Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00073440 (transcript) - C. hemisphaerica

Overview
NameTCONS_00073440
Unique NameTCONS_00073440
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1936

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00073440 ID=TCONS_00073440|Name=TCONS_00073440|organism=Clytia hemisphaerica|type=transcript|length=1936bp
GTTTATAATGGCggatatttgagaaaaatagaCGAGTGTAGGATTTATTT
CAAATGCCACTCAGAGTATAACCTGGAAACTTTCTCATGCATTGGgaaaa
aatatgtttgtttttgagtttcaaaaatgaaagaggCAGGTGACAGTCGA
AAAAGAATCAAGTTCTAAGCCAATCAGAAGATGTTATTGCTTCATTGTCT
GATCAGCTCAGACGTCTCGGCTTCTGTATAGTCTAGACAGCTTTAGACAT
CACGTGACCAATATCGTCCAATCAGATGCgaagaaaaatcatattttaga
ACACAATTTTGAGGAGAAGAGAACCAAACATTTGAGATGAAAGCTTGCTG
GCGTTTTGTTCGTTTTGACGTTGAAAAATCTTTATGGACGAAGGAAATAC
AATTTGTGACTCTCAGAAGAAACTGAACCTGATAAATAAACTTTGGAAGA
ACTCTGTATATATGTACAACAAGAAGTGCTGTatgattaagaaaatttta
aggttCTCAAAGCTTCCTAAAGACAAGGAACAGAACCATGAGGTGAAAGA
ATTGAGACGAAAAGTTCACagtattttcaaaactttgacagAGGATCAGC
TAGATATACTACTAAAGACTTTACAAGCAAATGGTGGTATTGATTCTGAA
TGTATTCTTGTCAACACAAGCACTTTTAGACATATAACTTGTCGAACAAC
AAGTTTTGTACCAAGGACATTACTAGCGAAGGTTTTTCGCTTCCCAAACT
TGAAAGATGAATATTTACGCTGCTTATCTTGTTGCTATAACCATTCCTCT
TGTGATGAAACCAAAGTCTGTATCAATCCCTTCCACTCAAGTGTTGTTAT
TGAGTCAGAATCACCGCTGCCACCATACAGTGAGCTGACACCTTCAACGG
CTTTGTTCAGTGAatcgacaacaacaacaacacttGATGATGATGACCGA
CACATTCCAACACACGTTGCACTACCCAGGACACCGACACATCCTGCATT
TCTCGGTTATAAAGATTTGGGAAGCACCTGTTCATCAACCTCCTCCACAT
CTTCCACCTCATCAGAACGTTCGCATAGTGGCCCTGAACGAAATTGGTAT
GGTGGCCCATGGTGCCAAATTACGTACTGGGAAGAAAAATCAAGAATCGG
AAGCCGGTTTGACGTCGCTAAAGACTGTGTGAACGTGTTCGAAACGTTAC
CTCAAGGAAGTGGCTTAGACCTTTCCATGTTAACGCGATCACGACCGAAC
GAAGCTTCagagaaagtgaaaaatgatatcGGTTATGGATTTCAATTGAC
ACGAGAAGCTGACGGAATCTGGTTGTATAATCGAAGTGACATTGTTTTAT
TCGCTGGCTCACCTACCATTCAACTCGGAAGTGAAAATTTGACGCAGCCC
GTCGTTAAACGGCTTCCGCCCGGAAATTCCGTCCTCGTGTATGATCCGAA
CCTTCTGCCGGACCTTTCGACCATCGAGAAGCCGGGACTGGAAACAACGG
AAGATGGAATGAAAAGTTCATCAGCGAGTAAAGAAATGCGAGGCGGGACT
CAACCTTTCTGTGTTCGCGTCAGCTTCAAGAAAGGCTGGGGCAAGAACTA
CACTCGGATGTACATTACACAATGTCCTTGCTGGGTGGAAATTTATCTGA
ATATATGATGAAAGTTTGTTCTCGTTATCGTTGGAGAGTTTTAGAATGAT
ATTGTACATACGAAAGAACCCTCTTCcttgttaaaattgaaaaaaaatca
aaaagattaaATCGTTGAAATTTGACACAATATCTAACTCAATTACTTGA
ACCTTCTTTATCAAGGCTTTCTCTCAATTACGCGAGGTTTCGGTTATCAa
