Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00073407 (transcript) - C. hemisphaerica

Overview
NameTCONS_00073407
Unique NameTCONS_00073407
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1388

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00073407 ID=TCONS_00073407|Name=TCONS_00073407|organism=Clytia hemisphaerica|type=transcript|length=1388bp
gtcaaaaaaggattggatcgagtttagggggatgattaaataataaagtg
gcacgcgcctgaccgtgcgactacgtttttttttcaaggtaTCGGCGTGG
ATGATGTCTTTGTCATTATTCAAAATTGGGACAACATTGGTGGCCCTAAA
AATCGTGACCGCTCGATCGCCGAAAATGTTTCTCTCGCATTGAGAACTGC
TGGCGTATCCATCCTGGTCACGTCAATCACGGACGTTTGCGCTTTCTTGA
TCGGAGCAACTACAATCCTTCCCGCCTTACGATCGTTCTGTATTTTCGCT
GGCATTGGTGTTTTAGCCGTCTTCATTTTAACATGTACATTTTATGTGGC
TTGGTTGGCTTTGGATAGCAGGAGACAACGTGACCACCGTGACGCGTGTT
GTTGTTGTGCGTCTTTACCGACGGATTGGCAACCGTTGGAATGTTCAAAG
AGAATGTACCTTCAAGAGTTCATGAGAGGAACTTATTCAAAAGCAATTCT
CTCTACGCCTGGTCGGATTGTTTTGATGTTGGTATGGGCTGGTTTATTAG
CGGGAGGTGCATACGGTCTTTCACAATTGAAACAAGATTTCGATCCTGAA
TGGTTTTTACCGGAAGATTCGAACGCCAGGATTTACAGCTCCGTGGATGA
TAAGTATTTCTCGAATGATGGTATCCAAGCCTATGCGTACATTGAAGATG
TTGactattttgcagaccaggaCAAGTTAGTGAGCATGTATAACACACTG
GAGAATAACCAGTACACTGTTAAGGGAGAAACTCAGAGTTGGTATCAAAC
CTATATCGCATGGATGGCAGCCAATCACGCCGCTGATTTGACCAACGGTA
AACCAAGTACGAAAGATATATTTTACAATCGATTAGATGAGTTTACGAAA
ACACAAGTTGGGAAAGTTTTCGAGAAGGAGATCAAAGGAAACATAACGGA
ACAAAAGATTGAGGCTTCTCGTATCAAATACAAACATATCAAATTGGAAG
GCGCTTCGGTTGAAGTCAAGGCAATGGACAGTGTGCAAGATGAGCTTGCC
AAAATCACATTCACTAATGACTTCAGTCCTTTCGGTTACACAAGGTTCTA
CGTTGGCTGGGAAACAAATAAGGTCATTTCTGAAGAATTGATACGTAATT
TGTTGTTGGCTGGTGTTATTGTGTTCTTGGTGACATTGTTCTTGATCGCC
AACGTCTGGGTCTCCTTACTCGTCCTCACATGTGTTGTCTTCACTCTGAT
CAACATTGCGGGTTACATGCATTTCTGGGGATTGACGGTTGATACGGTGA
CCACTATCCAGTTGATTCTGGCTATCGGTCTGTCAGTCGATTATTCCGCT
CATATCGGGCATGGTTTCATGGCTGCACGCGAAGGAAA
Run BLAST on NCBI

transcript from alignment at scaffold_91:326960..339689-

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00073407 ID=TCONS_00073407|Name=TCONS_00073407|organism=Clytia hemisphaerica|type=transcript|length=12730bp|location=Sequence derived from alignment at scaffold_91:326960..339689- (Clytia hemisphaerica)
GTCAAAAAAGGATTGGATCGAGTTTAGGGGGATGATTAAATAATAAAGTG GCACGCGCCTGACCGTGCGACTACGTTTTTTTTTCAAGGTATCGGCGTGG ATGATGTCTTTGTCATTATTCAAAATTGGGACAACATTGGTGGCCCTAAA AATCGTGACCGCTCGATCGCCGAAAATGTTTCTCTCGCATTGAGAACTGC TGTAAGAACATTACAATTACATGTTAATTTTTTCCTACATTAACAACATT AACAATTTCCAATTAACACACACTCGCTCGAAAAGGAGGAAACTTCTAAT TAGCGGACAGTTTCATTTTCTCCGGCCGTTTGAGTCGAGTCGATATTTTA CGTGGATAACCCAGTAATCTAGGACTTTTCGACAGTCTTTCGATTGTTTC GATTTCGATTCACGGGGTCCACGGCCAACCGGCTCGGCTATCTATGAACT GAACAGGACATTGAAAGGAGCGGGGATTCGAACCGTGAATCCCTGGTTTG