Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00073372 (transcript) - C. hemisphaerica

Overview
NameTCONS_00073372
Unique NameTCONS_00073372
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length463

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00073372 ID=TCONS_00073372|Name=TCONS_00073372|organism=Clytia hemisphaerica|type=transcript|length=463bp
AGCAAGTGGTTGTTGTTCCAAGAGGCCAGGCGCGTTATGAGATGCTAATC
GTCGTAGGATATTTGATGACGATCTGGTAACCGTTGCTTGTGTTGGTTGT
GCTGGCTGAGGCTGAGCGGGCATAGGAACTGTTGGATGAGGAATAGTTGG
AGGAGTGGTCTCTAATGGTGAGGCTGGAGGCAGATTGGTGGGTGTGGGTA
GTGCTGTTGGTGATACAAATGTTGCTGGTCGAAGGAAGCGACGATTTTGC
AGTGTCACCCTCCCTGAGCCATTGGTTCTGACTCTGTATTGTCTGTTAGG
GAGTGTTTCTACAATCATCCCAGAGCGGATCCATCGGCGTTGATGCTTCT
TACTACGGTTTTGGATGACGACAGCAGTTCCAACCGATAGGGACGGTAAT
GTTTTGGCGTGTCTGTTGTACTTCTCACTGATGACATGGTTTCGTTTGGA
GAATGCTTCTTCC
Run BLAST on NCBI

protein sequence of TCONS_00073372-protein

>TCONS_00073372-protein ID=TCONS_00073372-protein|Name=TCONS_00073372-protein|organism=Clytia hemisphaerica|type=polypeptide|length=154bp
EEAFSKRNHVISEKYNRHAKTLPSLSVGTAVVIQNRSKKHQRRWIRSGMI
VETLPNRQYRVRTNGSGRVTLQNRRFLRPATFVSPTALPTPTNLPPASPL
ETTPPTIPHPTVPMPAQPQPAQPTQATVTRSSSNILRRLASHNAPGLLEQ
QPLA
Run BLAST on NCBI

transcript from alignment at scaffold_90:112009..112471

Legend: exonfive_prime_UTRCDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00073372 ID=TCONS_00073372|Name=TCONS_00073372|organism=Clytia hemisphaerica|type=transcript|length=463bp|location=Sequence derived from alignment at scaffold_90:112009..112471 (Clytia hemisphaerica)
GGAAGAAGCATTCTCCAAACGAAACCATGTCATCAGTGAGAAGTACAACA GACACGCCAAAACATTACCGTCCCTATCGGTTGGAACTGCTGTCGTCATC CAAAACCGTAGTAAGAAGCATCAACGCCGATGGATCCGCTCTGGGATGAT TGTAGAAACACTCCCTAACAGACAATACAGAGTCAGAACCAATGGCTCAG GGAGGGTGACACTGCAAAATCGTCGCTTCCTTCGACCAGCAACATTTGTA TCACCAACAGCACTACCCACACCCACCAATCTGCCTCCAGCCTCACCATT AGAGACCACTCCTCCAACTATTCCTCATCCAACAGTTCCTATGCCCGCTC AGCCTCAGCCAGCACAACCAACACAAGCAACGGTTACCAGATCGTCATCA AATATCCTACGACGATTAGCATCTCATAACGCGCCTGGCCTCTTGGAACA ACAACCACTTGCT

Coding sequence (CDS) from alignment at scaffold_90:112009..112471

>TCONS_00073372 ID=TCONS_00073372|Name=TCONS_00073372|organism=Clytia hemisphaerica|type=CDS|length=462bp|location=Sequence derived from alignment at scaffold_90:112009..112471 (Clytia hemisphaerica)
GAAGAAGCATTCTCCAAACGAAACCATGTCATCAGTGAGAAGTACAACAG
ACACGCCAAAACATTACCGTCCCTATCGGTTGGAACTGCTGTCGTCATCC
AAAACCGTAGTAAGAAGCATCAACGCCGATGGATCCGCTCTGGGATGATT
GTAGAAACACTCCCTAACAGACAATACAGAGTCAGAACCAATGGCTCAGG
GAGGGTGACACTGCAAAATCGTCGCTTCCTTCGACCAGCAACATTTGTAT
CACCAACAGCACTACCCACACCCACCAATCTGCCTCCAGCCTCACCATTA
GAGACCACTCCTCCAACTATTCCTCATCCAACAGTTCCTATGCCCGCTCA
GCCTCAGCCAGCACAACCAACACAAGCAACGGTTACCAGATCGTCATCAA
ATATCCTACGACGATTAGCATCTCATAACGCGCCTGGCCTCTTGGAACAA
CAACCACTTGCT
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_045526XLOC_045526Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073372-exon-scaffold_90-1491911889:112009..112471TCONS_00073372-exon-scaffold_90-1491911889:112009..112471Clytia hemisphaericaexon
TCONS_00073372-exon-scaffold_90-1510915933:112009..112471TCONS_00073372-exon-scaffold_90-1510915933:112009..112471Clytia hemisphaericaexon
TCONS_00073372-exon-scaffold_90-1575043694:112009..112471TCONS_00073372-exon-scaffold_90-1575043694:112009..112471Clytia hemisphaericaexon
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073372-proteinTCONS_00073372-proteinClytia hemisphaericapolypeptide
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_90supercontigscaffold_90:112009..112471 .
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
2.63068 0.624778 4.04515 3.17903 5.44388 3.88818 2.49167 3.80231 2.27049 2.95664 2.07032 2.08732 0.562883 1.45887 0.228605 0.293864 0 0.651088 0.148479 0.646043 0.334048 0 0 0.1456 0.780706 0.549825 0 0.220078 0 0
Blast
The following BLAST results are available for this feature:
BLAST of TCONS_00073372 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 0
Match NameE-valueIdentityDescription
back to top