTCATCG TCCATAAGGGTGACACGCAACACGCAACCAAGAGTTCTAAACAATCTAAA CAATCTTAATCTGTTTCTTTCATTGATTAAATCCAACTAACACTTTCCTC CTTTTCAGCGGCGTTACGATTTTGTCGTCGCATCATCCAACACAAGGACG ATATGTACAACAAATACATTATTGTCGGCCGACTCTTCAAACCCATTGTG CAAGCTTTCCTTGTCAATGGACAACGATACAATCTTCTCAACTCCGCCAT CTTAGAACTTTTCCAATTCATTTTAAATGTAAGTTTCGAGGTTTTCGACA ATTTACAATCTGACTTTCGCTTCATAATGGTTTTTGCTCGATCTGATCAG GAAGAAAAGCGCCTTACTCAAGTCCAAGACTGTTCTATAGGTTTTAAAAG ATAATGTTTGTATCTTTTCAAAATAGTTGGGTTCGTGGTGTTTTATATCT TTCTTTTGCATTACAGGAGGACATAAAAAGTCTGGTAGCCTACATAGTTG AAAATCATATTCAAGCATTTCGAGATATCACGTATGTTGACACGTTCGCG GCACTTGCTGTCCGCTATGAACATCAAAACCAAGAGAAACGAAGGCTGGA TGATTCCCAAGACAGGTAAGGAATTGAGCTCCGTAAATGCTCACGGCTGA CCATCGTGTTGCTCAAAGGAATTTTTTTTAATGTCTGGCTCAAAGCCGTT TTCAATTCGGTGCGGATTCCGCTTGCAAAGCGTTTTCCGTTTTCAATGCA TGGAGGTATTTTTCACACGGGAAATGCAAAATTAATGTAAATTTAGATTA TCTCTTAAAAACGGCCTTCACTCTTTACTCTAATATATCTACATTTTGCA AGTTTCTTTCTATTCTCCCCTCATCCAAATATATCACTACCGTAGCCGTA TTACTGCGAATAAATGTTCCGGATTTTAGGAGGGCCGTTTATTGGAGAAG GCGTTTAAAAGAAGGGGGCGTTTATTAAACTTTAATAAATTGAATGGGAA CCTTATTTTTGGACCTACCCCGGTGGAGGTCCTATAAATTAACCTATGTT TGTTCGTTCGTCCGTCCGTTCGTTCGTCTGTTACCAACTATTCTCAGGAT TGAATCATAGGAATCTTTTGATTTTTGGTGTAAAGGTGCAAAATGGTGGT GGCCAAAATGTGATTTTTGCATGAAAGTAGGTAAAAGATGGCTCAAGCAG ATTTTTGTAAAAAAAGATTTTTTAGCTAAAAAACGCATCTTTATCTGTAT AAGAATCACTATTAATAAGGATACATCAATGTTCTTAGCCAAATTACTTA ATTTTTTGATGAGATAGATGTATTTCTTGCTCACGAAGTCTTGAATATGA AAGAATATTTCAAGGGCATGAAATTTTGGTTTCTAAACGTTTTTTTTTAT ANCCAAATTACTTAATTTTTTGATAAGATAGATGTATTTCTTGCTCACGA AGTCTTGAATATGAAAGAATATTTCAAGGGCATGAAATTTTGGTTTCTAA ACTTTTTTTTTTATAAGAAACAAACGACTAATTTTAATAGATCGTCACTA CTTGTGTTGTGAATGATTGTTTAACGGTCATGCTCACGTAGATATAAATT ATATGTGTTAAATGCATAACCAGGTAGGTCCATAAAAGTATCACTTGTTC CCTTTCGTTCTCTTTCAGTTATTATATGTCATTTTGGAAATGGGTAAAAA TGGGTCAAAATTAGTTTCAATACAATGATCAACACATATGTATAAGTACG GGGGAGGCGTTCATTCGAAGAGGGCGTTTATTGAAGAATTTTCCTTAAGG GAGGGGCGTTTATTCGAAGTAATACGGTATTTTGTTGTGCATCTTCTAGA GATTCTGGGTACGCTTACGGTGGCGGTGGTATTATTCACGATCAGCCTTC ATCACGCGAGAAACGTGACGATCGAACGATGGACTCGTACGAAGAAGCTT GGTTTCGTTCTGACGATGATGATGATGAACTACCAGAACTTCCGACCGAT CAAACCATTCCCCCTTCTACTGAGATCGCCGATGGCGCCACCACCAAACC GCTCAGTGCCAAACTCAAAGATGTCGAACTTTTAGATAACAAGAACTCTT CTGAGACTCACAATGCTACAAATGGACCATCAAGTCCTGTACATAATAAT AATTCCCCGATTACCGATCATATAAACAGCCAACCAAATCATAATTCCGA TACGGAAAAATCGGATTCAGTATTTTCTACGAATAACAAGACATTTAATA ATAAACCCTTGATGAATAATCGTTTGATTCAGAACAAGTTTCAGATCAAA