AGACGCTGATGCCTTTGACCACTTGGCCATCGTTCCTTTCCTAGAAATAC TTATAAAACAGTTGGCGGTCACTGACCTGTTTGCACGCCATGTGTCCATT AATTAGAAGTGTCACTCTATTCTTAAGAAAGGGGACCCCGCAAGAAAGGG CTCGAAGAACAGACTTTTTTTCAAATGGAATTTGCAGATTTGACAAGATC TTGATACTTAGATCTATAGCTACACACAAGGTTTTGCTATCAATTAAAAC ATTTTCTATTCCCTTAAGCGTCTTAGCTTTAAACCTTTAAAAACTTAAGT CAAATTACACAAAAAGCGTTATTATTGCAAATGGAAACATTAATCTAATA ATTTAATTAACGACTACCTATTTTAGGGCGTATCCATCCTGGTCACGTCA ATCACGGACGTTTGCGCTTTCTTGATCGGAGCAACTACAATCCTTCCCGC CTTACGATCGTTCTGTATTTTCGCTGGCATTGGTGTTTTAGCCGTCTTCA TTTTAACATGTACATTTTATGTGGCTTGGTTGGCTTTGGATAGCAGGAGG TAAGGTTTCCTTAAAGGGACATAAAAGTACTGACGAAATTTGTAAACAAA CCGTATGCAGCGAGATACAAAATCAAAACAAATATCACATGTCAAAATAA AAATAAAAACAAATGTTACATGTCAAAATAAAAAATAAAGACAAATATGG CTGATTTTGATTGTTTCTTGAAATTATTGTTTTACAAGTTTGTTTTGAAC ACGTGATTTTAATTGTTCTCTTTTAATGACACATGGTTCGCGCAATGCTT ACATTTTACTACTCAGTGACTTGGACAAAATCCAATTTATTTCTTTAAAC CTACCAAACCTGATAAGGTAATGAGATAGGAACTAAATTATCCAGATGAG ATGGAGTTTTTATAAGATACTTTAATAATTAGTCATTTGAAGTAATAGAA ATGACGCGTTCTTTAGAAAAAGTAACAAAATTGTTTTATTACTGGTTAGC GACCAACCAAATCAAATAAGAGCTTGTAAAAACTTCATCTCGTCCGAATT ACCTTCTCAACCTAAATTTTTTTTCTTTATCGAAACATAAAAGACTGGGT CCTTCTCTCCGCGGCATTTGATAACCATCCAATCTTTACAGCTCAAAATA CTCCTAAAATGGTGCAAGTTTCATGTTTTCATGTTTCAAATTTGAATAAG TATAAGCTTGTTCGCTTTATATTTGTAACCACTCCCCACTAAACCTTGAT ACATTTTCGCCCAGCTAATTCTTTTGACCAATCAAAATTGTTCTTTTAGA CAACGTGACCACCGTGACGCGTGTTGTTGTTGTGCGTCTTTACCGACGGA TTGGCAACCGTTGGAATGTTCAAAGAGAATGTACCTTCAAGAGTTCATGA GAGGAACTTATTCAAAAGCAATTCTCTCTACGCCTGGTCGGGTAAGCTAA TTTTCTATTTCTATTCGGTTGAGTTGATGAGGATGCTCTGAGGCAACTGT TGATGCTTTCAAGAGTGTATCTCACGTTCGCTTCGTAGTACACTCTATTC GCATTGTCTGTACAGAAACCTCTGCGATGAGGCTTGATTTATACTTAGCA ACTCTTATCTCGTCGTCTCCCCTCTCTCACCAACACTCCATCGCAGCGGT CGGTTTGAAAAATCTTAAATGAGAAAAGACAATGACAACAGACCCTCTAC AGCATTGAATTTTGAAATAAGCCGTAGATACTGGGTTTGTGTACAGACAA TGAGCGCCCAATCAGCACCTTATACTGACAACCCGATTCCCCCGCCCCAT GCCACGCCTGAGTGAAGGTTATAAAGTGAAGCGCTGCTAGTGGGAATCGA ACCATAGTCGCTTGTACAGCAACCAAGGTTAATAACTACCGTGGCTTGTT AGTGCCATGTGTAAGCTACTTATACTTATAGGTTCTTGCTAAGTCGACTT AATAGGGCTAAGTTGTAAGTCAACTTATAAGTGCTAAGTCGACATAGAAC CTCTAAGTATAAGTAGTTTACACATGGCACTAACAAGCCACGGTAAATAA CCGCTTTGCCACAGCGCCTGTATACCATTTACGCTCTTCCATAGTACAGT TACCGTCTTCGAAAGAATTATATGGGTGTAGACACTCTTGGTGCTTTTGA AGTTGTACCCCTTAGGCGTACAAACTTTCGCGAGCAGAATTTTTTGCGAG CTCGAAAAATCGCGAAATTTACAATATTTGCTTTCGCGAATTTGAGGAAA AAATGTTTTTCGCGAATAAACTTTCATATTTAGAAGTTTTTTTACAAAAT TTGGAGGATGTACCGTGTTTCAATCCCGACTTATGGAAGATTTTGAAAAT CGTTAAAAATTCATTTTCGGTATTAACCACCTGTCACTCTTTTGTCAATA ACTTTTTTTGCCCAAGGTGTAAAAATTGACTCTACCTCACATCCGAAAGC TGATAAAATTATCTTTCCAACGGTGTATAGAAACCTTCTATTCGTTTTTT TTCTAGGTTGACTCTATTTTCGACAAAGTTCTACAGGACTAGAATCGTTG