Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00073443 (transcript) - C. hemisphaerica

Overview
NameTCONS_00073443
Unique NameTCONS_00073443
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length2677

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00073443 ID=TCONS_00073443|Name=TCONS_00073443|organism=Clytia hemisphaerica|type=transcript|length=2677bp
CAGCTTTCCAGCATGGCGTCAACATTTTTTTGTGCTTTTTAAGAACCACA
CTGTATTTAATCTgaaatgCAACCTTACTAATAAAGAGATATCGAGCAAT
ATGGGTGTCTCGTGCAAGAACTGTGGTGGGACTGAAATTGACCATGATCA
AGCTCGCGGGGATTCAGTATGTGTTGGATGTGGGTCAGTTGTAGAGAGTC
TTTGCATTGTCAATGAAGttgaatttcaagaaaatagcGCTGGTAACGCT
TCTGTTATTGGCCAATTCGTTTCTGCAGAAGGGCATCACAGCAGAGCAGG
ATATAAATATTCTCTAGGAAGAGATCATCGTCAAGTCATCCTAGATAATG
GAAAACGTCTTATCAACCAGCTTGGTTCCAACCTGAAGATGACAAACCAT
TGTTTAGAATCTGCTTTCATGTTTTACAAGATGGCAGTCAGTAAGAGGTT
TACATCAGGTCGAAGAACCATTCACGTCATTGGCGCTTGCTTGTACCTGG
TCTCTCGAACGGAAAAAACTCCTCatATGCTACTCGATGTTTGTGATGTT
GTGCAGTGTGATGTTGTGACCCTTGGTAGAGTGTTTTTACAATTGGCGCG
AGAATTATGCATCGATTGCCCCATTGTTGACCCATCATTATACATCCACC
GCTTTGCACATCAGCTAGATTttggtgaaaaagaaaatgaagtctCCATG
TCTGCACTTCGTATTATGGCTCGAATGAAAAAAGATTGGATACATTTTGG
GAGAAGGCCTTCAGCTTTGTGTGGCGCAGCTTTGATCATAGCAGCCAAAT
TGTACAACTTCGAGGTGACCATGAAAGACATTGTGAAGTTAGTTCGCATG
AGTAAAACGACCGTTTTCAAACGATTGATGGATTTCAGTAAAACAGCCAC
TGGTAAATTAACAACAGACGAGTTCAAAACAGTCGACCTTGAAGAGGAGG
CCGACCCACCTTGTTATACAGAAGGGCGTAACCGTGTCAAGTTTGCACAA
GAAATAAGTGGACAATATCATTTTGTATCGACAGATGTTTTAGCACAAGT
TACACgaactcaagaaaaattagaggAATTGCTGgataaaaggaaaaata
ttcAATTCGATATCGAAGATACGAAATCGGAATCCAAAGCATTCGATTAT
AGAAAAGAACTACCGCGAGATTATTCTTTGTACAGTTACGAATTAGACGA
AAACGGTGAATTTAAGACACCATCAAAGTTCATCATTCATAAAGAAGAAG
GTGGCGTCAAGAAACCTCCAGAGAATGAAGagccttcttcttcttcttcg
gaGAAAGATGAgaatgatgagctgaatcaaaTGAAAGGAACTGTCGCTAG
CAGCACTCTTATTATCGATCAAAGTCGAATACAAAAGGTCAAGTGTGATG
AGAAAAAACAATTGAAAGAAGAAAGTAACCAAGGCAACCAAAACAACAAT
AGTGATGAAATCGACCTGGATGGAATTAATGATGACGAAATTGACATGTT
GCTGCTAACAgaagaagaaatcaaaatcaaaacagaagTTTGGTTGGAAG
AAAACCGAGAGTACCTCATCAAAATGAAAGagaaagaagaagagcaacga
agaaaagaagaagaagaaaataaagatgGCATCAAAAAGAAGAAGCGAAA
ATACAAgcgaaaaaacaacaaagatcgACCGGTTTGCGAAACTGCAGACG
AAGCAATCAAAACGATGTTGGCGGAACGTAAACTTTCCAGTAAAATCAAT
TACGATGTCCTGCGAGGCTTGAAGTCTGAAGATAATATACCAGGTTATGA
AGAGAATGAACCGAGTATCGTTCCCAAAGTGGAAATGCCGTCGGCTGATA
TCTCTATGGTAACCGGAAGAAGTGAGGTGGAAGAGAGTATGCCGGTTGTT
TACGAAACTGGTTCAACGCTTGCAACATCCAAACGTGCTGTCAGTAAGCG
AAGCAAGTCTATGAGCGGACCAATCTTCGGCACAGCTTATCAATCTAAAA
AGTTTAAAACGGAGACGAAAGTGAACCTGCCCAGTAGCAGCGTTGGGAAA
GAAGACAAAACCAGTGAACTCGATGTCGACGAGAAGCCATTGGAGACGGT
GGTGGAATCAGGTCCTGTACAACACCACAACGAGGCTCAGAATCATGAGT
ACGAGGATGAAGAGGAAGAAATTGTGACCGCTTCTTCACTCTTCGCCAAA
CAAATGGACTGTGATGAGGATTACGGAGGATTTGACGATGAAGATGATGG
ATCGTTTTATTGACCAACAAATTGCTCATATCTCTTTCTATTTCTGTATT
ACACATCTAGGTCTCGTCCTACTCTGTGCAAAATGCCAATGCGTGTGGTT
AGTTAGCCTGTATCACCGGGAAATTCACTGGATTAAACTTTAGGAGCTTA
TCTTTCTTACACATGCAAACGAAAAGCTCTAGCTACAATACAGCTACAAA
GTATAGTTTCCTAAACAATAGTATATGTCTTTGTATTGATGGCGCTCTGA
AGCCTAGATATGTACTCCACTCTAGGttgatattttcagtttttaaggAA
TTTTCTTCTCGATTGTAATAAATAGAAATTTGAAATACTATCAAAAGatt
caaaatatattatttattgttttaccaaaatctttcaattttccttgttt
tgaTTTCTAAAATTCCTCAACTTTTCG
Run BLAST on NCBI

transcript from alignment at scaffold_92:157150..175005+

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00073443 ID=TCONS_00073443|Name=TCONS_00073443|organism=Clytia hemisphaerica|type=transcript|length=17856bp|location=Sequence derived from alignment at scaffold_92:157150..175005+ (Clytia hemisphaerica)