ATCAACTCCACTATATCTTCGTTGGCGAATCACGCGGACGAACTTAAGAA TGGCGATACACCGAAAACGACCGGCGATCAGCCGATGGAGGTCGACGACG CCTCGCCTACTGCTAAAACGAAACCGGTAGGGCTTTTTCTTTGTTGCTCA TGACGTGTTTAAGCTAGATTTTACCTAAATCGACTTCACTTGGTAGTAAT AAGAGATAGTGATCAGTGGATTTCTTCTATACCCCAGCGGTTTGCTTGAA TGGGCTTTTTCACTTGCGTAAATGCGTGAAGATTTTAAAAAAGCTGCGTG GATGTGTGAACTATAAAACTTTGCGTGAACAGTAATTACGTGAATTTCGA AAAAAAGAGTGCGTGAATGCGTGAATTTCGAAATAAAATTGAGGGATTGC GTGAATTAAAGGTCTGCTGGGGGGGGGGGGNAAACTTTATTTTCACCTTC TTTTTAGTTGTTGGGAGGTCTGGTAGATTATCCCAGTGATGATGATGACG AGGATGAAGAATCCCGCCTTCAAAACAACACGCCCACCGCTACCCCGCCC ATCGAAAACGAAGTCCCTATTTCACCGGCAAAGAAGCAGCGTATAAGTTC CAGTTGAATAGAGATCAGTGTTGTGGCCATTGGTTGAAAGGCATTTCTTT CTCGAGCGATCGGTCGCTGGAATCGACGTAAAGTTCGCCTTAGTACGATA GCTTTCTTCAGGTTAGAAAGCTCTGGACAATTCTTGTCCGTAGAAGGATC CTTGATATTTGGGAAATTTTAAAAGAATGGAATTTTCTTGTGGATATAAC TCTTTGACGAATGTTTTTTATTTGTGCTTCAAAAAACGAGAATTGATACC CACCCGCGCTCGCCCGCTCAAACGCCGCCCGTCAGAAGGATGTACCCTTA CTGCTGTCGAATGATTGATATAATGAAACGAAATGGAATTTTTGATATGA TTTTGAAATTGGTGGCAAAAAATTGAACAATGTTTTTACGTTTTCTGTAA AAAATGCGGAATGTTTTTAATCTCACGACTGTTTCTCCTGTTCTAATGAT ACTCAAGGATATTTTATCTTGGTTTTAGCTCCCCTCAGTCCCGAAATTTA GTTAGGGAACAACTGACCCTGATTTTTTATTCAATTTTTCATGTTTTCAA AGTAGGTCAAGTGTGACAAAGTAGACTGGTTCCGTCATCCTGTATATCGA CGAGATCACTCCCTATACCTGGCGCCGTCTTCTAGTAGAACTTCTTTTGT TATTCTTTCTGGGGAGTGAATTGTCGGTTGGTATCCATGGTGATATACGT TATCATACTTGATCTCTCTTTAATGATCGATCAGCCGAAAGACGTTTGCT CTACTAAATGATCTACAGTAAACTCTCGGTTATTCTTACCCCATCTTAAA AATTAGATTTGAGCGATCGACCAACTAATTCGACTAAATAACGTCCTCTA TACATTCAAAAATTCGAAACAACTGTATGTTACATAGGGGATCTCTCGAT CTCATGTTTTGGCTCTAATTTTAACGACTTTAAAAAGAAAAATGGGAAAA GAACATTTTTTGACAAGATTGATTTGCCCAACGGAGTAAGTTTTCTAGAT TTTCATATATGCTTCATTCTCGTCGACTTGGTCTCTTAGAGTTCTACCAA AAAGCGCCATCAGTGTCTTTTCTGAAAGGTGAACCGTCTCCTCGGCTGTC CATTGTTTTTATATCATGTTATTAGACAAATAGACAGACAGATGTAAATA TGTAATGTTTTTACTTCTTTTTTCCACTGAAAACGTCAGATAATGCGAAA AATACAATCGAAAAAAAG

Coding sequence (CDS) from alignment at scaffold_92:131343..135510-

>TCONS_00073459 ID=TCONS_00073459|Name=TCONS_00073459|organism=Clytia hemisphaerica|type=CDS|length=4008bp|location=Sequence derived from alignment at scaffold_92:131343..135510- (Clytia hemisphaerica)
TTGTTGGGAGGTCTGGTAGATTATCCCAGTGATGATGATGACGAGGATGA
AGAATCCCGCCTTCAAAACAACACGCCCACCGCTACCCCGCCCATCGAAA
ACGAAGTCCCTATTTCACCGGCAAAGAAGCAGCGTATAAGTTCCAGTTGA
AGATTCTGGGTACGCTTACGGTGGCGGTGGTATTATTCACGATCAGCCTT
CATCACGCGAGAAACGTGACGATCGAACGATGGACTCGTACGAAGAAGCT
