Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00073441 (transcript) - C. hemisphaerica

Overview
NameTCONS_00073441
Unique NameTCONS_00073441
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length3329

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00073441 ID=TCONS_00073441|Name=TCONS_00073441|organism=Clytia hemisphaerica|type=transcript|length=3329bp
AGCCAGTTGAAAAATATGGCctaaaaatgctaaaaacgaCAGAATGTGGA
AAATAAAACTAACCATCTTCTTCTGAATTCATCAGCATAATCATTCCCCC
ATAATAGTTGCTTCTAAAATAATCAGAATCAGAATTTGGTACTATATTGA
TATCACCAACTCCAAGATCTTTCCAAGCTGGCTCTCCTCCAGATTCTTGC
TCTTGTGCCTTGTATAATTTGACTCTTTTTTCCAGAGTCCTGGCTTGATG
ATACCTATTCatctttctttgatttcattgATGCATTCTGAACGAGATTG
CAAATGATCCAAAATTGGAATTTACTTTAGATTTTCCAAAACATtcaaca
ataaagacaaaatatCAGAATTGTCCGCCAATTTGAAATTGATTCCATTG
CTAAACGCACCAAGGTTCGGAAGAAGCAAGATTCTAGCCTTGGTCCGACT
ATTAAACTGAAATATTCCCGTGATAGGGAAAGCACTGTAACTCTTCTTCC
GAATGAGTGATGAGCTCGGTAAACATTTGGTCAATGAGCTATTTAGACCA
TAACTGATTAAGATCTGTCTCATTCAACGAGCGCAGCCAGTTAGGTTTTA
AATTCACTATGATGTGTTTACGATTTGTTTTGGATTACATCATGATCCGA
CTCAGCTTTCCAGCATGGCGTCAACATTTTTTTGTGCTTTTTAAGAACCA
CACTGTATTTAATCTgaaatgCAACCTTACTAATAAAGAGATATCGAGCA
ATATGGGTGTCTCGTGCAAGAACTGTGGTGGGACTGAAATTGACCATGAT
CAAGCTCGCGGGGATTCAGTATGTGTTGGATGTGGGTCAGTTGTAGAGAG
TCTTTGCATTGTCAATGAAGttgaatttcaagaaaatagcGCTGGTAACG
CTTCTGTTATTGGCCAATTCGTTTCTGCAGAAGGGCATCACAGCAGAGCA
GGATATAAATATTCTCTAGGAAGAGATCATCGTCAAGTCATCCTAGATAA
TGGAAAACGTCTTATCAACCAGCTTGGTTCCAACCTGAAGATGACAAACC
ATTGTTTAGAATCTGCTTTCATGTTTTACAAGATGGCAGTCAGTAAGAGG
TTTACATCAGGTCGAAGAACCATTCACGTCATTGGCGCTTGCTTGTACCT
GGTCTCTCGAACGGAAAAAACTCCTCatATGCTACTCGATGTTTGTGATG
TTGTGCAGTGTGATGTTGTGACCCTTGGTAGAGTGTTTTTACAATTGGCG
CGAGAATTATGCATCGATTGCCCCATTGTTGACCCATCATTATACATCCA
CCGCTTTGCACATCAGCTAGATTttggtgaaaaagaaaatgaagtctCCA
TGTCTGCACTTCGTATTATGGCTCGAATGAAAAAAGATTGGATACATTTT
GGGAGAAGGCCTTCAGCTTTGTGTGGCGCAGCTTTGATCATAGCAGCCAA
ATTGTACAACTTCGAGGTGACCATGAAAGACATTGTGAAGTTAGTTCGCA
TGAGTAAAACGACCGTTTTCAAACGATTGATGGATTTCAGTAAAACAGCC
ACTGGTAAATTAACAACAGACGAGTTCAAAACAGTCGACCTTGAAGAGGA
GGCCGACCCACCTTGTTATACAGAAGGGCGTAACCGTGTCAAGTTTGCAC
AAGAAATAAGTGGACAATATCATTTTGTATCGACAGATGTTTTAGCACAA
GTTACACgaactcaagaaaaattagaggAATTGCTGgataaaaggaaaaa
tattcAATTCGATATCGAAGATACGAAATCGGAATCCAAAGCATTCGATT
ATAGAAAAGAACTACCGCGAGATTATTCTTTGTACAGTTACGAATTAGAC
GAAAACGGTGAATTTAAGACACCATCAAAGTTCATCATTCATAAAGAAGA
AGGTGGCGTCAAGAAACCTCCAGAGAATGAAGagccttcttcttcttctt
cggaGAAAGATGAgaatgatgagctgaatcaaaTGAAAGGAACTGTCGCT
AGCAGCACTCTTATTATCGATCAAAGTCGAATACAAAAGGTCAAGTGTGA
TGAGAAAAAACAATTGAAAGAAGAAAGTAACCAAGGCAACCAAAACAACA
ATAGTGATGAAATCGACCTGGATGGAATTAATGATGACGAAATTGACATG
TTGCTGCTAACAgaagaagaaatcaaaatcaaaacagaagTTTGGTTGGA
AGAAAACCGAGAGTACCTCATCAAAATGAAAGagaaagaagaagagcaac
gaagaaaagaagaagaagaaaataaagatgGCATCAAAAAGAAGAAGCGA
AAATACAAgcgaaaaaacaacaaagatcgACCGGTTTGCGAAACTGCAGA
CGAAGCAATCAAAACGATGTTGGCGGAACGTAAACTTTCCAGTAAAATCA
ATTACGATGTCCTGCGAGGCTTGAAGTCTGAAGATAATATACCAGGTTAT
GAAGAGAATGAACCGAGTATCGTTCCCAAAGTGGAAATGCCGTCGGCTGA
TATCTCTATGGTAACCGGAAGAAGTGAGGTGGAAGAGAGTATGCCGGTTG
TTTACGAAACTGGTTCAACGCTTGCAACATCCAAACGTGCTGTCAGTAAG
CGAAGCAAGTCTATGAGCGGACCAATCTTCGGCACAGCTTATCAATCTAA
AAAGTTTAAAACGGAGACGAAAGTGAACCTGCCCAGTAGCAGCGTTGGGA
AAGAAGACAAAACCAGTGAACTCGATGTCGACGAGAAGCCATTGGAGACG
GTGGTGGAATCAGGTCCTGTACAACACCACAACGAGGCTCAGAATCATGA
GTACGAGGATGAAGAGGAAGAAATTGTGACCGCTTCTTCACTCTTCGCCA
AACAAATGGACTGTGATGAGGATTACGGAGGATTTGACGATGAAGATGAT
GGATCGTTTTATTGACCAACAAATTGCTCATATCTCTTTCTATTTCTGTA
TTACACATCTAGGTCTCGTCCTACTCTGTGCAAAATGCCAATGCGTGTGG
TTAGTTAGCCTGTATCACCGGGAAATTCACTGGATTAAACTTTAGGAGCT
TATCTTTCTTACACATGCAAACGAAAAGCTCTAGCTACAATACAGCTACA
AAGTATAGTTTCCTAAACAATAGTATATGTCTTTGTATTGATGGCGCTCT
GAAGCCTAGATATGTACTCCACTCTAGGttgatattttcagtttttaagg
AATTTTCTTCTCGATTGTAATAAATAGAAATTTGAAATACTATCAAAAGa
ttcaaaatatattatttattgttttaccaaaatctttcaattttccttgt
tttgaTTTCTAAAATTCCTCAACTTTTCG
Run BLAST on NCBI

transcript from alignment at scaffold_92:156498..175005+