GTTAGAATGAGAATTTTCGAATGAAAAAGTGAAAAACATTCCTTAAATCC GATAAAGACGGTTGCTCTTCGACTTTAAAAAGGGATTTTAGGATAAGAAA ATGCTAAAATTTTGATATTTATTACGATTTCGAGGTTTTATAGAAACTTT CGCGAATTGCCCTGTTAAGAATTTTCAAAGACATTTACTCTCGCGAAAAA GGCCAAAATTCGCGTAAAGTTTGTACGCCTAAAGTGCTGTTTCAATCAGT TTTAAGGTTTCTTGCCAATGTGAGACTTTTCTTGACTCATGTGTTGGTTT TTTAAGCAATGAAATTAGTTGACAGCTTTATATCCAACTTTCATTTTCAA ATCGTATTAGTATACTGTTTTCAGGCTTATTCGCGAAATTAAATCCACGC GAAAATTTTCAAACCCTGACTCTCGAAATAAACTCCAGAAATACATGTCT GAGTTTCTGAACCCTCTTTTCCTTTCTGTTTAAGATTGTTTTGATGTTGG TATGGGCTGGTTTATTAGCGGGAGGTGCATACGGTCTTTCACAATTGAAA CAAGATTTCGATCCTGAATGGTTTTTACCGGAAGATTCGAACGCCAGGAT TTACAGCTCCGTGGATGATAAGGTAAATGATAACCCTGGGTTAGTATCTG GTGCATATATTTCTTATACTAGATGGAGCTTCTTCTTTTATCTCTCTGGG TCAGGTTTCAGAGGTATCGGCCACTTTTTAATGTACTTTTTATGCACAGT AACTTCGTGTCATGCCGACATACCTTGTCTAATTCCGTCATAGCAACTAT CTGGTCTTTAAAAATGTTTATAAATAAAACATTTTAAGTAAGCTGTTAAA AAATTCACTTTAATTACTTTGCAGACCAGATAGTTGCTATGACGGAATTA GACAAGGTATGTCGACGTTAGACGAAGTGACGGTACTTTTTATGTAGTGA TTTGCTGGTCAACCTGAAATGGGCAGTTCCAGAAAAACCATTACCCCCCC CCCCCTGTGGACGACAGGGTTTTTTTGGATTCTTTTTCACTTGGAAATCC TGAGAAATTTTGAAAAAGGTTACGGAAAAGGCACGATTTTCCTGATTATT TGGTCATCCGTATCGGAAAATCCTTAAAATTTGCTCTATTTTCTTGTTAA GTATCGGAAAATCCAAGATTTAGAATTCCTTAAAAATTCTTTAAAAATTC TTGAATAGCATAAGTGAATTGTTACGGAAAATCCATGTCGTCCACATGGG GTAACGAACTATAACTGGAACCGCCCAATCAATTCCAATAACGTTTCGTT TAATAGTATTTCTCGAATGATGGTATCCAAGCCTATGCGTACATTGAAGA TGTTGACTATTTTGCAGACCAGGACAAGTTAGTGAGCATGTATAACACAC TGGAGAATAACCAGTACACTGTTAAGGGAGAAACTCAGAGTTGGTATCAA ACCTATATCGCATGGATGGCAGCCAATCACGCCGCTGATTTGACCAACGG TTTGTTGTTGTACTTTTTGTTTTTCATTTGTGAGATTTTACTTAGGTGAG ACTAATTTAATTTGTTGTTTTACGGGACAAGTAGCAAGCACATCATCAAA AACCGAGATTATTCATCCCGTTTCTACACTGTAACGTCTGTTCCACTTTG CGACTTTTTCGAATGTTTTGAGCCCAGGTTTTCGGGCTCTAAACATTCGA TTTTTTGACGTCACTTTAAACGTTTGAAGCTCTTGTAGTATCAAAAAATC GAATTTGCGTCAAAACACTTGAAAGGCTTCTTTTTTTTCGAAAATCGTGA AAGTGGAACTCACTAACACTAAGAAACGGGATGAAAAATCCCGGTTTTTG GTGAGGTGCTCTCTATAGTGAGTTCCACTTTGACGATTTTTCTCAAAACA TACGAAAAAGTCGCAAAGTGGAATAGACGTTAATTGTGTAGAAAAAGCGC GGGTGACGTCTAGTATAGTCTACGGGACAAGCTACCCAAAAAAGAGGGTC GGTCGGTCGGTCGGTCTGTCGGTCGGTCGGTCGGTCGGTGAAAAAATAAG AATAAAATATACTTCCACTTTTAAATGAGAGTAACGCATCAATACCAACA TCACATTTATTATGATGTCCTTTATCAAAATCTTGATTTATTTCTTTGTC TAGGTAAACCAAGTACGAAAGATATATTTTACAATCGATTAGATGAGTTT ACGAAAACACAAGTTGGGAAAGTTTTCGAGAAGGAGATCAAAGGAAACAT AACGGAACAAAAGATTGAGGTTTGTATGATTACACGTTTTTTTATAAGGT ACTTTAGCCCGGCTCCGAGCCTGGAGCTCCTCATTAGCGACATTATGTAT CAAAGATATTCTGCGGCTATGGTTGCGGGGCTGCCCATGCGGGTCGTCAC CAAAGGCGACATGTTGTTGTCTATTTTGCTCTGTACGGGAACAACACCAA AAAACCGTATAAGCAATAAGTCGACATAATGCCGTACGTCAAATATCGAA CTTGCTTTCACCCGCCATTACTTGCCTCGCCGCTTTAACTGTAGCCGTAG