TGGTTTCGTTCTGACGATGATGATGATGAACTACCAGAACTTCCGACCGA
TCAAACCATTCCCCCTTCTACTGAGATCGCCGATGGCGCCACCACCAAAC
CGCTCAGTGCCAAACTCAAAGATGTCGAACTTTTAGATAACAAGAACTCT
TCTGAGACTCACAATGCTACAAATGGACCATCAAGTCCTGTACATAATAA
TAATTCCCCGATTACCGATCATATAAACAGCCAACCAAATCATAATTCCG
ATACGGAAAAATCGGATTCAGTATTTTCTACGAATAACAAGACATTTAAT
AATAAACCCTTGATGAATAATCGTTTGATTCAGAACAAGTTTCAGATCAA
AATCAACTCCACTATATCTTCGTTGGCGAATCACGCGGACGAACTTAAGA
ATGGCGATACACCGAAAACGACCGGCGATCAGCCGATGGAGGTCGACGAC
GCCTCGCCTACTGCTAAAACGAAACCGGAGGACATAAAAAGTCTGGTAGC
CTACATAGTTGAAAATCATATTCAAGCATTTCGAGATATCACGTATGTTG
ACACGTTCGCGGCACTTGCTGTCCGCTATGAACATCAAAACCAAGAGAAA
CGAAGGCTGGATGATTCCCAAGACAGATGTACAACAAATACATTATTGTC
GGCCGACTCTTCAAACCCATTGTGCAAGCTTTCCTTGTCAATGGACAACG
ATACAATCTTCTCAACTCCGCCATCTTAGAACTTTTCCAATTCATTTTAA
ATTTGTTGGGAGGTCTGGTAGATTATCCCAGTGATGATGATGACGAGGAT
GAAGAATCCCGCCTTCAAAACAACACGCCCACCGCTACCCCGCCCATCGA
AAACGAAGTCCCTATTTCACCGGCAAAGAAGCAGCGTATAAGTTCCAGTT
GAAGATTCTGGGTACGCTTACGGTGGCGGTGGTATTATTCACGATCAGCC
TTCATCACGCGAGAAACGTGACGATCGAACGATGGACTCGTACGAAGAAG
CTTGGTTTCGTTCTGACGATGATGATGATGAACTACCAGAACTTCCGACC
GATCAAACCATTCCCCCTTCTACTGAGATCGCCGATGGCGCCACCACCAA
ACCGCTCAGTGCCAAACTCAAAGATGTCGAACTTTTAGATAACAAGAACT
CTTCTGAGACTCACAATGCTACAAATGGACCATCAAGTCCTGTACATAAT
AATAATTCCCCGATTACCGATCATATAAACAGCCAACCAAATCATAATTC
CGATACGGAAAAATCGGATTCAGTATTTTCTACGAATAACAAGACATTTA
ATAATAAACCCTTGATGAATAATCGTTTGATTCAGAACAAGTTTCAGATC
AAAATCAACTCCACTATATCTTCGTTGGCGAATCACGCGGACGAACTTAA
GAATGGCGATACACCGAAAACGACCGGCGATCAGCCGATGGAGGTCGACG
ACGCCTCGCCTACTGCTAAAACGAAACCGGAGGACATAAAAAGTCTGGTA
GCCTACATAGTTGAAAATCATATTCAAGCATTTCGAGATATCACGTATGT
TGACACGTTCGCGGCACTTGCTGTCCGCTATGAACATCAAAACCAAGAGA
AACGAAGGCTGGATGATTCCCAAGACAGATGTACAACAAATACATTATTG
TCGGCCGACTCTTCAAACCCATTGTGCAAGCTTTCCTTGTCAATGGACAA
CGATACAATCTTCTCAACTCCGCCATCTTAGAACTTTTCCAATTCATTTT
AAATTTGTTGGGAGGTCTGGTAGATTATCCCAGTGATGATGATGACGAGG
ATGAAGAATCCCGCCTTCAAAACAACACGCCCACCGCTACCCCGCCCATC
GAAAACGAAGTCCCTATTTCACCGGCAAAGAAGCAGCGTATAAGTTCCAG
TTGAAGATTCTGGGTACGCTTACGGTGGCGGTGGTATTATTCACGATCAG
CCTTCATCACGCGAGAAACGTGACGATCGAACGATGGACTCGTACGAAGA
AGCTTGGTTTCGTTCTGACGATGATGATGATGAACTACCAGAACTTCCGA
CCGATCAAACCATTCCCCCTTCTACTGAGATCGCCGATGGCGCCACCACC
AAACCGCTCAGTGCCAAACTCAAAGATGTCGAACTTTTAGATAACAAGAA
CTCTTCTGAGACTCACAATGCTACAAATGGACCATCAAGTCCTGTACATA
ATAATAATTCCCCGATTACCGATCATATAAACAGCCAACCAAATCATAAT
TCCGATACGGAAAAATCGGATTCAGTATTTTCTACGAATAACAAGACATT
TAATAATAAACCCTTGATGAATAATCGTTTGATTCAGAACAAGTTTCAGA