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00073441 ID=TCONS_00073441|Name=TCONS_00073441|organism=Clytia hemisphaerica|type=transcript|length=18508bp|location=Sequence derived from alignment at scaffold_92:156498..175005+ (Clytia hemisphaerica)
AGCCAGTTGAAAAATATGGCctaaaaatgctaaaaacgaCAGAATGTGGA AAATAAAACTAACCATCTTCTTCTGAATTCATCAGCATAATCATTCCCCC ATAATAGTTGCTTCTAAAATAATCAGAATCAGAATTTGGTACTATATTGA TATCACCAACTCCAAGATCTTTCCAAGCTGGCTCTCCTCCAGATTCTTGC TCTTGTGCCTTGTATAATTTGACTCTTTTTTCCAGAGTCCTGGCTTGATG ATACCTATTCatctttctttgatttcattgATGCATTCTGAACGAGATTG CAAATGATCCAAAATTGGAATTTACTTTAGATTTTCCAAAACATtcaaca ataaagacaaaatatCAGAATTGTCCGCCAATTTGAAATTGATTCCATTG CTAAACGCACCAAGGTTCGGAAGAAGCAAGATTCTAGCCTTGGTCCGACT ATTAAACTGAAATATTCCCGTGATAGGGAAAGCACTGTAACTCTTCTTCC GAATGAGTGATGAGCTCGGTAAACATTTGGTCAATGAGCTATTTAGACCA TAACTGATTAAGATCTGTCTCATTCAACGAGCGCAGCCAGTTAGGTTTTA AATTCACTATGATGTGTTTACGATTTGTTTTGGATTACATCATGATCCGA CTCAGCTTTCCAGCATGGCGTCAACATTTTTTTGTGCTTTTTAAGAACCA CACTGTATTTAATCTGTAAGTGTACTGTTTCAAGAAATAGGATGaagttt tttgaactttttagggAAGACATGAAGGGGGGTGCTGCGTGACTCCTTTT GCCTTTTCATTCCAGAccggttggcaaacgatatcatccaccaggatgca tcctctcttattttccccctattttctactttcctatcttttATATCCTG ATTTCTGACTTTATCTAGTGTTTCTatctgttttctaagtatttttctga aatttgactGTACCGGTGAAATTggtctccgaccccggctcgaacgacca aatgcaagcaaccttggtatAATACATCCCCAATGCCTAACGTTGCCTAA CCGCTTGCGCCACACCGAAACACGACAGGAtactgtcattcacaaatact tatagcgtgtaattcagtcaggcacatcctggcaaatgaacggggtattt ttcacttgcgaccattgccaaatgaacggggtcgaaaacgaaagtgacgt aatagggccgaatacccagtttaattgaaccgggttggaaatattttgct tcatttcaaagaactgcatagatgaaattttttttccatgggtcaatttt gtcttcgaagattgaagaaacttttaatgaaaaaataaagttcccagttg tcttccttttttccctttttcagtttgaagttcattttttttattttcac gcttttagcctgagacgtcctatctcatttacactgggtgacgaataccc catgcaaatgctcaccccgttcatttgccaggatgtgcctgactgttgta atttacagacctttattaagaaagctcccaaccctaccggtgccacTACa aggatcccgtagggatcctaAATAAGGTCACAGGGTACagatgcccctaa gaaggcctgcggccttatattgtgactctcgagctccaaccctaataTTA TCTGATAATAACCGagcccccgtctaggtccgcagattgaaaaatttcac ttgcatcctggtggatgatatcgtctgccaaccttCCAGACCAGACATGA CGCATGAGTTGTGGTCCAGACTGGATGGAGTTTCCCCTAGTCGTTTTCTG CTAAAGAATGGCCATTGGGCGGgctaggaccctgccgacgcaccggactg tccagtgtatttgtccggtggcaaaaagaaaagtatccttgagctacacc ggacgcaatcagtccggtgtcagtccggtgttgcatacagggaattttgg acgccggacatttatgaaacaaaaaattaaaaacactggacgcaccggac tggtcatgtcctgtgttttgattgtccggttggaaaaaatatccttctct gacaccggacatccaacttccttaagtccggtgtagaaattgtccggtgg taaaaaaaattctcattttacaccggactttcgcatgtccggtgttcgtt aagtccggtgcgtcggcagggtcctggcaggctattccaaaaatatatac aggGGTATTGGCAAACCTGTTACACCAACccccttgaaaattttgaataa caaattatccTTTGAAAATTTGGGCTAGCTAACTAGATAGAGTCCCCTGG GGAagttgaaattttatgaaaaagggACTGGAAAACATGCCATGAGCGGA GAGAAATGATCCCCTTGGAACAAAATTCCCCTGGAAAAtctactgtcaac tgctctaacttgggacgattggtttggcctgtattttcacttactgttaa atctcaatatgacaacaaatttgttttgcaagtttatcaatcatactttc tgtcataacatgtcacgataactcgTGTGTACTCCACTGTTACGGAACaa ctttcatatttcaatttaaaagcctactcggtgcgaaagagaaattgtgt attttttaacgGATACAGGGTatgtccagacgatctcaatcaaacagaat cgacaatcgaaccagttgaaccaaattgaacgtaatcgacccattgaaat tcgattggcgaacgcaatcgaatctcaatcgaacatcaaagttctgggta atattcgattttttatgtttggaagaaaatttttacatcAGTGGTTGCCA AATAAGGAAAAGTCCAATTAAACATATACGAACCTAATCAAACGCATTCA AACACATTCGAATACGAATCctaatcaaacgcaatcgaatatcaatcgaa tctgaaaattgcggtaatattcgattgagattcgattgcattcgacaatc gaatttcaatcagtcaATTGCGTTCGGTTTGGTTCGATCgtcaattccgt tcgattgagatcgtctgggtaTGTGAACATGGTGAATTCACACActcaat tttctcgagattcgaaaaaataaaaacacaaaaattgttCTCTATAGATT TTTTcttgtagaaaaaatattttatatattatttcaaagaaacatACACA ATGTTTAAAAGGTACATCTATTGATACGTTTCAACTTTTGTGTTCAAATG ATGTCAAAGAAGCTTTTTTGTTTGTGTGAGAGAGACTCTTCTTCGTAATA AGTTCTCTGAAGGATTCGCATTCATCTTGTTATCAAACATCAACGGTGGA GATTATTTTGGCAGAATTTTGTGAGGATAATTACatagttttgcatactt ttcacaaattttCATTCTTTCAGACTGCTCGGGTGAGTTAGGGAgtgtct agatttttaaaaatcccAGATCCCAAATTCGCGATcaatagcacccattc tcagggattcacttatggatttttagatgccctataccttaaggtttcag gacccggttgtggtgtaattaaatattaacctaaaaattaattattatgA AAAGTGtaagttatgacgtcataaatcacAAAATAGCTCCAACTCTATAA