CAGCTTTCCAGCATGGCGTCAACATTTTTTTGTGCTTTTTAAGAACCACA CTGTATTTAATCTGTAAGTGTACTGTTTCAAGAAATAGGATGaagttttt tgaactttttagggAAGACATGAAGGGGGGTGCTGCGTGACTCCTTTTGC CTTTTCATTCCAGAccggttggcaaacgatatcatccaccaggatgcatc ctctcttattttccccctattttctactttcctatcttttATATCCTGAT TTCTGACTTTATCTAGTGTTTCTatctgttttctaagtatttttctgaaa tttgactGTACCGGTGAAATTggtctccgaccccggctcgaacgaccaaa tgcaagcaaccttggtatAATACATCCCCAATGCCTAACGTTGCCTAACC GCTTGCGCCACACCGAAACACGACAGGAtactgtcattcacaaatactta tagcgtgtaattcagtcaggcacatcctggcaaatgaacggggtattttt cacttgcgaccattgccaaatgaacggggtcgaaaacgaaagtgacgtaa tagggccgaatacccagtttaattgaaccgggttggaaatattttgcttc atttcaaagaactgcatagatgaaattttttttccatgggtcaattttgt cttcgaagattgaagaaacttttaatgaaaaaataaagttcccagttgtc ttccttttttccctttttcagtttgaagttcattttttttattttcacgc ttttagcctgagacgtcctatctcatttacactgggtgacgaatacccca tgcaaatgctcaccccgttcatttgccaggatgtgcctgactgttgtaat ttacagacctttattaagaaagctcccaaccctaccggtgccacTACaag gatcccgtagggatcctaAATAAGGTCACAGGGTACagatgcccctaaga aggcctgcggccttatattgtgactctcgagctccaaccctaataTTATC TGATAATAACCGagcccccgtctaggtccgcagattgaaaaatttcactt gcatcctggtggatgatatcgtctgccaaccttCCAGACCAGACATGACG CATGAGTTGTGGTCCAGACTGGATGGAGTTTCCCCTAGTCGTTTTCTGCT AAAGAATGGCCATTGGGCGGgctaggaccctgccgacgcaccggactgtc cagtgtatttgtccggtggcaaaaagaaaagtatccttgagctacaccgg acgcaatcagtccggtgtcagtccggtgttgcatacagggaattttggac gccggacatttatgaaacaaaaaattaaaaacactggacgcaccggactg gtcatgtcctgtgttttgattgtccggttggaaaaaatatccttctctga caccggacatccaacttccttaagtccggtgtagaaattgtccggtggta aaaaaaattctcattttacaccggactttcgcatgtccggtgttcgttaa gtccggtgcgtcggcagggtcctggcaggctattccaaaaatatatacag gGGTATTGGCAAACCTGTTACACCAACccccttgaaaattttgaataaca aattatccTTTGAAAATTTGGGCTAGCTAACTAGATAGAGTCCCCTGGGG AagttgaaattttatgaaaaagggACTGGAAAACATGCCATGAGCGGAGA GAAATGATCCCCTTGGAACAAAATTCCCCTGGAAAAtctactgtcaactg ctctaacttgggacgattggtttggcctgtattttcacttactgttaaat ctcaatatgacaacaaatttgttttgcaagtttatcaatcatactttctg tcataacatgtcacgataactcgTGTGTACTCCACTGTTACGGAACaact ttcatatttcaatttaaaagcctactcggtgcgaaagagaaattgtgtat tttttaacgGATACAGGGTatgtccagacgatctcaatcaaacagaatcg acaatcgaaccagttgaaccaaattgaacgtaatcgacccattgaaattc gattggcgaacgcaatcgaatctcaatcgaacatcaaagttctgggtaat attcgattttttatgtttggaagaaaatttttacatcAGTGGTTGCCAAA TAAGGAAAAGTCCAATTAAACATATACGAACCTAATCAAACGCATTCAAA CACATTCGAATACGAATCctaatcaaacgcaatcgaatatcaatcgaatc tgaaaattgcggtaatattcgattgagattcgattgcattcgacaatcga atttcaatcagtcaATTGCGTTCGGTTTGGTTCGATCgtcaattccgttc gattgagatcgtctgggtaTGTGAACATGGTGAATTCACACActcaattt tctcgagattcgaaaaaataaaaacacaaaaattgttCTCTATAGATTTT TTcttgtagaaaaaatattttatatattatttcaaagaaacatACACAAT GTTTAAAAGGTACATCTATTGATACGTTTCAACTTTTGTGTTCAAATGAT GTCAAAGAAGCTTTTTTGTTTGTGTGAGAGAGACTCTTCTTCGTAATAAG TTCTCTGAAGGATTCGCATTCATCTTGTTATCAAACATCAACGGTGGAGA TTATTTTGGCAGAATTTTGTGAGGATAATTACatagttttgcatactttt cacaaattttCATTCTTTCAGACTGCTCGGGTGAGTTAGGGAgtgtctag atttttaaaaatcccAGATCCCAAATTCGCGATcaatagcacccattctc agggattcacttatggatttttagatgccctataccttaaggtttcagga cccggttgtggtgtaattaaatattaacctaaaaattaattattatgAAA AGTGtaagttatgacgtcataaatcacAAAATAGCTCCAACTCTATAAGT GAgtcgggttggtgtaatttaagatgcatgATCTAACGATTTAAGATTCA CAATgtgcgatccatgcataaagtatgctgattattcctaataattgtCA TAAAGCTTTAAATTATaaaacataattctaaaacaatggcataatctttt ctcgcttttgtttaccatgttgaatttatgcaacaaaatagaaataagta AGCAATGGAATTACGAATAtttacgaccgtaaaattatgaaaaaaactaa cttacATAATATTGATGATGAGAAAAAAAAGTAGaatgcacaagaaatat tttttctctcaacctctcagttttaacaatcataatcaaatataggaatt tctttcttaaaggaaataaaagaatatattgacgaacaatatgtTCTgag gaccgtaatgtacgaagcaaaaaacgggtGCTCTATTAATTGTCtaatga gaaagaattttctttcagtaaacaattcccctatattgATTCATTGATTG ATTCAAATTGTGAAAGAGTACAGGAGGTGAATGCactttaaatttcttta aatataatttgCATTATCTTggataaatgatgtttttgaaattaattgag tttcagcgaatgaaggggtcatgcagttattatataaacactatgacaat tactaccgtggtggtatataaaccaaaatttgggaaaacagttactccac cagtggactaactgcaaNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNtagtacactatggaata actgcaagggtggtggtgtctgtagaaaatgtccaaaattgcagttactc cacatagtgtcaaggagtaactgcaagaccccccctgAATGAAAGTTagt aaattgcctaaatattttagcatgattagcataattacgcatgaattaac atattttatgcaaggatcgcgaatcgtgcatcgtgaatcgttagatcgtg catcttaaattacaccaacccaagtgagtctgctaaattgtgtgggttgc