TCAAAATCAACTCCACTATATCTTCGTTGGCGAATCACGCGGACGAACTT
AAGAATGGCGATACACCGAAAACGACCGGCGATCAGCCGATGGAGGTCGA
CGACGCCTCGCCTACTGCTAAAACGAAACCGGAGGACATAAAAAGTCTGG
TAGCCTACATAGTTGAAAATCATATTCAAGCATTTCGAGATATCACGTAT
GTTGACACGTTCGCGGCACTTGCTGTCCGCTATGAACATCAAAACCAAGA
GAAACGAAGGCTGGATGATTCCCAAGACAGATGTACAACAAATACATTAT
TGTCGGCCGACTCTTCAAACCCATTGTGCAAGCTTTCCTTGTCAATGGAC
AACGATACAATCTTCTCAACTCCGCCATCTTAGAACTTTTCCAATTCATT
TTAAATTTGTTGGGAGGTCTGGTAGATTATCCCAGTGATGATGATGACGA
GGATGAAGAATCCCGCCTTCAAAACAACACGCCCACCGCTACCCCGCCCA
TCGAAAACGAAGTCCCTATTTCACCGGCAAAGAAGCAGCGTATAAGTTCC
AGTTGAAGATTCTGGGTACGCTTACGGTGGCGGTGGTATTATTCACGATC
AGCCTTCATCACGCGAGAAACGTGACGATCGAACGATGGACTCGTACGAA
GAAGCTTGGTTTCGTTCTGACGATGATGATGATGAACTACCAGAACTTCC
GACCGATCAAACCATTCCCCCTTCTACTGAGATCGCCGATGGCGCCACCA
CCAAACCGCTCAGTGCCAAACTCAAAGATGTCGAACTTTTAGATAACAAG
AACTCTTCTGAGACTCACAATGCTACAAATGGACCATCAAGTCCTGTACA
TAATAATAATTCCCCGATTACCGATCATATAAACAGCCAACCAAATCATA
ATTCCGATACGGAAAAATCGGATTCAGTATTTTCTACGAATAACAAGACA
TTTAATAATAAACCCTTGATGAATAATCGTTTGATTCAGAACAAGTTTCA
GATCAAAATCAACTCCACTATATCTTCGTTGGCGAATCACGCGGACGAAC
TTAAGAATGGCGATACACCGAAAACGACCGGCGATCAGCCGATGGAGGTC
GACGACGCCTCGCCTACTGCTAAAACGAAACCGGAGGACATAAAAAGTCT
GGTAGCCTACATAGTTGAAAATCATATTCAAGCATTTCGAGATATCACGT
ATGTTGACACGTTCGCGGCACTTGCTGTCCGCTATGAACATCAAAACCAA
GAGAAACGAAGGCTGGATGATTCCCAAGACAGATGTACAACAAATACATT
ATTGTCGGCCGACTCTTCAAACCCATTGTGCAAGCTTTCCTTGTCAATGG
ACAACGATACAATCTTCTCAACTCCGCCATCTTAGAACTTTTCCAATTCA
TTTTAAAT
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_045594XLOC_045594Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073459-exon-scaffold_92-1575043694:135183..135510TCONS_00073459-exon-scaffold_92-1575043694:135183..135510Clytia hemisphaericaexon
TCONS_00073459-exon-scaffold_92-1575043694:134846..134994TCONS_00073459-exon-scaffold_92-1575043694:134846..134994Clytia hemisphaericaexon
TCONS_00073459-exon-scaffold_92-1575043694:133035..133611TCONS_00073459-exon-scaffold_92-1575043694:133035..133611Clytia hemisphaericaexon
TCONS_00073459-exon-scaffold_92-1575043694:131343..132703TCONS_00073459-exon-scaffold_92-1575043694:131343..132703Clytia hemisphaericaexon
TCONS_00073459-exon-scaffold_92-1510915933:135183..135510TCONS_00073459-exon-scaffold_92-1510915933:135183..135510Clytia hemisphaericaexon
TCONS_00073459-exon-scaffold_92-1510915933:134846..134994TCONS_00073459-exon-scaffold_92-1510915933:134846..134994Clytia hemisphaericaexon