GTGAgtcgggttggtgtaatttaagatgcatgATCTAACGATTTAAGATT CACAATgtgcgatccatgcataaagtatgctgattattcctaataattgt CATAAAGCTTTAAATTATaaaacataattctaaaacaatggcataatctt ttctcgcttttgtttaccatgttgaatttatgcaacaaaatagaaataag taAGCAATGGAATTACGAATAtttacgaccgtaaaattatgaaaaaaact aacttacATAATATTGATGATGAGAAAAAAAAGTAGaatgcacaagaaat attttttctctcaacctctcagttttaacaatcataatcaaatataggaa tttctttcttaaaggaaataaaagaatatattgacgaacaatatgtTCTg aggaccgtaatgtacgaagcaaaaaacgggtGCTCTATTAATTGTCtaat gagaaagaattttctttcagtaaacaattcccctatattgATTCATTGAT TGATTCAAATTGTGAAAGAGTACAGGAGGTGAATGCactttaaatttctt taaatataatttgCATTATCTTggataaatgatgtttttgaaattaattg agtttcagcgaatgaaggggtcatgcagttattatataaacactatgaca attactaccgtggtggtatataaaccaaaatttgggaaaacagttactcc accagtggactaactgcaaNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNtagtacactatggaa taactgcaagggtggtggtgtctgtagaaaatgtccaaaattgcagttac tccacatagtgtcaaggagtaactgcaagaccccccctgAATGAAAGTTa gtaaattgcctaaatattttagcatgattagcataattacgcatgaatta acatattttatgcaaggatcgcgaatcgtgcatcgtgaatcgttagatcg tgcatcttaaattacaccaacccaagtgagtctgctaaattgtgtgggtt gcgtgggtgcgtgggtcaatatttttgcgtgggtcatttttttgtgtggg tcaaaatattttttgcatgggtcaaattttttgtgTGGGTCATATGTTTT GCATGGGTCATAtgttttgcgtgggtcaaattttttggttgggtcaaatt ttttgcgtgggtcatattttttgtgtgggtcatatttttgcgtgggtcat tatatttttttgtgtaggtcaaaatttttgcgtgggtcaaaattctctct gtaattcgaaaaaataccTTCCCTTGAAATTTGAACTAGTTACAtccaaa atgttggatgtgttttacataacaccttttggtttattttgtttattttg catagcTGTACTTGTACAGTTCCATAATTTCTGAATATGGTGAATTTGTT CCAATAAACGTGTTCAGAAAGAATGTTTCCAACAGGGGAGTGTCTTTTTA TAAGTGGAATGTTCCCTTTTGGGAGATTTCGTCCAAAATTAATACTGTAG TTACGTTTTGTATATACCTAAGAATGGCAAAAAAAATGTACACAATTAAG cggctttatattttttttaattccccTAACTAAACATGTTAGCTTTTATA GCTTCTTGTAGCACGCTTTAATCTTTTGGGTTGCCTTTGAGTGTTAAAGA ACAAAGCAAATGACgacaaaatctgaaattttttttacaaaagttatGTT CATTAGGTGACCGATTACTAAACAATTTAATTGTTGTCAATTATTTTGTC CACCCCACTggtaatttctttgatttaagtacattaaaggccaattaaaa aaattggacgaaataaagacgctgtactttttttcaaaacaagagAAAAG GAGAGGAAAAAATTCAATAGAAAGGAAAGAAGCAATGAACGGTCATATCT CATTTTTGTTGCTTAAAGTTATAGTGTTTATTTCCATGACACTGGAATCC TGAAATATATcatgctaaaattcaaaagtgagatCCTGAAGTTTGTCTAC AAAAATTAGACGGGTGTGTGTTGATTCTGTATAATATTATAGTAAATAAG TGCAGCTATGCAAAATAAACCACAATGCGTTACATAAAAACGAtgtgctt ttgtttagttttcgtagatacacaacacatttttgtataaaataacttga aaattttaatttgacaaaaaaacgagttagctaactcgaaagttttaatt tggtaaaaaaattgagttagcTGAAAANGTTAGCTAActcaaaagtttta atttggtaaaaaaatcgagttagctgaaaaatcaacaaaaaaatagtGAT CCACGCAAAaactttgacccacgcaaaaactttgacccacgcaaaaaata tgacccacgcaaaaaatatgatcATTAGGCGACTACTCATTAGTAACTAC AGTATTAATTTTGGACGAAATCTCCCAAAAGGGAACATTCCACTTATAAA AAGACACTCCCCTGTTGGAAACATTCTTTCTGAACACGTTTATTGGAACA AATTCACCATATTCAGAAATTATGGAACTGTACAAGTACAgctatgcaaa ataaacaaaataaaccaaaacgtgttatgtaatacacatccaacattttg gaTGTAACTAGTTCAAATTTCAAGGGAAggtattttttcgaattacagag agaattttgacccacgcaaaaattttgacctacacaaaaaaatataatga cccacgcaaaaatatgacccacacaaaaaataatgacccacacaaaaaat atgacccacacaaaaaatatgacccacacaaaaaaatatgacccacacaa aaaatatgacccacacaaaaaatatgacccacacaaaaaataatgactca cgcaaaaaatatgacccacgcaaattTTTGATGCACGCACCcatgcaaaa atattgacccaagCACCCACGCAACAGACGCACGCATAAGTACATGTaga atctttgtcaaattttgaccaaagatgcatcttaaTTGTGCCAAGCTTTT CAACGAAAAattgacgtcagcaaaaattgcaaaaaatcgaaatatgcaat attttgctgacatcatcaaattttcaaaaaaaattttcaaNagcaaaaat tgcaaaaaatcgaaatatgcAATATTTTGCAGAcatcatcaaatttttca aaaatttttttctcaaaaagttacattttagtTCGATGCATCTATGGTTC AAATTTGTATGTATTGTATGCatttttaatattatagcgATTTTACGATT Catcatgacgtcaccaaattcgatcaaattatgatgtcataattacaatt tttttaattatagaTTTTTGTGGTGATATTTAATTAGGTCACAACCTGAT TGATAAACTTCaaggtatagaggtactttagagccctaatctggctgcta ttggtCGCTTACTTAGGGTAAACTGCTAGGTAtttgagacttgccctaag tcaaTTGAGTGAAACCACTTTTTCATACCCATACCCACCATCGCAATTTT TGTGTAAACAAATCACGAAGTTTTCTCTCTTTCTGAGTCTGATCtaaagt tttttacaagaacataaaCTGACATGAGGACTTTTTGAGACTATGATTCT GACCTCTTATAAGTAAAGTGAATTAAAGATATTATATACATGTGTGTGGC ATGTAGCGATGGGGTAGAGTATTCCTTCAATAATCGGATTCGAAAATCGG GATTACATTGGAAAATCATGGTAAACCGGAATTTTCACACAGTGATAAAA