gtgggtgcgtgggtcaatatttttgcgtgggtcatttttttgtgtgggtc aaaatattttttgcatgggtcaaattttttgtgTGGGTCATATGTTTTGC ATGGGTCATAtgttttgcgtgggtcaaattttttggttgggtcaaatttt ttgcgtgggtcatattttttgtgtgggtcatatttttgcgtgggtcatta tatttttttgtgtaggtcaaaatttttgcgtgggtcaaaattctctctgt aattcgaaaaaataccTTCCCTTGAAATTTGAACTAGTTACAtccaaaat gttggatgtgttttacataacaccttttggtttattttgtttattttgca tagcTGTACTTGTACAGTTCCATAATTTCTGAATATGGTGAATTTGTTCC AATAAACGTGTTCAGAAAGAATGTTTCCAACAGGGGAGTGTCTTTTTATA AGTGGAATGTTCCCTTTTGGGAGATTTCGTCCAAAATTAATACTGTAGTT ACGTTTTGTATATACCTAAGAATGGCAAAAAAAATGTACACAATTAAGcg gctttatattttttttaattccccTAACTAAACATGTTAGCTTTTATAGC TTCTTGTAGCACGCTTTAATCTTTTGGGTTGCCTTTGAGTGTTAAAGAAC AAAGCAAATGACgacaaaatctgaaattttttttacaaaagttatGTTCA TTAGGTGACCGATTACTAAACAATTTAATTGTTGTCAATTATTTTGTCCA CCCCACTggtaatttctttgatttaagtacattaaaggccaattaaaaaa attggacgaaataaagacgctgtactttttttcaaaacaagagAAAAGGA GAGGAAAAAATTCAATAGAAAGGAAAGAAGCAATGAACGGTCATATCTCA TTTTTGTTGCTTAAAGTTATAGTGTTTATTTCCATGACACTGGAATCCTG AAATATATcatgctaaaattcaaaagtgagatCCTGAAGTTTGTCTACAA AAATTAGACGGGTGTGTGTTGATTCTGTATAATATTATAGTAAATAAGTG CAGCTATGCAAAATAAACCACAATGCGTTACATAAAAACGAtgtgctttt gtttagttttcgtagatacacaacacatttttgtataaaataacttgaaa attttaatttgacaaaaaaacgagttagctaactcgaaagttttaatttg gtaaaaaaattgagttagcTGAAAANGTTAGCTAActcaaaagttttaat ttggtaaaaaaatcgagttagctgaaaaatcaacaaaaaaatagtGATCC ACGCAAAaactttgacccacgcaaaaactttgacccacgcaaaaaatatg acccacgcaaaaaatatgatcATTAGGCGACTACTCATTAGTAACTACAG TATTAATTTTGGACGAAATCTCCCAAAAGGGAACATTCCACTTATAAAAA GACACTCCCCTGTTGGAAACATTCTTTCTGAACACGTTTATTGGAACAAA TTCACCATATTCAGAAATTATGGAACTGTACAAGTACAgctatgcaaaat aaacaaaataaaccaaaacgtgttatgtaatacacatccaacattttgga TGTAACTAGTTCAAATTTCAAGGGAAggtattttttcgaattacagagag aattttgacccacgcaaaaattttgacctacacaaaaaaatataatgacc cacgcaaaaatatgacccacacaaaaaataatgacccacacaaaaaatat gacccacacaaaaaatatgacccacacaaaaaaatatgacccacacaaaa aatatgacccacacaaaaaatatgacccacacaaaaaataatgactcacg caaaaaatatgacccacgcaaattTTTGATGCACGCACCcatgcaaaaat attgacccaagCACCCACGCAACAGACGCACGCATAAGTACATGTagaat ctttgtcaaattttgaccaaagatgcatcttaaTTGTGCCAAGCTTTTCA ACGAAAAattgacgtcagcaaaaattgcaaaaaatcgaaatatgcaatat tttgctgacatcatcaaattttcaaaaaaaattttcaaNagcaaaaattg caaaaaatcgaaatatgcAATATTTTGCAGAcatcatcaaatttttcaaa aatttttttctcaaaaagttacattttagtTCGATGCATCTATGGTTCAA ATTTGTATGTATTGTATGCatttttaatattatagcgATTTTACGATTCa tcatgacgtcaccaaattcgatcaaattatgatgtcataattacaatttt tttaattatagaTTTTTGTGGTGATATTTAATTAGGTCACAACCTGATTG ATAAACTTCaaggtatagaggtactttagagccctaatctggctgctatt ggtCGCTTACTTAGGGTAAACTGCTAGGTAtttgagacttgccctaagtc aaTTGAGTGAAACCACTTTTTCATACCCATACCCACCATCGCAATTTTTG TGTAAACAAATCACGAAGTTTTCTCTCTTTCTGAGTCTGATCtaaagttt tttacaagaacataaaCTGACATGAGGACTTTTTGAGACTATGATTCTGA CCTCTTATAAGTAAAGTGAATTAAAGATATTATATACATGTGTGTGGCAT GTAGCGATGGGGTAGAGTATTCCTTCAATAATCGGATTCGAAAATCGGGA TTACATTGGAAAATCATGGTAAACCGGAATTTTCACACAGTGATAAAAAT TCCTGTATCCGCCCCTGTGCTAGGTTAGACTTTGACCGCTAAGTTGGGTT GCGACCGCTGGCAGAAAAAAGTACACCTCCCCGCCAACCATAAAACCACA AAAATAAAAGGTGCACAAAAATTGATGAGATTATTAAGCTAAAGTATTTG ATTTCTCTCTCCTTTAGAAATACAAAAAAGATTATTGCAACTCTGAGAAA TCTTGTTGACATTAACTaactattattttttaaaggaaatgCAACCTTAC TAATAAAGAGATATCGAGCAATATGGGTGTCTCGTGCAAGAACTGTGGTG GGACTGAAATTGACCATGATCAAGCTCGCGGGGATTCAGTATGTGTTGGA TGTGGGTCAGTTGTAGAGAGTCTTTGCATTGTCAATGAAGttgaatttca agaaaatagcGCTGGTAACGCTTCTGTTATTGGCCAATTCGTTTCTGCAG AAGGTAGGTGAAAAATGAATaaagcttttctttttttcttgagtTTTCTT GTGCTActataatacaataatgaccggttagtgaggttTGTACTGAGGAA TATTGCCcaaggtcaagtaacgaccgagcttgcaaGGTTGTTGCGATGAC caagggcaatattttcagtacatcccgaaaaaaccggtcttttttgtatt tgttaaccgtttccttcagcttcggttgatttttagcgctttatccagga aaaatagtgaaataaagtgaaaaaggcaagcgaaaagagatgaaaaattg ctataatttctgacgtcagaaatagaaaatgagagaaatgatgttaACGN AAAAGGCAAGCGAAAAGAGAtgaaaaaatgttataatttctgacgtcaga aatagaaaatgagagaaatgatgtcaacacATTGTtcatttcctttgaaa