tagtctgattcgcagacctatacttcctataggtctgcttaatagtGTAT
GGATTGGTTTCCCGTTACGGTGGCTCTTATGGTGGC
Run BLAST on NCBI

protein sequence of Smad6/7 protein

>TCONS_00073440-protein ID=TCONS_00073440-protein|Name=Smad6/7 protein|organism=Clytia hemisphaerica|type=polypeptide|length=424bp
MDEGNTICDSQKKLNLINKLWKNSVYMYNKKCCMIKKILRFSKLPKDKEQ
NHEVKELRRKVHSIFKTLTEDQLDILLKTLQANGGIDSECILVNTSTFRH
ITCRTTSFVPRTLLAKVFRFPNLKDEYLRCLSCCYNHSSCDETKVCINPF
HSSVVIESESPLPPYSELTPSTALFSESTTTTTLDDDDRHIPTHVALPRT
PTHPAFLGYKDLGSTCSSTSSTSSTSSERSHSGPERNWYGGPWCQITYWE
EKSRIGSRFDVAKDCVNVFETLPQGSGLDLSMLTRSRPNEASEKVKNDIG
YGFQLTREADGIWLYNRSDIVLFAGSPTIQLGSENLTQPVVKRLPPGNSV
LVYDPNLLPDLSTIEKPGLETTEDGMKSSSASKEMRGGTQPFCVRVSFKK
GWGKNYTRMYITQCPCWVEIYLNI
Run BLAST on NCBI

transcript from alignment at scaffold_92:81097..87049+

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00073440 ID=TCONS_00073440|Name=TCONS_00073440|organism=Clytia hemisphaerica|type=transcript|length=5953bp|location=Sequence derived from alignment at scaffold_92:81097..87049+ (Clytia hemisphaerica)
GTTTATAATGGCggatatttgagaaaaatagaCGAGTGTAGGATTTATTT CAAATGCCACTCAGAGTATAACCTGGAAACTTTCTCATGCATTGGgaaaa aatatgtttgtttttgagtttcaaaaatgaaagaggCAGGTGACAGTCGA AAAAGAATCAAGTTCTAAGCCAATCAGAAGATGTTATTGCTTCATTGTCT GATCAGCTCAGACGTCTCGGCTTCTGTATAGTCTAGACAGCTTTAGACAT CACGTGACCAATATCGTCCAATCAGATGCgaagaaaaatcatattttaga ACACAATTTTGAGGAGAAGAGAACCAAACATTTGAGATGAAAGCTTGCTG GCGTTTTGTTCGTTTTGACGTTGAAAAATCTTTATGGACGAAGGAAATAC AATTTGTGACTCTCAGAAGAAACTGAACCTGATAAATAAACTTTGGAAGA ACTCTGTATATATGTACAACAAGAAGTGCTGTatgattaagaaaatttta aggttCTCAAAGCTTCCTAAAGACAAGGAACAGAACCATGAGGTGAAAGA ATTGAGACGAAAAGTTCACagtattttcaaaactttgacagAGGATCAGC TAGATATACTACTAAAGACTTTACAAGCAAATGGTGGTATTGATTCTGAA TGTATTCTTGTCAACACAAGCACTTTTAGACATATAACTTGTCGAACAAC AAGTTTTGTACCAAGGACATTACTAGCGAAGGTTTTTCGCTTCCCAAACT TGAAAGATGAATATTTACGCTGCTTATCTTGTTGCTATAACCATTCCTCT TGTGATGAAACCAAAGTCTGTATCAATCCCTTCCACTCAAGTGTTGTTAT TGAGTCAGGTAAGATTTAATTCTGAAATTTGGTTATTATGGTGATAAAAC ATCAACCAGAATTTGACTAACAATCCAGTCTGGAAATTGCGGCTTGTGCG CCGGATATCTCCGGCGTAGATTTGAGATTTGAGATCTGCTGCCTTTAACT TTTTCCAGTTAAGTTGGAGCAGCTCCGGCGAAACATTTCCCTTCTTTCCA GACTGGCTAACAATCTAAATCAAACAGAACTTGAGGATTGAACAAATCTA ACCGAATCAAATCAATCGAGTGAAAACAACTGATTGCTGTATGCAACAAA