ATTCCTGTATCCGCCCCTGTGCTAGGTTAGACTTTGACCGCTAAGTTGGG TTGCGACCGCTGGCAGAAAAAAGTACACCTCCCCGCCAACCATAAAACCA CAAAAATAAAAGGTGCACAAAAATTGATGAGATTATTAAGCTAAAGTATT TGATTTCTCTCTCCTTTAGAAATACAAAAAAGATTATTGCAACTCTGAGA AATCTTGTTGACATTAACTaactattattttttaaaggaaatgCAACCTT ACTAATAAAGAGATATCGAGCAATATGGGTGTCTCGTGCAAGAACTGTGG TGGGACTGAAATTGACCATGATCAAGCTCGCGGGGATTCAGTATGTGTTG GATGTGGGTCAGTTGTAGAGAGTCTTTGCATTGTCAATGAAGttgaattt caagaaaatagcGCTGGTAACGCTTCTGTTATTGGCCAATTCGTTTCTGC AGAAGGTAGGTGAAAAATGAATaaagcttttctttttttcttgagtTTTC TTGTGCTActataatacaataatgaccggttagtgaggttTGTACTGAGG AATATTGCCcaaggtcaagtaacgaccgagcttgcaaGGTTGTTGCGATG ACcaagggcaatattttcagtacatcccgaaaaaaccggtcttttttgta tttgttaaccgtttccttcagcttcggttgatttttagcgctttatccag gaaaaatagtgaaataaagtgaaaaaggcaagcgaaaagagatgaaaaat tgctataatttctgacgtcagaaatagaaaatgagagaaatgatgttaAC GNAAAAGGCAAGCGAAAAGAGAtgaaaaaatgttataatttctgacgtca gaaatagaaaatgagagaaatgatgtcaacacATTGTtcatttcctttga aaaagtgacgtcacaatgaattttcctaacgacgggcaactctggacagt gtaggcccgtcgtcgtgcaaaaagaaccaattgtattgcgcaaaaagccg tgtagcccgctttgaaaaagtaacgGGTTAACAATGTGAGATGTTACATA TTGAGATGTCAATAAAAATAATGTTGCTCCAAGACCACCAGGTAAGAATG GTCAACAACAACAGCTTGTTCCGATTTAATTCTACATTGAAAATAATGAT AACAATTTGTCCCCTTTGCATAGCAAAGTCATTACAAGAACTTGATTTTA ACCTAATCAATCAAACCACGGCACGGTTAAACATGTTATTGTTATAAATT CACTGATTCAATAATCTTTAATTTTTCCAGGGCATCACAGCAGAGCAGGA TATAAATATTCTCTAGGAAGAGATCATCGTCAAGTCATCCTAGATAATGG TAAGAAACCTAAATCTTGTATTTTGCAGTATAAACCTTGGTAATTTTATT CTAGAGaatctttgaaaagttttggaaGTAAGTCTGGAAACTCTCGCTTT GTAACAAAATCTGTAGTTAGAGTTTTGTcccaattttgtttttgatcaaa atcagatgAGTACCCTATTTTGATGCTGGAACTTTTTAGGAAAACGTCTT ATCAACCAGCTTGGTTCCAACCTGAAGATGACAAACCATTGTTTAGAATC TGCTTTCATGTTTTACAAGATGGCAGTCAGTAAGAGGTTTACATCAGGTC GAAGAACCATTCACGTCATTGGCGCTTGCTTGTACCTGGTCTCTCGAACG GAAAAAACTCCTCGTAAGTTGCAATCAAGAATCAAGTCAacagaattttt tgaaaagacaaTAACTGAAAGAGTGAAGAAGATGAAGCAGATTTCATTAT TCttgcttttatttttagatATGCTACTCGATGTTTGTGATGTTGTGCAG GTATTTactttgaaatttattgaaaatcacCTGATCAATTTCCGACAGAG GAATATTGctcatattttttgttgaattagGTCAATTTTAGTAAGGTAAT ATCATTAAGTCGTGACATTGTGTTTACTTTCTGCTGCTACTAAAGATACA TAAGCTTTAAGGTTTGAAttcaatcttaaatattttgtcTCCCAACTTTC TTAAGTGTGATGTTGTGACCCTTGGTAGAGTGTTTTTACAATNTTTTGTc ccaattttgtttttgatcaaaatcagatgAGTACTCTATTTTGATGCTGG AACTTTTTAGGAAAACGTCTTATCAACCAGCTTGGTTCCAACCTGAAGAT GACAAATCATTGTTTGGAATCTGCTTTCATGTTTTACAAGATGGCAGTCA GTAAGAGGTTTACATCAGGTCGAAGAACCATTCACGTCATTGGCGCGTGC TTGTACCTGGTCTCTCGAACGGAAAAAACTCCTCGTAAGTTGCAATCAAG AATCAAGTCAacagaattttttgaaaagacaaTAACTGAAAGAGTGAAGA AGATGAAGCAGATTTCATTATTCttgcttttatttttagatATGCTACTC GATGTTTGTGATGTTGTGCAGGTATTTactttgaaatttattgaaaatca cCTGATCAATTTCCGACAGAGGAATATTGctcatattttttgttgaatta gGTCAATTTTAGTAAGGTAATATCATTAAGTCGTGACATTGTGTTTACTT TCTGCTGCTACTAAAGATACATAAGCTTTAAGGTTTGAAttcaatcttaa atattttgtcTCCCAACTTTCTTAAGTGTGATGTTGTGACCCTTGGTAGA GTGTTTTTACAATTGGCGCGAGAATTATGCATCGATTGCCCCATTGTTGG TGAGTCTTATTATTCATCTACAAGTGGCAGCTGTCAAAGAAAAAATCCAT ATTTTACACCCCTCCTTTTTTGATAAGGGATAATTTACATAAGGGTTTCA AGGAAGGGTCAAGTTTCAAATGTAATGGGCTTTAGGCTCATAGAAGATTC ATTAAACTTTTAGGCCAAAGAATTGTCTTTTTGAAGACTACTTAGCCTGT TGTTGATTCAGCCGttgattttgaactttttttggtgCCCGATTTTGAAT CTCTAATACTTATTTTCGCACACAGACCCATCATTATACATCCACCGCTT TGCACATCAGCTAGATTttggtgaaaaagaaaatgaagtctCCATGTCTG CACTTCGTATTATGGCTCGAATGAAAAAAGATTGGATACATTTTGGGAGA AGGCCTTCAGCTTTGTGTGGCGCAGGTATGTTATGTGTTTGTGGTCATGA AAGAAATCACTTCCCAAAAAGAACTAAAtctctgtaaaaaaaatatattg ctctgccacccaaatctcctgattgaatatagttggacagaaattcttat ttcttcacatatatatctcttcgatttttttattcaatttgcGATTTCTA GTGCAGCGTCTTTTGATTGACCTGGCTTTTTTCGCTAGATTTTTActtgt gtcccaaaaaaaatcattttgaaaagatGAGTTGAAAGTCAAGCAAATAA ATCTGCGTGATTTTCTTTCGTTTCATAGCTTTGATCATAGCAGCCAAATT GTACAACTTCGAGGTGACCATGAAAGACATTGTGAAGTTAGTTCGCATGA GTAAAACGACCGTTTTCAAACGATTGATGGATTTCAGTAAAACAGCCACT GGTAAATTAACAACAGACGAGTTCAAAACAGTCGACCTTGAAGAGGAGGC CGACCCACCTTGTTATACAGAAGGGCGTAACCGTGTCAAGTTTGCACAAG AAATAAGTGGACAATATCATTTTGTATCGACAGATGTTTTAGCACAAGTT ACACgaactcaagaaaaattagaggAATTGCTGgataaaaggaaaaatat