aagtgacgtcacaatgaattttcctaacgacgggcaactctggacagtgt aggcccgtcgtcgtgcaaaaagaaccaattgtattgcgcaaaaagccgtg tagcccgctttgaaaaagtaacgGGTTAACAATGTGAGATGTTACATATT GAGATGTCAATAAAAATAATGTTGCTCCAAGACCACCAGGTAAGAATGGT CAACAACAACAGCTTGTTCCGATTTAATTCTACATTGAAAATAATGATAA CAATTTGTCCCCTTTGCATAGCAAAGTCATTACAAGAACTTGATTTTAAC CTAATCAATCAAACCACGGCACGGTTAAACATGTTATTGTTATAAATTCA CTGATTCAATAATCTTTAATTTTTCCAGGGCATCACAGCAGAGCAGGATA TAAATATTCTCTAGGAAGAGATCATCGTCAAGTCATCCTAGATAATGGTA AGAAACCTAAATCTTGTATTTTGCAGTATAAACCTTGGTAATTTTATTCT AGAGaatctttgaaaagttttggaaGTAAGTCTGGAAACTCTCGCTTTGT AACAAAATCTGTAGTTAGAGTTTTGTcccaattttgtttttgatcaaaat cagatgAGTACCCTATTTTGATGCTGGAACTTTTTAGGAAAACGTCTTAT CAACCAGCTTGGTTCCAACCTGAAGATGACAAACCATTGTTTAGAATCTG CTTTCATGTTTTACAAGATGGCAGTCAGTAAGAGGTTTACATCAGGTCGA AGAACCATTCACGTCATTGGCGCTTGCTTGTACCTGGTCTCTCGAACGGA AAAAACTCCTCGTAAGTTGCAATCAAGAATCAAGTCAacagaattttttg aaaagacaaTAACTGAAAGAGTGAAGAAGATGAAGCAGATTTCATTATTC ttgcttttatttttagatATGCTACTCGATGTTTGTGATGTTGTGCAGGT ATTTactttgaaatttattgaaaatcacCTGATCAATTTCCGACAGAGGA ATATTGctcatattttttgttgaattagGTCAATTTTAGTAAGGTAATAT CATTAAGTCGTGACATTGTGTTTACTTTCTGCTGCTACTAAAGATACATA AGCTTTAAGGTTTGAAttcaatcttaaatattttgtcTCCCAACTTTCTT AAGTGTGATGTTGTGACCCTTGGTAGAGTGTTTTTACAATNTTTTGTccc aattttgtttttgatcaaaatcagatgAGTACTCTATTTTGATGCTGGAA CTTTTTAGGAAAACGTCTTATCAACCAGCTTGGTTCCAACCTGAAGATGA CAAATCATTGTTTGGAATCTGCTTTCATGTTTTACAAGATGGCAGTCAGT AAGAGGTTTACATCAGGTCGAAGAACCATTCACGTCATTGGCGCGTGCTT GTACCTGGTCTCTCGAACGGAAAAAACTCCTCGTAAGTTGCAATCAAGAA TCAAGTCAacagaattttttgaaaagacaaTAACTGAAAGAGTGAAGAAG ATGAAGCAGATTTCATTATTCttgcttttatttttagatATGCTACTCGA TGTTTGTGATGTTGTGCAGGTATTTactttgaaatttattgaaaatcacC TGATCAATTTCCGACAGAGGAATATTGctcatattttttgttgaattagG TCAATTTTAGTAAGGTAATATCATTAAGTCGTGACATTGTGTTTACTTTC TGCTGCTACTAAAGATACATAAGCTTTAAGGTTTGAAttcaatcttaaat attttgtcTCCCAACTTTCTTAAGTGTGATGTTGTGACCCTTGGTAGAGT GTTTTTACAATTGGCGCGAGAATTATGCATCGATTGCCCCATTGTTGGTG AGTCTTATTATTCATCTACAAGTGGCAGCTGTCAAAGAAAAAATCCATAT TTTACACCCCTCCTTTTTTGATAAGGGATAATTTACATAAGGGTTTCAAG GAAGGGTCAAGTTTCAAATGTAATGGGCTTTAGGCTCATAGAAGATTCAT TAAACTTTTAGGCCAAAGAATTGTCTTTTTGAAGACTACTTAGCCTGTTG TTGATTCAGCCGttgattttgaactttttttggtgCCCGATTTTGAATCT CTAATACTTATTTTCGCACACAGACCCATCATTATACATCCACCGCTTTG CACATCAGCTAGATTttggtgaaaaagaaaatgaagtctCCATGTCTGCA CTTCGTATTATGGCTCGAATGAAAAAAGATTGGATACATTTTGGGAGAAG GCCTTCAGCTTTGTGTGGCGCAGGTATGTTATGTGTTTGTGGTCATGAAA GAAATCACTTCCCAAAAAGAACTAAAtctctgtaaaaaaaatatattgct ctgccacccaaatctcctgattgaatatagttggacagaaattcttattt cttcacatatatatctcttcgatttttttattcaatttgcGATTTCTAGT GCAGCGTCTTTTGATTGACCTGGCTTTTTTCGCTAGATTTTTActtgtgt cccaaaaaaaatcattttgaaaagatGAGTTGAAAGTCAAGCAAATAAAT CTGCGTGATTTTCTTTCGTTTCATAGCTTTGATCATAGCAGCCAAATTGT ACAACTTCGAGGTGACCATGAAAGACATTGTGAAGTTAGTTCGCATGAGT AAAACGACCGTTTTCAAACGATTGATGGATTTCAGTAAAACAGCCACTGG TAAATTAACAACAGACGAGTTCAAAACAGTCGACCTTGAAGAGGAGGCCG ACCCACCTTGTTATACAGAAGGGCGTAACCGTGTCAAGTTTGCACAAGAA ATAAGTGGACAATATCATTTTGTATCGACAGATGTTTTAGCACAAGTTAC ACgaactcaagaaaaattagaggAATTGCTGgataaaaggaaaaatattc AATTCGATATCGAAGATACGAAATCGGAATCCAAAGCATTCGATTATAGA AAAGAACTACCGCGAGATTATTCTTTGTACAGTTACGAATTAGACGAAAA CGGTGAATTTAAGACACCATCAAAGTTCATCATTCATAAAGAAGAAGGTG GCGTCAAGAAACCTCCAGAGAATGAAGagccttcttcttcttcttcggaG AAAGATGAgaatgatgagctgaatcaaaTGAAAGGAACTGTCGCTAGCAG CACTCTTATTATCGATCAAAGTCGAATACAAAAGGTCAAGTGTGATGAGA AAAAACGTAAGCTGTAAACGTGTTTTGAGTTCATTTTATCCACGATTGAA GTCCTTTTGATTCACCAGTCTGATTACGTATGATCTTTTAAATTTCCACG TTCGAAATATGCTATCGTATTTTTCTCTATTCAAGTTTCCTTGGTTATAG GAGTGTGGCCTTTCTATTAATTGTAGAGTCCACTTTTTAAATACTCGAAT ATTTTCACACTGAGTGCATTTTCTGGTTAAAAATAATAGCGAGCAAATCG TAAACTGCTCTATTTTTGAGTCAGCGGTTAAGAATTTATCATTTGAGTCT CTTCTTTTTTTCGCaaatattttctatttgatACCTTATTGGGATGTATA ATGCTTATTGGAGGGTGGTTCTTGATAGAGGATGGTGCTTTAGGGCGGCT CTTAAAAGAGAACAGTCGTGATTTTTGTCACCTTTTTTTTAGCAGACTCA