Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00073420 (transcript) - C. hemisphaerica

Overview
NameTCONS_00073420
Unique NameTCONS_00073420
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length546

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00073420 ID=TCONS_00073420|Name=TCONS_00073420|organism=Clytia hemisphaerica|type=transcript|length=546bp
GGGAGGTGATCAGAAATAGAGCTTATCaggttacatgaaaacatgtcAGT
GGTGACaaagcttgaaaaaatgttgtcaaTGAGAGTTTTTGAGCCTGGAG
TTATCCTGGTAGGTCTTGTAATTGTAGGAAAGAAAAAATGAGATAGATTG
CTATTAAGAAAATCTTCTATGTGTGATTTGGAATCTGCCTGTAGAAGATC
TAGATTGAAATCTCCAAATATtatagcttttttcttttctgataCAATCT
TATCAAGTAGATTTGAGTATAGGGTTTGAAAATTAGTAGCATCCACTTCA
GGGTGTTTATAAATACAAGCTacaataaagtttttatcaTAGATAATTTC
CCTGACTACagattcaatttcattttccatgTAAATATCTAGGTCAGGCC
TTGGAATAGAGTCAAATCCTTCAGAGACATAGATTCTAGCACCTCCTCGG
TTGGACTTAGTGCAACAGTNTGTAGATATCTAGGTCAGGCCTTGGAATAG
AGTCAAATCCTTCAGAGACATAGATTCTAGCACCTCCTCGGTTGGA
Run BLAST on NCBI

protein sequence of TCONS_00073420-protein

>TCONS_00073420-protein ID=TCONS_00073420-protein|Name=TCONS_00073420-protein|organism=Clytia hemisphaerica|type=polypeptide|length=126bp
MENEIESVVREIIYDKNFIVACIYKHPEVDATNFQTLYSNLLDKIVSEKK
KAIIFGDFNLDLLQADSKSHIEDFLNSNLSHFFFPTITRPTRITPGSKTL
IDNIFSSFVTTDMFSCNLISSISDHL
Run BLAST on NCBI

transcript from alignment at scaffold_91:72312..72857

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00073420 ID=TCONS_00073420|Name=TCONS_00073420|organism=Clytia hemisphaerica|type=transcript|length=546bp|location=Sequence derived from alignment at scaffold_91:72312..72857 (Clytia hemisphaerica)
TCCAACCGAGGAGGTGCTAGAATCTATGTCTCTGAAGGATTTGACTCTAT TCCAAGGCCTGACCTAGATATCTACANACTGTTGCACTAAGTCCAACCGA GGAGGTGCTAGAATCTATGTCTCTGAAGGATTTGACTCTATTCCAAGGCC TGACCTAGATATTTAcatggaaaatgaaattgaatctGTAGTCAGGGAAA TTATCTAtgataaaaactttattgtAGCTTGTATTTATAAACACCCTGAA GTGGATGCTACTAATTTTCAAACCCTATACTCAAATCTACTTGATAAGAT TGtatcagaaaagaaaaaagctataATATTTGGAGATTTCAATCTAGATC TTCTACAGGCAGATTCCAAATCACACATAGAAGATTTTCTTAATAGCAAT CTATCTCATTTTTTCTTTCCTACAATTACAAGACCTACCAGGATAACTCC AGGCTCAAAAACTCTCAttgacaacattttttcaagctttGTCACCACTg acatgttttcatgtaacctGATAAGCTCTATTTCTGATCACCTCCC

Coding sequence (CDS) from alignment at scaffold_91:72312..72857

>TCONS_00073420 ID=TCONS_00073420|Name=TCONS_00073420|organism=Clytia hemisphaerica|type=CDS|length=378bp|location=Sequence derived from alignment at scaffold_91:72312..72857 (Clytia hemisphaerica)
atggaaaatgaaattgaatctGTAGTCAGGGAAATTATCTAtgataaaaa
ctttattgtAGCTTGTATTTATAAACACCCTGAAGTGGATGCTACTAATT
TTCAAACCCTATACTCAAATCTACTTGATAAGATTGtatcagaaaagaaa
aaagctataATATTTGGAGATTTCAATCTAGATCTTCTACAGGCAGATTC
CAAATCACACATAGAAGATTTTCTTAATAGCAATCTATCTCATTTTTTCT
TTCCTACAATTACAAGACCTACCAGGATAACTCCAGGCTCAAAAACTCTC
AttgacaacattttttcaagctttGTCACCACTgacatgttttcatgtaa
cctGATAAGCTCTATTTCTGATCACCTC
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_045564XLOC_045564Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073420-proteinTCONS_00073420-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073420-exon-scaffold_91-1491911889:72312..72857TCONS_00073420-exon-scaffold_91-1491911889:72312..72857Clytia hemisphaericaexon
TCONS_00073420-exon-scaffold_91-1510915933:72312..72857TCONS_00073420-exon-scaffold_91-1510915933:72312..72857Clytia hemisphaericaexon
TCONS_00073420-exon-scaffold_91-1575043694:72312..72857TCONS_00073420-exon-scaffold_91-1575043694:72312..72857Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_91supercontigscaffold_91:72312..72857 .
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0 0.41064 0.119198 0.233233 4.40105 3.92652 2.16557 2.15409 0.354854 0.439543 1.06658 0.420676 0.420091 0.363558 0.239115 0.320759 0 0.486017 0.22382 0.351317 0.305358 0.297886 0.241413 0.10974 0.678176 0.605256 0.721766 0.61623 0.584236 0.119049
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR005135Endo/exonuclease/phosphatase
Blast
The following BLAST results are available for this feature:
BLAST of TCONS_00073420 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 0
Match NameE-valueIdentityDescription
back to top