TCONS_00073459-exon-scaffold_92-1510915933:133035..133611TCONS_00073459-exon-scaffold_92-1510915933:133035..133611Clytia hemisphaericaexon
TCONS_00073459-exon-scaffold_92-1510915933:131343..132703TCONS_00073459-exon-scaffold_92-1510915933:131343..132703Clytia hemisphaericaexon
TCONS_00073459-exon-scaffold_92-1491911889:135183..135510TCONS_00073459-exon-scaffold_92-1491911889:135183..135510Clytia hemisphaericaexon
TCONS_00073459-exon-scaffold_92-1491911889:134846..134994TCONS_00073459-exon-scaffold_92-1491911889:134846..134994Clytia hemisphaericaexon
TCONS_00073459-exon-scaffold_92-1491911889:133035..133611TCONS_00073459-exon-scaffold_92-1491911889:133035..133611Clytia hemisphaericaexon
TCONS_00073459-exon-scaffold_92-1491911889:131343..132703TCONS_00073459-exon-scaffold_92-1491911889:131343..132703Clytia hemisphaericaexon
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073459-proteinTCONS_00073459-proteinClytia hemisphaericapolypeptide
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_92supercontigscaffold_92:131343..135510 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
10.6144 9.77042 10.1244 10.8849 96.8586 73.6426 49.4994 54.5288 25.8849 32.0627 25.4017 20.3291 20.3757 20.9271 20.392 28.1558 33.1524 28.9809 18.7029 17.6571 25.2055 25.6657 29.688 28.181 28.7495 32.7932 17.9284 17.0155 20.492 25.1701
Blast
BLAST of TCONS_00073459 vs. Swiss-Prot (Human)
Match: P4R3A (Serine/threonine-protein phosphatase 4 regulatory subunit 3A OS=Homo sapiens GN=PPP4R3A PE=1 SV=1)

HSP 1 Score: 129.413 bits (324), Expect = 1.296e-30
Identity = 67/142 (47.18%), Postives = 93/142 (65.49%), Query Frame = 2
Query:  158 AALRFCRRIIQHKDDMYNKYIIVGRLFKPIVQAFLVNGQRYNLLNSAILELFQFILNEDIKSLVAYIVENHIQAFRDITYVDTFAALAVRYEHQNQEKRRLDDSQDRDSGYAYGGGGIIHDQPSSREKRDDRTMDSYEEAWF 583
             ALRF R+II  KD+ YN+YI+   LF+P+V+AFL NG RYNL+NSAI+E+F+FI  EDIKSL A+++EN+ +A  D+ YV TF  L +R+E Q    R   D+   DS  +     I+ +    R +RD RT++  EE WF
Sbjct:  554 CALRFKRKIIGLKDEFYNRYIMKSFLFEPVVKAFLNNGSRYNLMNSAIIEMFEFIRVEDIKSLTAHVIENYWKALEDVDYVQTFKGLKLRFEQQ----RERQDNPKLDSMRS-----ILRNH---RYRRDARTLEDEEEMWF 683          
The following BLAST results are available for this feature:
BLAST of TCONS_00073459 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
P4R3A1.296e-3047.18Serine/threonine-protein phosphatase 4 regulatory ... [more]
back to top