TGAATATTACGCATTTAATACTTTAATTAAACCTACTTCTCTTCAGAATT GAAAGAAGAAAGTAACCAAGGCAACCAAAACAACAATAGTGATGAAATCG ACCTGGATGGAATTAATGATGACGAAATTGACATGGTATTTATTTAtcaa ttcattcattcatccatcCTTTCATTTTCATCCGAGtgatttgttttttt agttGTTTGAAAAGATTCCAAGAAATAGTTCATACTTGAGCTTGGGTTTA GGTAGAGgataatattattttcatcaatttctgaacaaggaaaatttact ctttcattacTCATCGTACACGGGAAGCTTTTTTGTATAATTCTTCTTTT CCGTTCTACATGATTTCAGTTGCTGCTAACAgaagaagaaatcaaaatca aaacagaagTTTGGTTGGAAGAAAACCGAGAGTACCTCATCAAAATGAAA GGTTGATAATCCTTGTTTGTTGCTATACGCGTCTGTAAAACACTCTGTCT CTCTGAACTGCTAAAAACTTTGTAGCTGATGGAAGGAGCTGAATTCTGAT CGGGATAGAAAATCATCTGTTTTTAATTGGTAATGGTATGGACTCTCAAA ATTACAGCGACTTTTGCAATTGATCTGAAGCATCGGGGTATTTTTCTCAC CGTGACAATTTTACTGCAAATTGATATAAGGTTGTACTAAAGTATTGAAA ATGCCTTCTTAGTAATCATTTTAAAGTAACTAAAAATAGCTTGACCCTGG TCCGAATTCAGAAGGATTCCCCTGTTTAgtatgattttgttttttttgta cagagaaagaagaagagcaacgaagaaaagaagaagaagaaaataaagat gGCATCAAAAAGGTTCGTTCACTTTGTTGACCATAGACTTTTTCActttt ccatccgccatcttggatcatatgcaaaaatacagaaaaGAAAAAGCCGG GGTTGGATtcagttggaaaatatgcaaaacatatgcaagtttacacaaag attataAAGCGAACAAGCAGGAACAAGAAGAAACATTATACTCATTAAAA GAATGAAAGATCAAACTTCAAAGTTCAAaaagaaatactaaaaaaaacat taaaaatttaaaagaaatcttttttttgccatgctattcccaggagaata atttatcgtcagccgaataaggattattctTGCAACTTTGCTGATGATCT TTCAGCTTGAGTTtttgtctaatgttatggtcttttgaagggCTGGTTCT AAGAGGCGAGAAAATATAATTATTTCTGGTTTTCAAGAGGGGCAAAAcca atctttcttctacaagattaaactttaatataatgcctgCCAATTATGGA GTCAAAGAGGCTCCACTATGGAAAGTTTAACTTTAGAGTTTATCTTTTTT CAGAAGAAGCGAAAATACAAgcgaaaaaacaacaaagatcgACCGGTTTG CGAAACTGCAGACGAAGCAATCAAAACGATGTTGGCGGAACGTAAACTTT CCAGTAAAATCAATTACGATGTCCTGCGAGGCTTGAAGTCTGAAGATAAT ATACCAGGTGAGAAGCCAGTCATTTGCTTGATTTACCGAATCGATCTTCA TTTACCGTATTTTTCGAGAAAACGCACCAGGcatttattgaatttatcaG TTTTGGTTGGGCTTTGAAGGGGAACTTTATTTTGCCTTTCTGTTTTATTT GAGTACAAATTTTTGACCCTAATAAAATCAGTTCgaacaatgaaaaaata aacgacCCTCCTAGGGAGGCGATTATTCGAAGGGGACGTTTAGAGAAATT TTTTCTCATAGGAGGGATATTTATTAGGGGGTATTTGAAATAAGGAAgca tttattcgaagtaatattTGTCAACTtgagttgagctagaatctgagaat gtttGTCTGtgtatctgtctgtctgtaactttggggcagcctggagactt caaaaatggtcggatttggctgaaatttagcacacttgttctttgggtga atatatggggtgttttttttcatttttcaaaaattttgatttttggggcc tagtgacgagtttttcgccaaaacgaggctaaaactttggggcagcctgg agacttcaaaaaattttggatttgcctgaaatttggcacacttgttttTT GGGTTGATATTTGGGgttttttagatttagattttttggGCCTGGGCAAT TATCTTTTGTTTTCCCGGAGCAAGAGGTTCTTACTGGTATTTCTTCTTTG AAGGTTTTGAATCTTCTTTGTCAATTTGAGTAGTCAGGATATAAATGTGA ACGTATTCAATTCGTATTAGGTTATGAAGAGAATGAACCGAGTATCGTTC CCAAAGTGGAAATGCCGTCGGCTGATATCTCTATGGTAACCGGAAGAAGT GAGGTGGAAGAGAGTATGCCGGTTGTTTACGAAACTGGTTCAACGCTTGC AACATCCAAACGTGCTGTCAGTAAGCGAAGGTTGGTTGAGCAAGAATATT TTAACTTGTCTATTTTCCTTGTTCTGTGATATCCAAACTATGAAACCCTT CATGATGGACAATTTTGGCCAAGATTTCATCATGATTTTCACAGTACAGT TCAAATGATCAAGTTTCCGCTtgatttttcttggaaaatttcttttaatc TATTTTCTTTTCCACTGCAGCAAGTCTATGAGCGGACCAATCTTCGGCAC AGCTTATCAATCTAAAAAGTTTAAAGTAAGTGTTGTGTGCTAGCGTATCT TCTTCGGTCAAAAATCCCATGCTACAGGTTTGATGCAGTTGGTTTGATTG TTTAATGGAGAGGTGAAAGCATATTTTCGATGTCTGGATccgtatacctt atcggggaaaacttcgtcggggaaaagtgacgaaattttggacaagtgac gaatattttccccgacgaaaattttccccggccttaatgcgtttaccaac taccagcaagtgacgaatttttccccgacgaaaattttcaccgaggaagt tttccccgataaggtgtAATTTTTCTTATGTCTGAAATCTGATCATTAAA AATTAAGCCTTTGTATAAAATGactctttcaaaattttggaaatttccgA AATTTCCTAAAAAGAGACGGGATAGCAAGATGGGAATTGGATTTGTTAAT TTTCGCTCGCTGTACTAATCTAAAAGCCCAAGCTAACAAAATTATCGCGG TACTTAATTTTTGTTGTAGTGACTAAGATTTCCCCAAACTAAATTACGTG CTATTTATTGAATATGATTTACACGAATCTTATCCCTTTCATGATTGTTT CGTGGTTTACTCGAAAATGTTCTCCGCTTTTTTTTCTCAGACGGAGACGA AAGTGAACCTGCCCAGTAGCAGCGTTGGGAAAGAAGACAAAACCAGTGAA CTCGATGTCGACGAGAAGCCATTGGAGACGGTGGTGGAATCAGGTCCTGT ACAACACCACAACGAGGCTCAGAATCATGAGTACGAGGATGAAGAGGAAG AAATTGTGACCGCTTCTTCACTCTTCGCCAAACAAATGGACTGTAAGTTG TTGATCTTCTAAACGAATCCCATTCCTAAAGACCAAGTGCAgaactttat tattattatacagatTTACAAGCTAGGCTCACAGTGGGCCTCTAACCGAT CTTATTTTACACTATTCTTGAATCTTATTTTGAGGGATGGTTTTCCCATG