ATATCAACATTATATTACTCCAATTTTCAGATTTCATTGAGATGTGGCTT GCTAGCGACTTCTCATGTGCTTATATAATGCAATAGATTCTTTAATGTTT ACCCTGAGTTGGTTTGATGTCAACAACCCTCAACTATAATTCCATCCCTC ACCCTCTACAGAGATGAGAATAGACCTCTTGATAccattttgacttcaaa attagtggcaaaaacATGACGTATTGACTCCAAAAACAGTATGACACAAT ACCCTATAATTAAGGACGTCCCTATATATACCgtataagttggtctaatg tcgacatccctcttctaatttcgacaccgtTCTTTGTAGATGGGAATAAT ACGAAGGTCCGAATTGCTGattgaaattcattttcttGCTTAGCAATCAG AGAGGAAAACATCTTTTCTCTATCAGtgatgtcgacatccctcttctaat acCAACACCCTAGAGATAGCTGAATAATATGAAGGTCAGAGAAGATCATG ATTCCAaccttcatattattcctatctctaaaaaagggtgttggaattag aagagggatgtcgatattagaccaacttaggGTACGGAATGTCCTTAGAG CAGCTTAGAGACGTTGTTTTATTAAGGAGCTTCTTTTTCCACTGATCTAC TGGATCAGAAAAAAACCAGCTCACTAGCAGGGATATAGATATCTGTTTTT TTCCAAGTTAATTACGTGTAAAGCTTGATTTACATCGGAGGAAAACTTGc cgttgtggtatagtggtcattaacTTTGGTAGCTAAATACTCAGAAGGCC TCgtgacttagaatttttttgaaaactgtagatttgaccccggctcgaac cacaaAAGTAATTTGTCATTGATTCTGAGCGCTGGGCAACCTGGTACAAA CTCCTAACCCTTATAAAGTGTACACTTGCGGCGCACAACGCTCCAAGCGA TCTGTGCATCTAGCGATTTGTCTTTTGATACCATTTTGAATCCATAAATT AGCAGCAAAAACATTATATAATCTTAGCAACAGAATAACCTAATAGCAAA TCGATATCTTAGCGCTTAAAACTTATctttattgaatttgaaaagtgtCT GTAAACTAAGCTACAGAGTACATACACAGTCATTAGGCTGTTTGACATTT GCAGACTTTGCAACCTAATGATTGCTTACGTGTTCTTTTACACACAGAAA CACAGTAAGATACCAATTAAATGGGGTAAATGCTACCAGTTCATCATACA Tagcatggaccaggggtttaggtaccccctaagaaaataggtaccccctg aattttaggtacccccaaacaacagactttagtaggtaccccctgtgatt ggtaccccctgtatatttttataattaaaaagaataatgatagttagata aaagcaagatatAAATATATAGTTCCCCagcccccagaccttactgTATA AAAGTTAGGTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCCAGCCCC cagcctttttcaggaagattttggttgtagcccccccccctgcggGCTGG GGGGGGTTCATGCCATGTCATACCGTTATTTTTGGAGTCTTTACATAATG TTTTTGTCCTTATTATATGGAGTTTAAAATGGTACTGTGGTTAGCAAAAG GACCATTCAACACAATTGTGAAATGACAATTAATTTTAcagatttgattg aaatatcCAAATCAGCTGATTGCATTTGGTTTGATTTGTTGGACTAAATC TGTAAATCCAGACAGAACTTTAGATAGTATGGATTAGAAAATAGTCTATG ATATAGTGGATTGAACTGTCCATATAACAAGCATTATACTGTAATGAAAT TctggcaaaatttaatttatttaattttttcccaaattcaagCTATTTCA GGCTTTCTAAAAACGAATTTTCAGcctatttaaaaatattaaaataaaat tttgtttatttttcaaaatatttttgaccaaaaatatcctacatttttaa aataaaggCAACAAAGAGACTGCACTGGTTCCCCATGTCTTGGTTATTAT TTCTGGTCAAATCTAATTTATTTGTTGATTTTAGAATCACCGCTGCCACC ATACAGTGAGCTGACACCTTCAACGGCTTTGTTCAGTGAatcgacaacaa caacaacacttGATGATGATGACCGACACATTCCAACACACGTTGCACTA