AGAATTCCAGATACATAATCTCTTTATTTTTCCAGAGGGTTTAGCCTTAA AGTTCCCTATCGAGTTCCTTATTTACTTAGCTACTTAGTTTAGACTGATA TGATGCTTTGTTTAACAATGTTATACTACAATACATAAAAAAGACGTTTA TTGAACGTTGTTTCGTCAATATTCTATAAATTTTTTTGTTTAGGTTGTTG TAAATGAGTGCAAGTCTAAATCGTACTGTTCCTTAACTTGTCTTGTTATT CTCAGCCTGAATAATTCCTTAACAATTCCTTATTTTTTGGACCATTTCCA GCCTCAAGTTCCTTATAAACGTGTTCCTTAAAAAAAGATGTAGTGTCAAA AGCTAAAAATTGATCAAATCGATTAAGTAAAAAAGTCATTATAAGGGTAA TTCTTATTGAACTACTTTCTTAACCAAAAAGGGGGGGTTTTATACTAACT GTTAACACCTTCTCTCCGGGCCCGGCGGGGTACTACCCTTGCCGACCGAC GGGGGTGCTCCGCTGAGGTTCGAAAAATGGTCCCTACGTTGGACTCGTTT TTTCAAAAATTTTGCCCAAATTTGCGTAAAAAGTGACCCTGAATGGGGCT GAAATTCCAAAATTATCTCAAATTTTTTACTTTTTCCCCAAATTTTCCAA AAAAGACACCCTACGAGGGACTGATTTTTCTATTTTGAAGTTTTTGCGAC CCTAACCGGGACTCGTGGAGGTTAAAAAAGGTACCCTCACCAGCGGCGCA TCCCCGTAACCCATTTTGCCCTAGTATCCCCCGGGACACCTCTCTTGGCA CCCATAACGTGGTTCGTTTGGTTTGGTTTCGTTTACAGGCTTCTCGTATC AAATACAAACATATCAAATTGGAAGGCGCTTCGGTTGAAGTCAAGGCAAT GGACAGTGTGCAAGATGAGCTTGCCAAAATCACATTCACTAATGACTTCA GTCCTTTCGGTTACACAAGGTTCTACGTTGGCTGGGAAACAAATAAGGTA TTGTCTTATTTGGTTATTAGGTAATCATCATCGAGTTTGAAAGCCCTGAA GGCTAAAACTCTTTGATGGGAAATTGGCTATTCGAGAAAAAAAATTGTAC CCCCTAAGTTGAGAAGGTCTTTTTCGGAAAGATGACCCCCTGGATTTTTT CAATTTTTCAGGACCCCCTGGATTTTTTTTCTCTCATTCTTTTTACCACC ACTTTTCGACCTCGTCTTACTGAACACCTTGGATTTTCTACCTCATTTTA CTAACCACCCTGGATTTTTACACTCGAAAAACTAGACCCCTTTGATTTTT AATTTTACCGACCACCCTAGACTATTTCTGGAATAGCCACTTATTTACCA TATGAAACCTGTGACTCGCGTGGTTTTTGCACAAACGCCAAATTAAAAGG AAAATCCATTCACAGATTTTGAACACTATATGTCACTTCAAAATAAAAAG CGTTAGATTCAATCTCTCATTTTAAAAGCGGNAGGTAATTCTTATTGAAC TACTTTCTTAACCAAAAAGGGGGGGGTTCTATACTAACTGTTAACACCTT CTCTCCGGGCCCGGCGGGGTACTACCCTTGCCGACCGACGGGGGTGCTCC GCTGAGGTTCGAAAAATTTTGCCCAAATTTGCGTAAAAAGTGACCCTGAA TGGGGCTGAAATTCCAAAATTTTATCAAATTTTTTACTTTTCCCCCAAAT TTTCCAAAAAGGACACCCTACGAGGGACTGATTTTTCTATTTTGAAGTTT TTGCGACCCTACCTGGGACTCGTGAAGGTTAAAAAAGGTACCCTCACCAG CGGCGCATCCCCGTAACCCATTTTGCCCTAGTATCCCCCGGGACACCTCT CTTGGCACTCCTTAACGTGGTTCGTTTGGTTTGGTTTCGTTTACAGGCTT CTCGTATCAAATACAAACATATCAAATTGGAAGGCGCTTCGGTTGAAGTC AAGGCAATGGACAGTGTGCAAGATGAGCTTGCCAAAATCACATTCACTAA TGACTTCAGTCCTTTCGGTTACACAAGGTTCTACGTTGGCTGGGAAACAA ATAAGGTATTGTCTTATTTGGTTATTAGGTAATCATCATCGAGTTTGAAA GCCCTGAAGGCTAAAACTCTTTGATGGGAAATTGGCTATTCGAGAAAAAA AATTGTACCCCCTAAGTTGAGAAGGTCTTTTTCGGAAAGATGACCCCCTG GATTTTTTCAATTTTTCAGGACCCCCTGGATTTTTTTTCTCTCATTCTTT TTACCACCACTTTTCGACCTCGTCTTACTGAACACCTTGGATTTTCTACC TCATTTTACTAACCACCCTGGATTTTTACACTCGAAAAACTAGACCCCCT TGATTTTTAATTTTACCGACCACCCTAGACTATTTCTGGAATAGCCACTT ATTTACCATATGAAACCTGTGACTCGTGTGGTTTTTGCACAAACGCAAAA TTAAAAGGAAAATCCATTCACAGATTTTGAACACTATATGTCACTTCAAA ATAAAAAGCGTTAGATTCAATCTCTCATTTTAAAAGCGGCGCAAATCTTA TTAAGGCTTTAAACCCAATGATCGTCTTATAAAAATGTTTTAAAACCTTG