tcAATTCGATATCGAAGATACGAAATCGGAATCCAAAGCATTCGATTATA GAAAAGAACTACCGCGAGATTATTCTTTGTACAGTTACGAATTAGACGAA AACGGTGAATTTAAGACACCATCAAAGTTCATCATTCATAAAGAAGAAGG TGGCGTCAAGAAACCTCCAGAGAATGAAGagccttcttcttcttcttcgg aGAAAGATGAgaatgatgagctgaatcaaaTGAAAGGAACTGTCGCTAGC AGCACTCTTATTATCGATCAAAGTCGAATACAAAAGGTCAAGTGTGATGA GAAAAAACGTAAGCTGTAAACGTGTTTTGAGTTCATTTTATCCACGATTG AAGTCCTTTTGATTCACCAGTCTGATTACGTATGATCTTTTAAATTTCCA CGTTCGAAATATGCTATCGTATTTTTCTCTATTCAAGTTTCCTTGGTTAT AGGAGTGTGGCCTTTCTATTAATTGTAGAGTCCACTTTTTAAATACTCGA ATATTTTCACACTGAGTGCATTTTCTGGTTAAAAATAATAGCGAGCAAAT CGTAAACTGCTCTATTTTTGAGTCAGCGGTTAAGAATTTATCATTTGAGT CTCTTCTTTTTTTCGCaaatattttctatttgatACCTTATTGGGATGTA TAATGCTTATTGGAGGGTGGTTCTTGATAGAGGATGGTGCTTTAGGGCGG CTCTTAAAAGAGAACAGTCGTGATTTTTGTCACCTTTTTTTTAGCAGACT CATGAATATTACGCATTTAATACTTTAATTAAACCTACTTCTCTTCAGAA TTGAAAGAAGAAAGTAACCAAGGCAACCAAAACAACAATAGTGATGAAAT CGACCTGGATGGAATTAATGATGACGAAATTGACATGGTATTTATTTAtc aattcattcattcatccatcCTTTCATTTTCATCCGAGtgatttgttttt ttagttGTTTGAAAAGATTCCAAGAAATAGTTCATACTTGAGCTTGGGTT TAGGTAGAGgataatattattttcatcaatttctgaacaaggaaaattta ctctttcattacTCATCGTACACGGGAAGCTTTTTTGTATAATTCTTCTT TTCCGTTCTACATGATTTCAGTTGCTGCTAACAgaagaagaaatcaaaat caaaacagaagTTTGGTTGGAAGAAAACCGAGAGTACCTCATCAAAATGA AAGGTTGATAATCCTTGTTTGTTGCTATACGCGTCTGTAAAACACTCTGT CTCTCTGAACTGCTAAAAACTTTGTAGCTGATGGAAGGAGCTGAATTCTG ATCGGGATAGAAAATCATCTGTTTTTAATTGGTAATGGTATGGACTCTCA AAATTACAGCGACTTTTGCAATTGATCTGAAGCATCGGGGTATTTTTCTC ACCGTGACAATTTTACTGCAAATTGATATAAGGTTGTACTAAAGTATTGA AAATGCCTTCTTAGTAATCATTTTAAAGTAACTAAAAATAGCTTGACCCT GGTCCGAATTCAGAAGGATTCCCCTGTTTAgtatgattttgttttttttg tacagagaaagaagaagagcaacgaagaaaagaagaagaagaaaataaag atgGCATCAAAAAGGTTCGTTCACTTTGTTGACCATAGACTTTTTCActt ttccatccgccatcttggatcatatgcaaaaatacagaaaaGAAAAAGCC GGGGTTGGATtcagttggaaaatatgcaaaacatatgcaagtttacacaa agattataAAGCGAACAAGCAGGAACAAGAAGAAACATTATACTCATTAA AAGAATGAAAGATCAAACTTCAAAGTTCAAaaagaaatactaaaaaaaac attaaaaatttaaaagaaatcttttttttgccatgctattcccaggagaa taatttatcgtcagccgaataaggattattctTGCAACTTTGCTGATGAT CTTTCAGCTTGAGTTtttgtctaatgttatggtcttttgaagggCTGGTT CTAAGAGGCGAGAAAATATAATTATTTCTGGTTTTCAAGAGGGGCAAAAc caatctttcttctacaagattaaactttaatataatgcctgCCAATTATG GAGTCAAAGAGGCTCCACTATGGAAAGTTTAACTTTAGAGTTTATCTTTT TTCAGAAGAAGCGAAAATACAAgcgaaaaaacaacaaagatcgACCGGTT TGCGAAACTGCAGACGAAGCAATCAAAACGATGTTGGCGGAACGTAAACT TTCCAGTAAAATCAATTACGATGTCCTGCGAGGCTTGAAGTCTGAAGATA ATATACCAGGTGAGAAGCCAGTCATTTGCTTGATTTACCGAATCGATCTT CATTTACCGTATTTTTCGAGAAAACGCACCAGGcatttattgaatttatc aGTTTTGGTTGGGCTTTGAAGGGGAACTTTATTTTGCCTTTCTGTTTTAT TTGAGTACAAATTTTTGACCCTAATAAAATCAGTTCgaacaatgaaaaaa taaacgacCCTCCTAGGGAGGCGATTATTCGAAGGGGACGTTTAGAGAAA TTTTTTCTCATAGGAGGGATATTTATTAGGGGGTATTTGAAATAAGGAAg catttattcgaagtaatattTGTCAACTtgagttgagctagaatctgaga atgtttGTCTGtgtatctgtctgtctgtaactttggggcagcctggagac ttcaaaaatggtcggatttggctgaaatttagcacacttgttctttgggt gaatatatggggtgttttttttcatttttcaaaaattttgatttttgggg cctagtgacgagtttttcgccaaaacgaggctaaaactttggggcagcct ggagacttcaaaaaattttggatttgcctgaaatttggcacacttgtttt TTGGGTTGATATTTGGGgttttttagatttagattttttggGCCTGGGCA ATTATCTTTTGTTTTCCCGGAGCAAGAGGTTCTTACTGGTATTTCTTCTT TGAAGGTTTTGAATCTTCTTTGTCAATTTGAGTAGTCAGGATATAAATGT GAACGTATTCAATTCGTATTAGGTTATGAAGAGAATGAACCGAGTATCGT TCCCAAAGTGGAAATGCCGTCGGCTGATATCTCTATGGTAACCGGAAGAA GTGAGGTGGAAGAGAGTATGCCGGTTGTTTACGAAACTGGTTCAACGCTT GCAACATCCAAACGTGCTGTCAGTAAGCGAAGGTTGGTTGAGCAAGAATA TTTTAACTTGTCTATTTTCCTTGTTCTGTGATATCCAAACTATGAAACCC TTCATGATGGACAATTTTGGCCAAGATTTCATCATGATTTTCACAGTACA GTTCAAATGATCAAGTTTCCGCTtgatttttcttggaaaatttcttttaa tcTATTTTCTTTTCCACTGCAGCAAGTCTATGAGCGGACCAATCTTCGGC ACAGCTTATCAATCTAAAAAGTTTAAAGTAAGTGTTGTGTGCTAGCGTAT CTTCTTCGGTCAAAAATCCCATGCTACAGGTTTGATGCAGTTGGTTTGAT TGTTTAATGGAGAGGTGAAAGCATATTTTCGATGTCTGGATccgtatacc ttatcggggaaaacttcgtcggggaaaagtgacgaaattttggacaagtg acgaatattttccccgacgaaaattttccccggccttaatgcgtttacca actaccagcaagtgacgaatttttccccgacgaaaattttcaccgaggaa gttttccccgataaggtgtAATTTTTCTTATGTCTGAAATCTGATCATTA