CCCAGGACACCGACACATCCTGCATTTCTCGGTTATAAAGATTTGGGAAG CACCTGTTCATCAACCTCCTCCACATCTTCCACCTCATCAGGTAAATTCA TCTTTCCATCCTCAATTTGGTGAGTTCCTTAGCCCAAAGCTCTGTCACCA ACTCAATATGATTTTGGGTTTACCAAAGTCCTGGTCGCACATTTCTCCTT TTAGCACATAACCTTTATGGAGCGTTTAGTCATGTGTGGTAATCATTGTG CTTTTTCCCAGGGTTTTAATTTGCTTATTTTATCTACCTCATTTGTAAGA AGGTTTGTAAGGCTTTCTGATTGTTTTGGaattctttaaagattttggtt taaaactttgttttgatttcgttGGAATTACTTTGTCTATAATATCATTT GgagatttttgcatttttgaagacagATTTTTGGGGTagtctcttttttt tcaaagctgTCATGGAAGTGTTTGCTCAGCTTTTTGGTTTCATCACAACA ACTGACTTTTAAGAGTCATCACTGTCTGAGAGAACGCTTGTAAATCTTTT CGTCGACTCTCTCCTTTATTTTCTTCTTGGTTTCGTGTCCtatcaaattt caatttgatGATGATATAAGGAAGGGGCTTTATTTGGTGACAATATTTTA TCTGAAACGGTATGGATGTAAAATGATTCTCAGACAATCGTCTTTTAAAT CGATATTTTATTACAAGAAGATTAACCTACGCTTTTTCTTCACCCTGTGT TTGATTTTCAGACGACTGTTCGCATACCAAAAGAATGGAATCGAGTTGAA AGATTTCTATTCCCTCTTTGTTTTTCTCTCTCTTCTTTTCTTGAACTCTT TTATTAATAGCCTGGCAGTGCATTGGAAAGAACATCTAAGTATTGAGACA GAATCTATGAAACGGCTGGGTTTTTCTTTCCCCTTCTCTGTTTTGCTTCT TTTAGAAATTCTCTCCTTTTTATCGTTTTGTCTGTGTTGTTTCAGTAAAC GTTTATCcttctcaaaaaaatatttttggcacAGTCTCAAAACAATGTAA AACGAGGCCAGAAAGAGACATAGAGGATTGCTGTGTTATTTTTCTTGGAT AAACTgtctttatcatttttttgttcTAAATGAAAGTTGTCTAGGGGATG CATGTGATAAAAAGCTTTCTTAATGAGTGCAATGACTCAATGACTGAAAT ACCTTTCTCTCTACATGTCTGGAGAGAAATTAATTAGATTTTCTAAAGAT TATGTTGCACAgcctttctcaagcaaagatAAAAAGTTTTCTACTTTTCT TACATAAACTGTCttgattaaaatttttattttgatgcatttcctgtggt ttaaaaaaaatctcatcCTTCGTTCGTTCGATTCATCTGGTTGTCAGCAA AAAGAACCTCGGGTCACCCTTTATTATCCGAACTTCATTTTAATGCATTC CGGTGTATTCGAACGTAGAATTTCAACATAAGAGAaaactttgaatgaaa acaGTTCCTTTTTATCCCGTTTTCTGGTATTTTTTTACCCTTAATGTTTT CTTGAAAGTGATAAGGCTTCTTTCTTTTATAGAACGTTCGCATAGTGGCC CTGAACGAAATTGGTATGGTGGCCCATGGTGCCAAATTACGTACTGGGAA GAAAAATCAAGAATCGGAAGCCGGTTTGACGTCGCTAAAGACTGTGTGAA CGTGTTCGAAACGTTACCTCAAGGAAGTGGCTTAGACCTTTCCATGTTAA CGCGATCACGACCGAACGAAGCTTCagagaaagtgaaaaatgatatcGGT TATGGATTTCAATTGACACGAGAAGCTGACGGAATCTGGTTGTATAATCG AAGTGACATTGTTTTATTCGCTGGCTCACCTACCATTCAACTCGGAAGTG AAAATTTGACGCAGCCCGTCGTTAAACGGCTTCCGCCCGGAAATTCCGTC CTCGTGTATGATCCGAACCTTCTGCCGGACCTTTCGACCATCGAGAAGCC GGGACTGGAAACAACGGAAGATGGAATGAAAAGTTCATCAGCGAGTAAAG AAATGCGAGGCGGGACTCAACCTTTCTGTGTTCGCGTCAGCTTCAAGAAA GGCTGGGGCAAGAACTACACTCGGATGTACATTACACAATGTCCTTGCTG GGTGGAAATTTATCTGAATATATGATGAAAGTTTGTTCTCGTTATCGTTG GAGAGTTTTAGAATGATATTGTACATACGAAAGAACCCTCTTCcttgtta aaattgaaaaaaaatcaaaaagattaaATCGTTGAAATTTGACACAATAT CTAACTCAATTACTTGAACCTTCTTTATCAAGGCTTTCTCTCAATTACGC GAGGTTTCGGTTATCAatagtctgattcgcagacctatacttcctatagg tctgcttaatagtGTATGGATTGGTTTCCCGTTACGGTGGCTCTTATGGT GGC