CATCGTTGAGGTTTTCTTTGAAGGTCTTGATAGACTTTGCTGTAACGACA TTTCTCGGCAGTCTATTCCAGGTTGGCACACATCTGTAATAAAAGGATTT CGTTTGTGGTCCGTGGAAACCGCCATTCGCGAAGTTAGGTAGAAGCTCAC GAGCGTGTCTTCGATTTGGACGCGGACGTTTAGTCAACTTGTCAGGTATT TTGAGCCTATCAAAATACGAAAGGCTGCGGTACGTTGGGACCAATCTTGT TGCACGTCTTTGCACTCCCTAAAGTAAGTTGATATGCTTACGTAATCTTG GTGACCAAACTGATTGTGCGTACACAAGGTGTGGTCGGACAAATGTTGAA TATAGCGTAAGGAGGATCTCCGGAGTTGTTAAGTTGGTGAAACCTGGTTT AATGACACCAAGCATTGAGTTtgctttttttacttgattggCTATATGGT CTTCAAATGTCAATTCAGCATCAACCAATATACCCAGGTCTTTTGTTCAA ATACATGCTCAAGCTGAATATCACCAAGACGATACGGATGAGCGTGTTTT ATATTTACGAATTTGCCGAGTGTAAGGACGTGACATTTATCCGGATGGAA CTGTAATAGCCAATCGTTGGACCATTTTTTGAGTGTGTCTATATCACTTT GTATGGCAAGGGAGTCATAGACTGAATCTACCTCTCTGAAGATCTTTGTA TCATCTGCGAAAAGTAGCAGAGCCGAAATCACCTTTTCAGGCAAATCATT TATGTACAGTGTAAAGATTAGAGGGCCCAAGACACTTCCTTGTGGTATTC CATATAATACACTATCCACCTTGGATTTTGATTGGTTTACTTTGACCAAC TGCTTCCATCCACTCAGAAACGATGAAATCCAGTTCTTTATTGATCCAAC TATGCCATACCCTTCTAGCTTTTTGCAAAGCCTACGATGAGGCACTGTAT CAAATGCTTTAGCGAAATCAAAATAGATGCAGTCTACAACTTTTCCGTCT GATATACTTTCACAGCACCTGCCGACATATTTCAATAGTTGAGTAACAGT GGAACGTCTACTGATGAAGCCATGCTGCTTATCTGATAAAAGGTTTAAGT TTGTCAGGTGGTTCGTGATATGTTCTCGTAGATCGACTCATTCATCAGCT TGCAAACCACGGATGTTAAACTCACTGGTCTGTAATTGATGGCCAAGTTA TGCGCGCCTTTGTTCTTGAAGATGGGCGTGACGTGAGCAACCTTCCAATC CTCAGGTAGTACCCCTTCAGCCAGTGTCTTATTCATAAGCCTTGAAAGGG GCTCGGAAATTTCGTCGACAAGCTCTTTCAACATTCTTGGATATATTTCA TCAGGACCAAAAGATTTGTTTGTATCCAGATCCTTGATCTTCTTACTTGT CATATCTTTAGTTATGATGATGTCTGCAATATCTTGTTCTGTTCTTCGTG GAAATTCCGGAAGTTCTCCTTCAGGCTCGATGGTAAAGACACTGCAGAAT TGTTTTTGGAGAATGTTTGCTTTCTCGTGGTCTTTGTGACGTAGCGATGA CTTGTCTTCAGGTGACTCGAGAAGTGACGAAACACCTGTCGCAGCTTTCA TCTTACTTCTTAGATGCGACCAAAAGACCTTTGGTTTCGTTTTCGGTTTT CGGTTTTCGTTACTTAATTTACTTATAATTAAGTATTTTATTCTTAATTA TGACTATTGGAACTTTTTAGCGCAAAAGGTTTCGAACATTTTATAATGTG AAAATTACAAGATATACAACTCGATGATCGGACCAGAGTTTGATTTGagt tgtatttcttttttttacatcTCAAGggttggaagaaaattttaacctaa ttcaaatttccagggggttaaaagttattttttaatttccaaGGGGTAAA AAGATTGATTTTAGTACACCCACCCTCACATTGGAtccttttttcagttt tttgccAGTTTTCCATGGGATATTCgtaatattttaagatttttttggcT TGAGAAAAGTTTGGCCATCCCCTGTATAGATATAAGTAGAATAGCCTTAT ACagcaaagtttgaaattatcttCTTTCTTTATATGAAGGTGATGAGGAT TACGGAGGATTTGACGATGAAGATGATGGATCGTTTTATTGACCAACAAA TTGCTCATATCTCTTTCTATTTCTGTATTACACATCTAGGTCTCGTCCTA CTCTGTGCAAAATGCCAATGCGTGTGGTTAGTTAGCCTGTATCACCGGGA AATTCACTGGATTAAACTTTAGGAGCTTATCTTTCTTACACATGCAAACG AAAAGCTCTAGCTACAATACAGCTACAAAGTATAGTTTCCTAAACAATAG TATATGTCTTTGTATTGATGGCGCTCTGAAGCCTAGATATGTACTCCACT CTAGGttgatattttcagtttttaaggAATTTTCTTCTCGATTGTAATAA ATAGAAATTTGAAATACTATCAAAAGattcaaaatatattatttattgtt ttaccaaaatctttcaattttccttgttttgaTTTCTAAAATTCCTCAAC TTTTCG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_045584XLOC_045584Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073443-exon-scaffold_92-1491911889:157150..157212TCONS_00073443-exon-scaffold_92-1491911889:157150..157212Clytia hemisphaericaexon
TCONS_00073443-exon-scaffold_92-1510915933:157150..157212TCONS_00073443-exon-scaffold_92-1510915933:157150..157212Clytia hemisphaericaexon
TCONS_00073443-exon-scaffold_92-1575043694:157150..157212TCONS_00073443-exon-scaffold_92-1575043694:157150..157212Clytia hemisphaericaexon
TCONS_00073443-exon-scaffold_92-1491911889:164435..164652TCONS_00073443-exon-scaffold_92-1491911889:164435..164652Clytia hemisphaericaexon
TCONS_00073443-exon-scaffold_92-1510915933:164435..164652TCONS_00073443-exon-scaffold_92-1510915933:164435..164652Clytia hemisphaericaexon
TCONS_00073443-exon-scaffold_92-1575043694:164435..164652TCONS_00073443-exon-scaffold_92-1575043694:164435..164652Clytia hemisphaericaexon
TCONS_00073443-exon-scaffold_92-1491911889:165478..165546TCONS_00073443-exon-scaffold_92-1491911889:165478..165546Clytia hemisphaericaexon