CCTTTTATTTTGCCTCAAACAAAGAAATAAACTTGCAAAAGTATACTTTA AGGAAAGAAATTTTAGCGGGAATTTAATCTGGCGTGTAGTCGAAAAAGTT TTTTCAGAGGGAATTTAATTTTGACGGATGGTGGGAAAAGTTAAAATATC GGCGTTAACTTAATTTGGCGGAATTTGGCCAAATTTCACTTTCTTTCCAC CAAAATTTCTTCCCTTAAGGTGAATAATAGTGCAATCTGGATGTGCCAAA AAGTCATTAAAACATTGTGCACAAAGGTGAATGGTCCTGGAGTTTTTGCT GACGTCAACAATTACGTCATTTTTCAAAAAGCNTTGAAAGCCCTGAAGGC TAAAACTCTTTGATGGGAAATTGGCTATTCGAGAAAAAAAATTGTACCCC CTAAGTTGAGAAGGTCTTTTTCGGAAAGATGACCCCCTGGATTTTTTCAA TTTTTCAGGACCCCCTGGATTTTTTTTCTCTCATTCTTTTTACCACCACT TTTCGACCTCGTCTTACTGAACACCTTGGATTTTCTACCTCATTTTACTA ACCACCCTGGATTTTTACACTCGAAAAACTAGACCCCTTTGATTTTTAAT TTTACCGACCACCCTAGACTATTTCTGGAATAGCCACTTATTTACCATAT GAAACCTGTGACTCGCGTGGTTTTTGCACAAACGCCAAATTAAAAGGAAA ATCCATTCACAGATTTTGAACACTATATGTCACTTCAAAATAAAAAGCGT TAGATTCAATCTCTCATTTTAAAAGCGGCGCAAATCTTATTAAGGCTTTA AACCCAATGATCTTCGTATAAAAATGTTTTGAAACCTTGCCTTTTATTTT GCCTCAAACAAAGAAATAAACTTGCAAAAGTATACTTTAAGGAAAGAAAT TTTAGCGGGAATTTAATCTGGCGTGTAGTCGAAAAAGTTTTTTCAGAGGG AATTTAATTTTGACGGATGGTGGGGAAAATTAAAATATCGGCGGGAACTT AATTTGGCGGAATTTGGCCAAATTTCACTTTCTTTCCACCAAAATTTCTT CCCTTAAGGTGAATAAAAGTGCAATCTGAATGTGCCAAAAAGTCATTAAA ACATTGTGCACAAAGGTGAATGGTCCTGGAGTTTTTGCTGACGTCAACAA TTACGTCATTTTTCAAAAAGCCTTCCGCAATAACTTTTATTGGCTTCATT TTCTGATGTAGGTAATGTATTTCTAAACGAGCATGAAAAACGCTTTCCAA CGGTGTGTAAAATGACATACTTTGGAGAAAAAAATCATTTTAGCCTGGGA ACCTGTTCTGGTCTGTAAAATACACAAACAGGTGCCAATTTTTCGGGTCT GAGATTTAAATCCATTTTTGACCCCTAAATTACAATTGTACAAAATCTCA TGCTTGTACGCCTTTGTGCACAATTTTTACACAACTAGACCGTACTAAAT TTTTTTCTTCTTTGACAGGTCATTTCTGAAGAATTGATACGTAATTTGTT GTTGGCTGGTGTTATTGTGTTCTTGGTGACATTGTTCTTGATCGCCAACG TCTGGGTCTCCTTACTCGTCCTCACATGTGTTGTCTTCACTCTGGTAAGC AGAAAAAAAATTTACCCCTACTGTTTTGGATATTGACTTTTCGAAGTATC GAACCCCCTGGCAGTCTGTGCCACTAACTCGATCGGGAAGATTTTTCCGA AATGGGAGGTTGAAAATTGACTGAATCTTCGGCGAAGCTTACGATGACCT GCTAAAGTTGAAACTTTTTGGAGGTGAAAAAGCATCAAATTTTAAGATTT TGCACTGAAAGAGAAATAAACTTTACCGTAGAAATCTTGTTAAATTGTGA AAAAACTGCGTAGGCTACCCGAACGGGAAGTTCCAACCCGATCGAGTTTT CCTTATTTTCTCGCTTCTTCCCGATCTGGAAGTCCGTTTTTTAACTCTTA CCCATTCATTACCCGTTGGGTGTCAAGTTAATTTCCTGTTCGGGAAGGCT CTTCCCATTTCGGAAGAATCTTCCCGATCTAGTTAGTGGCACAGACTGCC TGGATATCCACTTTTAAAAATATGCTCAACTCCTTTGGATATCCTCTCTT ATAAAGATGCTTACCTCTGGATATCGTACTTTTTACTTGAAAAGACACTT TACCCCCTGGATATCCGCTCCCTTGTAGATATTTGAAATTTAAGATATTT GAACAAAAATCGTTAAACCCCTTTGATATCCGATATCTTCAAAAGGAGGG GACGGACTTTTTCTGGAAAAGCTCATTATGGCGTAACATAAAAGTTGGTT AATTTTCGCGTGGGCGTTTTTCTTGAATTGAGAATCTAAAATTTTCGCAT TGACGAAATTTGGCGAATCGGCCTCTTTTTCACACTACAGTATATGGCCC CCAAAACGGAGACGGCCCCCAAAACGGAGGTTTTCATTAATATGAAGATT CTGACTTGTAGATTTATCAGAATTAAACAATTGTTGTTTATTTTGAAAGA ATGATGGTTATACTTAAAAATGAGCATGTTTTTGATGGTTTGATACAGAT