Coding sequence (CDS) from alignment at scaffold_92:81097..87049+

>TCONS_00073440 ID=TCONS_00073440|Name=TCONS_00073440|organism=Clytia hemisphaerica|type=CDS|length=3825bp|location=Sequence derived from alignment at scaffold_92:81097..87049+ (Clytia hemisphaerica)
ATGGACGAAGGAAATACAATTTGTGACTCTCAGAAGAAACTGAACCTGAT
AAATAAACTTTGGAAGAACTCTGTATATATGTACAACAAGAAGTGCTGTa
tgattaagaaaattttaaggttCTCAAAGCTTCCTAAAGACAAGGAACAG
AACCATGAGGTGAAAGAATTGAGACGAAAAGTTCACagtattttcaaaac
tttgacagAGGATCAGCTAGATATACTACTAAAGACTTTACAAGCAAATG
GTGGTATTGATTCTGAATGTATTCTTGTCAACACAAGCACTTTTAGACAT
ATAACTTGTCGAACAACAAGTTTTGTACCAAGGACATTACTAGCGAAGGT
TTTTCGCTTCCCAAACTTGAAAGATGAATATTTACGCTGCTTATCTTGTT
GCTATAACCATTCCTCTTGTGATGAAACCAAAGTCTGTATCAATCCCTTC
CACTCAAGTGTTGTTATTGAGTCAGAATCACCGCTGCCACCATACAGTGA
GCTGACACCTTCAACGGCTTTGTTCAGTGAatcgacaacaacaacaacac
ttGATGATGATGACCGACACATTCCAACACACGTTGCACTACCCAGGACA
CCGACACATCCTGCATTTCTCGGTTATAAAGATTTGGGAAGCACCTGTTC
ATCAACCTCCTCCACATCTTCCACCTCATCAGAACGTTCGCATAGTGGCC
CTGAACGAAATTGGTATGGTGGCCCATGGTGCCAAATTACGTACTGGGAA
GAAAAATCAAGAATCGGAAGCCGGTTTGACGTCGCTAAAGACTGTGTGAA
CGTGTTCGAAACGTTACCTCAAGGAAGTGGCTTAGACCTTTCCATGTTAA
CGCGATCACGACCGAACGAAGCTTCagagaaagtgaaaaatgatatcGGT
TATGGATTTCAATTGACACGAGAAGCTGACGGAATCTGGTTGTATAATCG
AAGTGACATTGTTTTATTCGCTGGCTCACCTACCATTCAACTCGGAAGTG
AAAATTTGACGCAGCCCGTCGTTAAACGGCTTCCGCCCGGAAATTCCGTC
CTCGTGTATGATCCGAACCTTCTGCCGGACCTTTCGACCATCGAGAAGCC
GGGACTGGAAACAACGGAAGATGGAATGAAAAGTTCATCAGCGAGTAAAG
AAATGCGAGGCGGGACTCAACCTTTCTGTGTTCGCGTCAGCTTCAAGAAA
GGCTGGGGCAAGAACTACACTCGGATGTACATTACACAATGTCCTTGCTG
GGTGGAAATTTATCTGAATATATGAATGGACGAAGGAAATACAATTTGTG
ACTCTCAGAAGAAACTGAACCTGATAAATAAACTTTGGAAGAACTCTGTA
TATATGTACAACAAGAAGTGCTGTatgattaagaaaattttaaggttCTC
AAAGCTTCCTAAAGACAAGGAACAGAACCATGAGGTGAAAGAATTGAGAC
GAAAAGTTCACagtattttcaaaactttgacagAGGATCAGCTAGATATA
CTACTAAAGACTTTACAAGCAAATGGTGGTATTGATTCTGAATGTATTCT
TGTCAACACAAGCACTTTTAGACATATAACTTGTCGAACAACAAGTTTTG
TACCAAGGACATTACTAGCGAAGGTTTTTCGCTTCCCAAACTTGAAAGAT