AAAATTAAGCCTTTGTATAAAATGactctttcaaaattttggaaatttcc gAAATTTCCTAAAAAGAGACGGGATAGCAAGATGGGAATTGGATTTGTTA ATTTTCGCTCGCTGTACTAATCTAAAAGCCCAAGCTAACAAAATTATCGC GGTACTTAATTTTTGTTGTAGTGACTAAGATTTCCCCAAACTAAATTACG TGCTATTTATTGAATATGATTTACACGAATCTTATCCCTTTCATGATTGT TTCGTGGTTTACTCGAAAATGTTCTCCGCTTTTTTTTCTCAGACGGAGAC GAAAGTGAACCTGCCCAGTAGCAGCGTTGGGAAAGAAGACAAAACCAGTG AACTCGATGTCGACGAGAAGCCATTGGAGACGGTGGTGGAATCAGGTCCT GTACAACACCACAACGAGGCTCAGAATCATGAGTACGAGGATGAAGAGGA AGAAATTGTGACCGCTTCTTCACTCTTCGCCAAACAAATGGACTGTAAGT TGTTGATCTTCTAAACGAATCCCATTCCTAAAGACCAAGTGCAgaacttt attattattatacagatTTACAAGCTAGGCTCACAGTGGGCCTCTAACCG ATCTTATTTTACACTATTCTTGAATCTTATTTTGAGGGATGGTTTTCCCA TGCATCGTTGAGGTTTTCTTTGAAGGTCTTGATAGACTTTGCTGTAACGA CATTTCTCGGCAGTCTATTCCAGGTTGGCACACATCTGTAATAAAAGGAT TTCGTTTGTGGTCCGTGGAAACCGCCATTCGCGAAGTTAGGTAGAAGCTC ACGAGCGTGTCTTCGATTTGGACGCGGACGTTTAGTCAACTTGTCAGGTA TTTTGAGCCTATCAAAATACGAAAGGCTGCGGTACGTTGGGACCAATCTT GTTGCACGTCTTTGCACTCCCTAAAGTAAGTTGATATGCTTACGTAATCT TGGTGACCAAACTGATTGTGCGTACACAAGGTGTGGTCGGACAAATGTTG AATATAGCGTAAGGAGGATCTCCGGAGTTGTTAAGTTGGTGAAACCTGGT TTAATGACACCAAGCATTGAGTTtgctttttttacttgattggCTATATG GTCTTCAAATGTCAATTCAGCATCAACCAATATACCCAGGTCTTTTGTTC AAATACATGCTCAAGCTGAATATCACCAAGACGATACGGATGAGCGTGTT TTATATTTACGAATTTGCCGAGTGTAAGGACGTGACATTTATCCGGATGG AACTGTAATAGCCAATCGTTGGACCATTTTTTGAGTGTGTCTATATCACT TTGTATGGCAAGGGAGTCATAGACTGAATCTACCTCTCTGAAGATCTTTG TATCATCTGCGAAAAGTAGCAGAGCCGAAATCACCTTTTCAGGCAAATCA TTTATGTACAGTGTAAAGATTAGAGGGCCCAAGACACTTCCTTGTGGTAT TCCATATAATACACTATCCACCTTGGATTTTGATTGGTTTACTTTGACCA ACTGCTTCCATCCACTCAGAAACGATGAAATCCAGTTCTTTATTGATCCA ACTATGCCATACCCTTCTAGCTTTTTGCAAAGCCTACGATGAGGCACTGT ATCAAATGCTTTAGCGAAATCAAAATAGATGCAGTCTACAACTTTTCCGT CTGATATACTTTCACAGCACCTGCCGACATATTTCAATAGTTGAGTAACA GTGGAACGTCTACTGATGAAGCCATGCTGCTTATCTGATAAAAGGTTTAA GTTTGTCAGGTGGTTCGTGATATGTTCTCGTAGATCGACTCATTCATCAG CTTGCAAACCACGGATGTTAAACTCACTGGTCTGTAATTGATGGCCAAGT TATGCGCGCCTTTGTTCTTGAAGATGGGCGTGACGTGAGCAACCTTCCAA TCCTCAGGTAGTACCCCTTCAGCCAGTGTCTTATTCATAAGCCTTGAAAG GGGCTCGGAAATTTCGTCGACAAGCTCTTTCAACATTCTTGGATATATTT CATCAGGACCAAAAGATTTGTTTGTATCCAGATCCTTGATCTTCTTACTT GTCATATCTTTAGTTATGATGATGTCTGCAATATCTTGTTCTGTTCTTCG TGGAAATTCCGGAAGTTCTCCTTCAGGCTCGATGGTAAAGACACTGCAGA ATTGTTTTTGGAGAATGTTTGCTTTCTCGTGGTCTTTGTGACGTAGCGAT GACTTGTCTTCAGGTGACTCGAGAAGTGACGAAACACCTGTCGCAGCTTT CATCTTACTTCTTAGATGCGACCAAAAGACCTTTGGTTTCGTTTTCGGTT TTCGGTTTTCGTTACTTAATTTACTTATAATTAAGTATTTTATTCTTAAT TATGACTATTGGAACTTTTTAGCGCAAAAGGTTTCGAACATTTTATAATG TGAAAATTACAAGATATACAACTCGATGATCGGACCAGAGTTTGATTTGa gttgtatttcttttttttacatcTCAAGggttggaagaaaattttaacct aattcaaatttccagggggttaaaagttattttttaatttccaaGGGGTA AAAAGATTGATTTTAGTACACCCACCCTCACATTGGAtccttttttcagt tttttgccAGTTTTCCATGGGATATTCgtaatattttaagatttttttgg cTTGAGAAAAGTTTGGCCATCCCCTGTATAGATATAAGTAGAATAGCCTT ATACagcaaagtttgaaattatcttCTTTCTTTATATGAAGGTGATGAGG ATTACGGAGGATTTGACGATGAAGATGATGGATCGTTTTATTGACCAACA AATTGCTCATATCTCTTTCTATTTCTGTATTACACATCTAGGTCTCGTCC TACTCTGTGCAAAATGCCAATGCGTGTGGTTAGTTAGCCTGTATCACCGG GAAATTCACTGGATTAAACTTTAGGAGCTTATCTTTCTTACACATGCAAA CGAAAAGCTCTAGCTACAATACAGCTACAAAGTATAGTTTCCTAAACAAT AGTATATGTCTTTGTATTGATGGCGCTCTGAAGCCTAGATATGTACTCCA CTCTAGGttgatattttcagtttttaaggAATTTTCTTCTCGATTGTAAT AAATAGAAATTTGAAATACTATCAAAAGattcaaaatatattatttattg ttttaccaaaatctttcaattttccttgttttgaTTTCTAAAATTCCTCA ACTTTTCG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_045584XLOC_045584Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073441-exon-scaffold_92-1491911889:156498..157212TCONS_00073441-exon-scaffold_92-1491911889:156498..157212Clytia hemisphaericaexon
TCONS_00073441-exon-scaffold_92-1510915933:156498..157212TCONS_00073441-exon-scaffold_92-1510915933:156498..157212Clytia hemisphaericaexon
TCONS_00073441-exon-scaffold_92-1575043694:156498..157212TCONS_00073441-exon-scaffold_92-1575043694:156498..157212Clytia hemisphaericaexon
TCONS_00073441-exon-scaffold_92-1491911889:164435..164652TCONS_00073441-exon-scaffold_92-1491911889:164435..164652Clytia hemisphaericaexon