TCAAAATAACATATTTGCGTCTAAAGGAAATATTTTAACACCATAATTAG ATAAAAATTGGATATAACTCACTCTAGCTCCTTGGATATTGAAAATAAGT TATGAAAACGGGGTATAGAAAACTTTCTACACCTAATGCCGTTCAGAAAN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNGTATCTTAAAGATATCTCGAGAAATCGCTA AAATTGCAAACCTCCGTTTTGGGGGCCATTAGAAAAAAGCTACCTATCTT TAAGCGATTGAAAAAATTGTTGAAATTGAAAATTTTGAAAAAGAACTTCC AGGAAATAAAGTAGAGATGTTAAAGGGGTTCGTTCATGCAGCAAAAATTT TTGTAAAAATCTCTTTTCCTCTAGATTTGAGAGAAATTTCAAATTTGATC GCCGTTTTGGGGGCCACATACTGTATATCTTTCATTTTCCTAGGGGTTTT TGGCCAAAATTCGGATTTTAAAATTATTTCGCGAGGACTAATGTTTGCGA AAACCGCGAAGATTGATCAACGGGAAATTTGATTCAGTCAATTTTTTTAA AGAGGGTTTTGGTAAAGTCTTGTATTTTAACAGTTTCCTTATATTGTGAT CAATACTATGTGCTAGACCTTCGGTGAAATTGTTTTTGTGCTTCTCTTGG TAGGCATGCTTGACTCAAGGTGCCTTTTTCTTTATCGATGCCTTATCTTT CTGACATTCACAAGACCTTTTATTGTTTCAGCATAAAAAAGACGGAATTG AGGAAATTTTTTCAAATAAATGATACATCCCCTAGTGTTTTATACACCTT TTCGACGGTAGCCGCCAATTGCCGTGCGGGCATTTTTATCCCACTAAAAC CGTCCCAGTCCTTTTTTTCGTACCTATAGACAATAAAAAAATGTGTCAAA AAAGAACTTGGACGGATAAAAATGCCCGCGCGGCAATTGGCGGCTACGGT CGAAAAGGTGTATTGAATGATTGTTTCGAAATTCTTTTAGATCAACATTG CGGGTTACATGCATTTCTGGGGATTGACGGTTGATACGGTGACCACTATC CAGTTGATTCTGGCTATCGGTCTGTCAGTCGATTATTCCGCTCATATCGG GCATGGTTTCATGGCTGCACGCGAAGGAAA
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_045553XLOC_045553Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073407-exon-scaffold_91-1575043694:339489..339689TCONS_00073407-exon-scaffold_91-1575043694:339489..339689Clytia hemisphaericaexon
TCONS_00073407-exon-scaffold_91-1575043694:338641..338813TCONS_00073407-exon-scaffold_91-1575043694:338641..338813Clytia hemisphaericaexon
TCONS_00073407-exon-scaffold_91-1575043694:337749..337890TCONS_00073407-exon-scaffold_91-1575043694:337749..337890Clytia hemisphaericaexon
TCONS_00073407-exon-scaffold_91-1575043694:336018..336155TCONS_00073407-exon-scaffold_91-1575043694:336018..336155Clytia hemisphaericaexon
TCONS_00073407-exon-scaffold_91-1575043694:335141..335333TCONS_00073407-exon-scaffold_91-1575043694:335141..335333Clytia hemisphaericaexon
TCONS_00073407-exon-scaffold_91-1575043694:334371..334486TCONS_00073407-exon-scaffold_91-1575043694:334371..334486Clytia hemisphaericaexon
TCONS_00073407-exon-scaffold_91-1575043694:333121..333251TCONS_00073407-exon-scaffold_91-1575043694:333121..333251Clytia hemisphaericaexon
TCONS_00073407-exon-scaffold_91-1575043694:332035..332062TCONS_00073407-exon-scaffold_91-1575043694:332035..332062Clytia hemisphaericaexon
TCONS_00073407-exon-scaffold_91-1575043694:329896..330021TCONS_00073407-exon-scaffold_91-1575043694:329896..330021Clytia hemisphaericaexon