GAATATTTACGCTGCTTATCTTGTTGCTATAACCATTCCTCTTGTGATGA
AACCAAAGTCTGTATCAATCCCTTCCACTCAAGTGTTGTTATTGAGTCAG
AATCACCGCTGCCACCATACAGTGAGCTGACACCTTCAACGGCTTTGTTC
AGTGAatcgacaacaacaacaacacttGATGATGATGACCGACACATTCC
AACACACGTTGCACTACCCAGGACACCGACACATCCTGCATTTCTCGGTT
ATAAAGATTTGGGAAGCACCTGTTCATCAACCTCCTCCACATCTTCCACC
TCATCAGAACGTTCGCATAGTGGCCCTGAACGAAATTGGTATGGTGGCCC
ATGGTGCCAAATTACGTACTGGGAAGAAAAATCAAGAATCGGAAGCCGGT
TTGACGTCGCTAAAGACTGTGTGAACGTGTTCGAAACGTTACCTCAAGGA
AGTGGCTTAGACCTTTCCATGTTAACGCGATCACGACCGAACGAAGCTTC
agagaaagtgaaaaatgatatcGGTTATGGATTTCAATTGACACGAGAAG
CTGACGGAATCTGGTTGTATAATCGAAGTGACATTGTTTTATTCGCTGGC
TCACCTACCATTCAACTCGGAAGTGAAAATTTGACGCAGCCCGTCGTTAA
ACGGCTTCCGCCCGGAAATTCCGTCCTCGTGTATGATCCGAACCTTCTGC
CGGACCTTTCGACCATCGAGAAGCCGGGACTGGAAACAACGGAAGATGGA
ATGAAAAGTTCATCAGCGAGTAAAGAAATGCGAGGCGGGACTCAACCTTT
CTGTGTTCGCGTCAGCTTCAAGAAAGGCTGGGGCAAGAACTACACTCGGA
TGTACATTACACAATGTCCTTGCTGGGTGGAAATTTATCTGAATATATGA
ATGGACGAAGGAAATACAATTTGTGACTCTCAGAAGAAACTGAACCTGAT
AAATAAACTTTGGAAGAACTCTGTATATATGTACAACAAGAAGTGCTGTa
tgattaagaaaattttaaggttCTCAAAGCTTCCTAAAGACAAGGAACAG
AACCATGAGGTGAAAGAATTGAGACGAAAAGTTCACagtattttcaaaac
tttgacagAGGATCAGCTAGATATACTACTAAAGACTTTACAAGCAAATG
GTGGTATTGATTCTGAATGTATTCTTGTCAACACAAGCACTTTTAGACAT
ATAACTTGTCGAACAACAAGTTTTGTACCAAGGACATTACTAGCGAAGGT
TTTTCGCTTCCCAAACTTGAAAGATGAATATTTACGCTGCTTATCTTGTT
GCTATAACCATTCCTCTTGTGATGAAACCAAAGTCTGTATCAATCCCTTC
CACTCAAGTGTTGTTATTGAGTCAGAATCACCGCTGCCACCATACAGTGA
GCTGACACCTTCAACGGCTTTGTTCAGTGAatcgacaacaacaacaacac
ttGATGATGATGACCGACACATTCCAACACACGTTGCACTACCCAGGACA
CCGACACATCCTGCATTTCTCGGTTATAAAGATTTGGGAAGCACCTGTTC
ATCAACCTCCTCCACATCTTCCACCTCATCAGAACGTTCGCATAGTGGCC
CTGAACGAAATTGGTATGGTGGCCCATGGTGCCAAATTACGTACTGGGAA
GAAAAATCAAGAATCGGAAGCCGGTTTGACGTCGCTAAAGACTGTGTGAA
CGTGTTCGAAACGTTACCTCAAGGAAGTGGCTTAGACCTTTCCATGTTAA
CGCGATCACGACCGAACGAAGCTTCagagaaagtgaaaaatgatatcGGT
TATGGATTTCAATTGACACGAGAAGCTGACGGAATCTGGTTGTATAATCG
AAGTGACATTGTTTTATTCGCTGGCTCACCTACCATTCAACTCGGAAGTG
AAAATTTGACGCAGCCCGTCGTTAAACGGCTTCCGCCCGGAAATTCCGTC
CTCGTGTATGATCCGAACCTTCTGCCGGACCTTTCGACCATCGAGAAGCC
GGGACTGGAAACAACGGAAGATGGAATGAAAAGTTCATCAGCGAGTAAAG
AAATGCGAGGCGGGACTCAACCTTTCTGTGTTCGCGTCAGCTTCAAGAAA
GGCTGGGGCAAGAACTACACTCGGATGTACATTACACAATGTCCTTGCTG
GGTGGAAATTTATCTGAATATATGA