TCONS_00073443-exon-scaffold_92-1510915933:165478..165546TCONS_00073443-exon-scaffold_92-1510915933:165478..165546Clytia hemisphaericaexon
TCONS_00073443-exon-scaffold_92-1575043694:165478..165546TCONS_00073443-exon-scaffold_92-1575043694:165478..165546Clytia hemisphaericaexon
TCONS_00073443-exon-scaffold_92-1491911889:165737..165910TCONS_00073443-exon-scaffold_92-1491911889:165737..165910Clytia hemisphaericaexon
TCONS_00073443-exon-scaffold_92-1510915933:165737..165910TCONS_00073443-exon-scaffold_92-1510915933:165737..165910Clytia hemisphaericaexon
TCONS_00073443-exon-scaffold_92-1575043694:165737..165910TCONS_00073443-exon-scaffold_92-1575043694:165737..165910Clytia hemisphaericaexon
TCONS_00073443-exon-scaffold_92-1491911889:166637..166668TCONS_00073443-exon-scaffold_92-1491911889:166637..166668Clytia hemisphaericaexon
TCONS_00073443-exon-scaffold_92-1510915933:166637..166668TCONS_00073443-exon-scaffold_92-1510915933:166637..166668Clytia hemisphaericaexon
TCONS_00073443-exon-scaffold_92-1575043694:166637..166668TCONS_00073443-exon-scaffold_92-1575043694:166637..166668Clytia hemisphaericaexon
TCONS_00073443-exon-scaffold_92-1491911889:166874..166946TCONS_00073443-exon-scaffold_92-1491911889:166874..166946Clytia hemisphaericaexon
TCONS_00073443-exon-scaffold_92-1510915933:166874..166946TCONS_00073443-exon-scaffold_92-1510915933:166874..166946Clytia hemisphaericaexon
TCONS_00073443-exon-scaffold_92-1575043694:166874..166946TCONS_00073443-exon-scaffold_92-1575043694:166874..166946Clytia hemisphaericaexon
TCONS_00073443-exon-scaffold_92-1491911889:167223..167372TCONS_00073443-exon-scaffold_92-1491911889:167223..167372Clytia hemisphaericaexon
TCONS_00073443-exon-scaffold_92-1510915933:167223..167372TCONS_00073443-exon-scaffold_92-1510915933:167223..167372Clytia hemisphaericaexon
TCONS_00073443-exon-scaffold_92-1575043694:167223..167372TCONS_00073443-exon-scaffold_92-1575043694:167223..167372Clytia hemisphaericaexon
TCONS_00073443-exon-scaffold_92-1491911889:167676..168305TCONS_00073443-exon-scaffold_92-1491911889:167676..168305Clytia hemisphaericaexon
TCONS_00073443-exon-scaffold_92-1510915933:167676..168305TCONS_00073443-exon-scaffold_92-1510915933:167676..168305Clytia hemisphaericaexon
TCONS_00073443-exon-scaffold_92-1575043694:167676..168305TCONS_00073443-exon-scaffold_92-1575043694:167676..168305Clytia hemisphaericaexon
TCONS_00073443-exon-scaffold_92-1491911889:168796..168884TCONS_00073443-exon-scaffold_92-1491911889:168796..168884Clytia hemisphaericaexon
TCONS_00073443-exon-scaffold_92-1510915933:168796..168884TCONS_00073443-exon-scaffold_92-1510915933:168796..168884Clytia hemisphaericaexon
TCONS_00073443-exon-scaffold_92-1575043694:168796..168884TCONS_00073443-exon-scaffold_92-1575043694:168796..168884Clytia hemisphaericaexon
TCONS_00073443-exon-scaffold_92-1491911889:169119..169200TCONS_00073443-exon-scaffold_92-1491911889:169119..169200Clytia hemisphaericaexon
TCONS_00073443-exon-scaffold_92-1510915933:169119..169200TCONS_00073443-exon-scaffold_92-1510915933:169119..169200Clytia hemisphaericaexon
TCONS_00073443-exon-scaffold_92-1575043694:169119..169200TCONS_00073443-exon-scaffold_92-1575043694:169119..169200Clytia hemisphaericaexon
TCONS_00073443-exon-scaffold_92-1491911889:169553..169611TCONS_00073443-exon-scaffold_92-1491911889:169553..169611Clytia hemisphaericaexon
TCONS_00073443-exon-scaffold_92-1510915933:169553..169611TCONS_00073443-exon-scaffold_92-1510915933:169553..169611Clytia hemisphaericaexon
TCONS_00073443-exon-scaffold_92-1575043694:169553..169611TCONS_00073443-exon-scaffold_92-1575043694:169553..169611Clytia hemisphaericaexon
TCONS_00073443-exon-scaffold_92-1491911889:170153..170306TCONS_00073443-exon-scaffold_92-1491911889:170153..170306Clytia hemisphaericaexon