TCONS_00073441-exon-scaffold_92-1510915933:164435..164652TCONS_00073441-exon-scaffold_92-1510915933:164435..164652Clytia hemisphaericaexon
TCONS_00073441-exon-scaffold_92-1575043694:164435..164652TCONS_00073441-exon-scaffold_92-1575043694:164435..164652Clytia hemisphaericaexon
TCONS_00073441-exon-scaffold_92-1491911889:165478..165546TCONS_00073441-exon-scaffold_92-1491911889:165478..165546Clytia hemisphaericaexon
TCONS_00073441-exon-scaffold_92-1510915933:165478..165546TCONS_00073441-exon-scaffold_92-1510915933:165478..165546Clytia hemisphaericaexon
TCONS_00073441-exon-scaffold_92-1575043694:165478..165546TCONS_00073441-exon-scaffold_92-1575043694:165478..165546Clytia hemisphaericaexon
TCONS_00073441-exon-scaffold_92-1491911889:165737..165910TCONS_00073441-exon-scaffold_92-1491911889:165737..165910Clytia hemisphaericaexon
TCONS_00073441-exon-scaffold_92-1510915933:165737..165910TCONS_00073441-exon-scaffold_92-1510915933:165737..165910Clytia hemisphaericaexon
TCONS_00073441-exon-scaffold_92-1575043694:165737..165910TCONS_00073441-exon-scaffold_92-1575043694:165737..165910Clytia hemisphaericaexon
TCONS_00073441-exon-scaffold_92-1491911889:166016..166047TCONS_00073441-exon-scaffold_92-1491911889:166016..166047Clytia hemisphaericaexon
TCONS_00073441-exon-scaffold_92-1510915933:166016..166047TCONS_00073441-exon-scaffold_92-1510915933:166016..166047Clytia hemisphaericaexon
TCONS_00073441-exon-scaffold_92-1575043694:166016..166047TCONS_00073441-exon-scaffold_92-1575043694:166016..166047Clytia hemisphaericaexon
TCONS_00073441-exon-scaffold_92-1491911889:166874..166946TCONS_00073441-exon-scaffold_92-1491911889:166874..166946Clytia hemisphaericaexon
TCONS_00073441-exon-scaffold_92-1510915933:166874..166946TCONS_00073441-exon-scaffold_92-1510915933:166874..166946Clytia hemisphaericaexon
TCONS_00073441-exon-scaffold_92-1575043694:166874..166946TCONS_00073441-exon-scaffold_92-1575043694:166874..166946Clytia hemisphaericaexon
TCONS_00073441-exon-scaffold_92-1491911889:167223..167372TCONS_00073441-exon-scaffold_92-1491911889:167223..167372Clytia hemisphaericaexon
TCONS_00073441-exon-scaffold_92-1510915933:167223..167372TCONS_00073441-exon-scaffold_92-1510915933:167223..167372Clytia hemisphaericaexon
TCONS_00073441-exon-scaffold_92-1575043694:167223..167372TCONS_00073441-exon-scaffold_92-1575043694:167223..167372Clytia hemisphaericaexon
TCONS_00073441-exon-scaffold_92-1491911889:167676..168305TCONS_00073441-exon-scaffold_92-1491911889:167676..168305Clytia hemisphaericaexon
TCONS_00073441-exon-scaffold_92-1510915933:167676..168305TCONS_00073441-exon-scaffold_92-1510915933:167676..168305Clytia hemisphaericaexon
TCONS_00073441-exon-scaffold_92-1575043694:167676..168305TCONS_00073441-exon-scaffold_92-1575043694:167676..168305Clytia hemisphaericaexon
TCONS_00073441-exon-scaffold_92-1491911889:168796..168884TCONS_00073441-exon-scaffold_92-1491911889:168796..168884Clytia hemisphaericaexon
TCONS_00073441-exon-scaffold_92-1510915933:168796..168884TCONS_00073441-exon-scaffold_92-1510915933:168796..168884Clytia hemisphaericaexon
TCONS_00073441-exon-scaffold_92-1575043694:168796..168884TCONS_00073441-exon-scaffold_92-1575043694:168796..168884Clytia hemisphaericaexon
TCONS_00073441-exon-scaffold_92-1491911889:169119..169200TCONS_00073441-exon-scaffold_92-1491911889:169119..169200Clytia hemisphaericaexon
TCONS_00073441-exon-scaffold_92-1510915933:169119..169200TCONS_00073441-exon-scaffold_92-1510915933:169119..169200Clytia hemisphaericaexon
TCONS_00073441-exon-scaffold_92-1575043694:169119..169200TCONS_00073441-exon-scaffold_92-1575043694:169119..169200Clytia hemisphaericaexon
TCONS_00073441-exon-scaffold_92-1491911889:169553..169611TCONS_00073441-exon-scaffold_92-1491911889:169553..169611Clytia hemisphaericaexon
TCONS_00073441-exon-scaffold_92-1510915933:169553..169611TCONS_00073441-exon-scaffold_92-1510915933:169553..169611Clytia hemisphaericaexon