TCONS_00073407-exon-scaffold_91-1575043694:326960..327099TCONS_00073407-exon-scaffold_91-1575043694:326960..327099Clytia hemisphaericaexon
TCONS_00073407-exon-scaffold_91-1510915933:339489..339689TCONS_00073407-exon-scaffold_91-1510915933:339489..339689Clytia hemisphaericaexon
TCONS_00073407-exon-scaffold_91-1510915933:338641..338813TCONS_00073407-exon-scaffold_91-1510915933:338641..338813Clytia hemisphaericaexon
TCONS_00073407-exon-scaffold_91-1510915933:337749..337890TCONS_00073407-exon-scaffold_91-1510915933:337749..337890Clytia hemisphaericaexon
TCONS_00073407-exon-scaffold_91-1510915933:336018..336155TCONS_00073407-exon-scaffold_91-1510915933:336018..336155Clytia hemisphaericaexon
TCONS_00073407-exon-scaffold_91-1510915933:335141..335333TCONS_00073407-exon-scaffold_91-1510915933:335141..335333Clytia hemisphaericaexon
TCONS_00073407-exon-scaffold_91-1510915933:334371..334486TCONS_00073407-exon-scaffold_91-1510915933:334371..334486Clytia hemisphaericaexon
TCONS_00073407-exon-scaffold_91-1510915933:333121..333251TCONS_00073407-exon-scaffold_91-1510915933:333121..333251Clytia hemisphaericaexon
TCONS_00073407-exon-scaffold_91-1510915933:332035..332062TCONS_00073407-exon-scaffold_91-1510915933:332035..332062Clytia hemisphaericaexon
TCONS_00073407-exon-scaffold_91-1510915933:329896..330021TCONS_00073407-exon-scaffold_91-1510915933:329896..330021Clytia hemisphaericaexon
TCONS_00073407-exon-scaffold_91-1510915933:326960..327099TCONS_00073407-exon-scaffold_91-1510915933:326960..327099Clytia hemisphaericaexon
TCONS_00073407-exon-scaffold_91-1491911889:339489..339689TCONS_00073407-exon-scaffold_91-1491911889:339489..339689Clytia hemisphaericaexon
TCONS_00073407-exon-scaffold_91-1491911889:338641..338813TCONS_00073407-exon-scaffold_91-1491911889:338641..338813Clytia hemisphaericaexon
TCONS_00073407-exon-scaffold_91-1491911889:337749..337890TCONS_00073407-exon-scaffold_91-1491911889:337749..337890Clytia hemisphaericaexon
TCONS_00073407-exon-scaffold_91-1491911889:336018..336155TCONS_00073407-exon-scaffold_91-1491911889:336018..336155Clytia hemisphaericaexon
TCONS_00073407-exon-scaffold_91-1491911889:335141..335333TCONS_00073407-exon-scaffold_91-1491911889:335141..335333Clytia hemisphaericaexon
TCONS_00073407-exon-scaffold_91-1491911889:334371..334486TCONS_00073407-exon-scaffold_91-1491911889:334371..334486Clytia hemisphaericaexon
TCONS_00073407-exon-scaffold_91-1491911889:333121..333251TCONS_00073407-exon-scaffold_91-1491911889:333121..333251Clytia hemisphaericaexon
TCONS_00073407-exon-scaffold_91-1491911889:332035..332062TCONS_00073407-exon-scaffold_91-1491911889:332035..332062Clytia hemisphaericaexon