TCONS_00073443-exon-scaffold_92-1510915933:170153..170306TCONS_00073443-exon-scaffold_92-1510915933:170153..170306Clytia hemisphaericaexon
TCONS_00073443-exon-scaffold_92-1575043694:170153..170306TCONS_00073443-exon-scaffold_92-1575043694:170153..170306Clytia hemisphaericaexon
TCONS_00073443-exon-scaffold_92-1491911889:171070..171229TCONS_00073443-exon-scaffold_92-1491911889:171070..171229Clytia hemisphaericaexon
TCONS_00073443-exon-scaffold_92-1510915933:171070..171229TCONS_00073443-exon-scaffold_92-1510915933:171070..171229Clytia hemisphaericaexon
TCONS_00073443-exon-scaffold_92-1575043694:171070..171229TCONS_00073443-exon-scaffold_92-1575043694:171070..171229Clytia hemisphaericaexon
TCONS_00073443-exon-scaffold_92-1491911889:171420..171474TCONS_00073443-exon-scaffold_92-1491911889:171420..171474Clytia hemisphaericaexon
TCONS_00073443-exon-scaffold_92-1510915933:171420..171474TCONS_00073443-exon-scaffold_92-1510915933:171420..171474Clytia hemisphaericaexon
TCONS_00073443-exon-scaffold_92-1575043694:171420..171474TCONS_00073443-exon-scaffold_92-1575043694:171420..171474Clytia hemisphaericaexon
TCONS_00073443-exon-scaffold_92-1491911889:172090..172291TCONS_00073443-exon-scaffold_92-1491911889:172090..172291Clytia hemisphaericaexon
TCONS_00073443-exon-scaffold_92-1510915933:172090..172291TCONS_00073443-exon-scaffold_92-1510915933:172090..172291Clytia hemisphaericaexon
TCONS_00073443-exon-scaffold_92-1575043694:172090..172291TCONS_00073443-exon-scaffold_92-1575043694:172090..172291Clytia hemisphaericaexon
TCONS_00073443-exon-scaffold_92-1491911889:174539..175005TCONS_00073443-exon-scaffold_92-1491911889:174539..175005Clytia hemisphaericaexon
TCONS_00073443-exon-scaffold_92-1510915933:174539..175005TCONS_00073443-exon-scaffold_92-1510915933:174539..175005Clytia hemisphaericaexon
TCONS_00073443-exon-scaffold_92-1575043694:174539..175005TCONS_00073443-exon-scaffold_92-1575043694:174539..175005Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_92supercontigscaffold_92:157150..175005 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
38.3896 41.1655 34.626 37.1554 22.3421 17.7822 18.7657 18.5089 20.045 18.3299 34.5301 24.1198 35.5788 34.8343 28.5903 31.4323 21.6608 27.9703 18.6634 18.9754 28.5454 30.5753 69.6789 61.7654 37.4738 42.7668 18.4535 20.7586 35.7688 42.1917
Blast
BLAST of TCONS_00073443 vs. Swiss-Prot (Human)
Match: TF3B (Transcription factor IIIB 90 kDa subunit OS=Homo sapiens GN=BRF1 PE=1 SV=1)

HSP 1 Score: 318.546 bits (815), Expect = 8.817e-96
Identity = 162/303 (53.47%), Postives = 224/303 (73.93%), Query Frame = 2
Query:  104 GVSCKNCGGTEIDHDQARGDXXXXXXXXXXESLCIVNEVEFQENSAGNASVIGQFVSAEGHHSR----AGYKYSLGRDHRQVILDNGKRLINQLGSNLKMTNHCLESAFMFYKMAVSKRFTSGRRTIHVIGACLYLVSRTEKTPHMLLXXXXXXXXXXXTLGRVFLQLARELCIDCPIVDPSLYIHRFAHQLDFGEKENEVSMSALRIMARMKKDWIHFGRRPSALCGAALIIAAKLYNFEVTMKDIVKLVRMSKTTVFKRLMDFSKTATGKLTTDEFKTVDLEEEADPPCYTEGRNRVKFAQ 1000
            G  C+ CGGT+I+ D ARGD+VC  CGSV+E   IV+EV+F E+S G +S +GQFVS +G         G+  +LG++ R   L NG+R I+ LG+ L++  HCL++AF F+KMAVS+  T GR+  HVI ACLYLV RTE TPHMLLD+ D++Q +V  LG+ FL LARELCI+ P +DP LYI RFAH L+FGEK +EVSM+ALR++ RMK+DW+H GRRPS LCGAAL++AA++++F  T+K+++ +V++ ++T+ KRL +F  T T +LT DEF  +DLEEE DPP YT G+ +++  Q
Sbjct:    3 GRVCRGCGGTDIELDAARGDAVCTACGSVLEDNIIVSEVQFVESSGGGSSAVGQFVSLDGAGKTPTLGGGFHVNLGKESRAQTLQNGRRHIHHLGNQLQLNQHCLDTAFNFFKMAVSRHLTRGRKMAHVIAACLYLVCRTEGTPHMLLDLSDLLQVNVYVLGKTFLLLARELCINAPAIDPCLYIPRFAHLLEFGEKNHEVSMTALRLLQRMKRDWMHTGRRPSGLCGAALLVAARMHDFRRTVKEVISVVKVCESTLRKRLTEFEDTPTSQLTIDEFMKIDLEEECDPPSYTAGQRKLRMKQ 305          
The following BLAST results are available for this feature:
BLAST of TCONS_00073443 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
TF3B8.817e-9653.47Transcription factor IIIB 90 kDa subunit OS=Homo s... [more]
back to top