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_045583XLOC_045583Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
Smad6/7 proteinTCONS_00073440-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073440-exon-scaffold_92-1491911889:81097..81954TCONS_00073440-exon-scaffold_92-1491911889:81097..81954Clytia hemisphaericaexon
TCONS_00073440-exon-scaffold_92-1510915933:81097..81954TCONS_00073440-exon-scaffold_92-1510915933:81097..81954Clytia hemisphaericaexon
TCONS_00073440-exon-scaffold_92-1575043694:81097..81954TCONS_00073440-exon-scaffold_92-1575043694:81097..81954Clytia hemisphaericaexon
TCONS_00073440-exon-scaffold_92-1491911889:84481..84687TCONS_00073440-exon-scaffold_92-1491911889:84481..84687Clytia hemisphaericaexon
TCONS_00073440-exon-scaffold_92-1510915933:84481..84687TCONS_00073440-exon-scaffold_92-1510915933:84481..84687Clytia hemisphaericaexon
TCONS_00073440-exon-scaffold_92-1575043694:84481..84687TCONS_00073440-exon-scaffold_92-1575043694:84481..84687Clytia hemisphaericaexon
TCONS_00073440-exon-scaffold_92-1491911889:86179..87049TCONS_00073440-exon-scaffold_92-1491911889:86179..87049Clytia hemisphaericaexon
TCONS_00073440-exon-scaffold_92-1510915933:86179..87049TCONS_00073440-exon-scaffold_92-1510915933:86179..87049Clytia hemisphaericaexon
TCONS_00073440-exon-scaffold_92-1575043694:86179..87049TCONS_00073440-exon-scaffold_92-1575043694:86179..87049Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_92supercontigscaffold_92:81097..87049 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
13.9071 12.8209 5.04095 3.32826 12.4942 8.97305 8.29313 8.43153 5.36647 4.60848 3.37167 5.26597 14.3173 8.01658 28.4973 54.0541 24.3344 14.5574 19.5214 13.7109 3.3164 3.40051 83.3818 78.9969 26.1579 26.3554 10.9012 9.25916 35.3189 40.6073
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR001132SMAD_dom_Dwarfin-type
IPR003619MAD_homology1_Dwarfin-type
IPR017855SMAD_dom-like
IPR013019MAD_homology_MH1
IPR008984SMAD_FHA_domain
Vocabulary: Cellular Component
TermDefinition
GO:0005622intracellular
GO:0005667transcription factor complex
Vocabulary: Biological Process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
GO:0007179transforming growth factor beta receptor signaling pathway
Vocabulary: Molecular Function
TermDefinition