TCONS_00073407-exon-scaffold_91-1491911889:329896..330021TCONS_00073407-exon-scaffold_91-1491911889:329896..330021Clytia hemisphaericaexon
TCONS_00073407-exon-scaffold_91-1491911889:326960..327099TCONS_00073407-exon-scaffold_91-1491911889:326960..327099Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_91supercontigscaffold_91:326960..339689 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
1.23897 1.16289 2.32495 0.482555 34.6465 19.9642 15.0816 15.0664 5.23041 5.12697 4.2241 5.93771 3.21756 6.21831 3.5667 5.12243 12.2957 15.8784 9.11573 10.1209 9.49287 13.8588 1.00538 8.08914 49.0389 38.3673 7.8112e-07 0.528182 0 0
Blast
BLAST of TCONS_00073407 vs. Swiss-Prot (Human)
Match: NPC1 (Niemann-Pick C1 protein OS=Homo sapiens GN=NPC1 PE=1 SV=2)

HSP 1 Score: 120.168 bits (300), Expect = 1.070e-28
Identity = 107/493 (21.70%), Postives = 219/493 (44.42%), Query Frame = 1
Query:   76 FFFQGIGVDDVFVIIQNWDNIGGPKNRDRSIAENVSLALRTAGVSILVTSITDVCAFLIGATTILPALRSFCIFAGIGVLAVFILTCTFYVAWLALDSRRQRDHRDACCCCASLPTDWQPLECSKRMYLQEFMRGTYSKAILSTPGRIVLMLVWXXXXXXXXXXXSQLKQDFDPEWFLPEDSNARIYSSVDDKYFSNDGIQAYAYIEDVDYFA-------------DQDKLV-SMYNTLENNQYTVKG-ETQSWYQTYIAWMAANHAA----DLTN---------------------GKPSTKDIFYNR-----LDEFTKTQVGKVFEKEIKGNIT-----EQKIEASRIKYKHIKLEGASVEVKAMDSVQDELAKITFT-----NDFSPFGYTRFYVGWETNKVISEELIRNLLLAGVIVFLVTLFLIA-NVWVSLLVLTCVVFTLINIAGYMHFWGLTVDTVTTIQLILAIGLSVDYSAHIGHGFMAAREG 1386
            F    +GVD++F+++Q +      + +  ++ + +   L     S+ ++S ++  AF +GA +++PA+ +F +FAG+ V   F+L  T +V+ L LD +RQ  +R    CC     D   ++ S+   L  F + +YS  +L    R +++ ++ G+L+     L+++    D    +P+DS    Y     +Y        +   E  DY +             + D LV  ++N  + + YT  G    SW   Y  W+    +     ++T+                     GK   +   + R     L +    + GK         +        ++ A+     H  L+ ++  + A+   +   + +T T     + +  F Y+ FYV +E    I ++ I NL ++   +FLVT+ L+   +W ++++   +   L+N+ G M  WG++++ V+ + L+++ G+SV++ +HI   F  + +G
Sbjct:  692 FLVLAVGVDNIFILVQAYQR--DERLQGETLDQQLGRVLGEVAPSMFLSSFSETVAFFLGALSVMPAVHTFSLFAGLAVFIDFLLQITCFVSLLGLDIKRQEKNRLDIFCCVRGAEDGTSVQASESC-LFRFFKNSYSPLLLKDWMRPIVIAIFVGVLSFSIAVLNKVDIGLDQSLSMPDDSYMVDYFKSISQYLHAGPPVYFVLEEGHDYTSSKGQNMVCGGMGCNNDSLVQQIFNAAQLDNYTRIGFAPSSWIDDYFDWVKPQSSCCRVDNITDQFCNASVVDPACVRCRPLTPEGKQRPQGGDFMRFLPMFLSDNPNPKCGKGGHAAYSSAVNILLGHGTRVGATYFMTYHTVLQTSADFIDALKKARLIASNVTETMGINGSAYRVFPYSVFYVFYEQYLTIIDDTIFNLGVSLGAIFLVTMVLLGCELWSAVIMCATIAMVLVNMFGVMWLWGISLNAVSLVNLVMSCGISVEFCSHITRAFTVSMKG 1181          
The following BLAST results are available for this feature:
BLAST of TCONS_00073407 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
NPC11.070e-2821.70Niemann-Pick C1 protein OS=Homo sapiens GN=NPC1 PE... [more]
back to top