TCONS_00073441-exon-scaffold_92-1575043694:169553..169611TCONS_00073441-exon-scaffold_92-1575043694:169553..169611Clytia hemisphaericaexon
TCONS_00073441-exon-scaffold_92-1491911889:170153..170306TCONS_00073441-exon-scaffold_92-1491911889:170153..170306Clytia hemisphaericaexon
TCONS_00073441-exon-scaffold_92-1510915933:170153..170306TCONS_00073441-exon-scaffold_92-1510915933:170153..170306Clytia hemisphaericaexon
TCONS_00073441-exon-scaffold_92-1575043694:170153..170306TCONS_00073441-exon-scaffold_92-1575043694:170153..170306Clytia hemisphaericaexon
TCONS_00073441-exon-scaffold_92-1491911889:171070..171229TCONS_00073441-exon-scaffold_92-1491911889:171070..171229Clytia hemisphaericaexon
TCONS_00073441-exon-scaffold_92-1510915933:171070..171229TCONS_00073441-exon-scaffold_92-1510915933:171070..171229Clytia hemisphaericaexon
TCONS_00073441-exon-scaffold_92-1575043694:171070..171229TCONS_00073441-exon-scaffold_92-1575043694:171070..171229Clytia hemisphaericaexon
TCONS_00073441-exon-scaffold_92-1491911889:171420..171474TCONS_00073441-exon-scaffold_92-1491911889:171420..171474Clytia hemisphaericaexon
TCONS_00073441-exon-scaffold_92-1510915933:171420..171474TCONS_00073441-exon-scaffold_92-1510915933:171420..171474Clytia hemisphaericaexon
TCONS_00073441-exon-scaffold_92-1575043694:171420..171474TCONS_00073441-exon-scaffold_92-1575043694:171420..171474Clytia hemisphaericaexon
TCONS_00073441-exon-scaffold_92-1491911889:172090..172291TCONS_00073441-exon-scaffold_92-1491911889:172090..172291Clytia hemisphaericaexon
TCONS_00073441-exon-scaffold_92-1510915933:172090..172291TCONS_00073441-exon-scaffold_92-1510915933:172090..172291Clytia hemisphaericaexon
TCONS_00073441-exon-scaffold_92-1575043694:172090..172291TCONS_00073441-exon-scaffold_92-1575043694:172090..172291Clytia hemisphaericaexon
TCONS_00073441-exon-scaffold_92-1491911889:174539..175005TCONS_00073441-exon-scaffold_92-1491911889:174539..175005Clytia hemisphaericaexon
TCONS_00073441-exon-scaffold_92-1510915933:174539..175005TCONS_00073441-exon-scaffold_92-1510915933:174539..175005Clytia hemisphaericaexon
TCONS_00073441-exon-scaffold_92-1575043694:174539..175005TCONS_00073441-exon-scaffold_92-1575043694:174539..175005Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_92supercontigscaffold_92:156498..175005 +
Expression
No biomaterial libraries express this feature.
Blast
BLAST of TCONS_00073441 vs. Swiss-Prot (Human)
Match: TF3B (Transcription factor IIIB 90 kDa subunit OS=Homo sapiens GN=BRF1 PE=1 SV=1)

HSP 1 Score: 318.546 bits (815), Expect = 2.877e-94
Identity = 162/303 (53.47%), Postives = 224/303 (73.93%), Query Frame = 3
Query:  756 GVSCKNCGGTEIDHDQARGDXXXXXXXXXXESLCIVNEVEFQENSAGNASVIGQFVSAEGHHSR----AGYKYSLGRDHRQVILDNGKRLINQLGSNLKMTNHCLESAFMFYKMAVSKRFTSGRRTIHVIGACLYLVSRTEKTPHMLLXXXXXXXXXXXTLGRVFLQLARELCIDCPIVDPSLYIHRFAHQLDFGEKENEVSMSALRIMARMKKDWIHFGRRPSALCGAALIIAAKLYNFEVTMKDIVKLVRMSKTTVFKRLMDFSKTATGKLTTDEFKTVDLEEEADPPCYTEGRNRVKFAQ 1652
            G  C+ CGGT+I+ D ARGD+VC  CGSV+E   IV+EV+F E+S G +S +GQFVS +G         G+  +LG++ R   L NG+R I+ LG+ L++  HCL++AF F+KMAVS+  T GR+  HVI ACLYLV RTE TPHMLLD+ D++Q +V  LG+ FL LARELCI+ P +DP LYI RFAH L+FGEK +EVSM+ALR++ RMK+DW+H GRRPS LCGAAL++AA++++F  T+K+++ +V++ ++T+ KRL +F  T T +LT DEF  +DLEEE DPP YT G+ +++  Q
Sbjct:    3 GRVCRGCGGTDIELDAARGDAVCTACGSVLEDNIIVSEVQFVESSGGGSSAVGQFVSLDGAGKTPTLGGGFHVNLGKESRAQTLQNGRRHIHHLGNQLQLNQHCLDTAFNFFKMAVSRHLTRGRKMAHVIAACLYLVCRTEGTPHMLLDLSDLLQVNVYVLGKTFLLLARELCINAPAIDPCLYIPRFAHLLEFGEKNHEVSMTALRLLQRMKRDWMHTGRRPSGLCGAALLVAARMHDFRRTVKEVISVVKVCESTLRKRLTEFEDTPTSQLTIDEFMKIDLEEECDPPSYTAGQRKLRMKQ 305          
The following BLAST results are available for this feature:
BLAST of TCONS_00073441 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
TF3B2.877e-9453.47Transcription factor IIIB 90 kDa subunit OS=Homo s... [more]
back to top