GO:0003700transcription factor activity, sequence-specific DNA binding
GO:0005515protein binding
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0006355 regulation of transcription, DNA-templated
biological_process GO:0007179 transforming growth factor beta receptor signaling pathway
cellular_component GO:0005622 intracellular
cellular_component GO:0005667 transcription factor complex
molecular_function GO:0005515 protein binding
molecular_function GO:0003700 transcription factor activity, sequence-specific DNA binding
Blast
BLAST of TCONS_00073440 vs. Swiss-Prot (Human)
Match: SMAD6 (Mothers against decapentaplegic homolog 6 OS=Homo sapiens GN=SMAD6 PE=1 SV=2)

HSP 1 Score: 178.718 bits (452), Expect = 1.597e-48
Identity = 118/385 (30.65%), Postives = 181/385 (47.01%), Query Frame = 3
Query:  546 KELRRKVHSIFKTLTEDQLDILLKTLQANGGIDSECILVNTSTFRHITCRTTSFVPRTLLAKVFRFPNLKDEY-LRCLSCCYNHSSC-DETKVCINPFHSSVVIESESPLPPYS-----------ELTPSTALFSESXXXXXXXXXXRHIPTHVALPRT--PTHPAFLGYKDLGXXXXXXXXXXXXXXXXXXXGPERNWYGGPWCQITYWEEKSRIGSRFDVAKDCVNVFETLPQGSGLDLSMLTRSRPNEASEKVKNDIGYGFQLTREADGIWLYNRSDIVLFAGSPTIQL-GSENLTQPVVKRLPPGNSVLVYDPNLLPDLSTIEKPGLETTEDGMKSSSASKEMRGGTQPFCVRVSFKKGWGKNYTRMYITQCPCWVEIYLN 1652
            +EL+   +S+ K L E  LD LL+ +++ GG+   C+LV  +  R          P+ LL ++FR+P+L+    L+ L  C++ ++  D   VC NP+H S +   ESP PPYS           +L+ ST  ++E+  T +L             P    P+H                                       WC + YWE ++R+G  + V    V++F  LPQGSG  L  L   + +E+  + ++ IG+G  L++E DG+W YNR +  +F  SPT+   G   L   VV+++PPG S+ V+D          E+ GL+   +            G   P  VR+SF KGWG  Y+R +IT CPCW+EI LN
Sbjct:  170 QELKTVTYSLLKRLKERSLDTLLEAVESRGGVPGGCVLVPRADLR---LGGQPAPPQLLLGRLFRWPDLQHAVELKPLCGCHSFAAAADGPTVCCNPYHFSRLCGPESPPPPYSRLSPRDEYKPLDLSDSTLSYTETEATNSLITAPGEFSDASMSPDATKPSH---------------------------------------WCSVAYWEHRTRVGRLYAVYDQAVSIFYDLPQGSGFCLGQLNLEQRSESVRRTRSKIGFGILLSKEPDGVWAYNRGEHPIFVNSPTLDAPGGRAL---VVRKVPPGYSIKVFD---------FERSGLQHAPE-------PDAADGPYDPNSVRISFAKGWGPCYSRQFITSCPCWLEILLN 493          
The following BLAST results are available for this feature:
BLAST of TCONS_00073440 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
SMAD61.597e-4830.65Mothers against decapentaplegic homolog 6 OS=Homo ... [more]
back to top