Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00073370 (transcript) - C. hemisphaerica

Overview
NameTCONS_00073370
Unique NameTCONS_00073370
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length543

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00073370 ID=TCONS_00073370|Name=TCONS_00073370|organism=Clytia hemisphaerica|type=transcript|length=543bp
GTGAATCTGAATCTGAGGGAATGGCTCTTTAGCTTTTGAATGCGAGGATT
CTTTACTGAGCTGAGGTCCCGATCGTTGAAAATACCCAGCAATGGTTTAT
GGTCTGTTGTGATGATCAGGTTGTTGCAGCCGAGGACGAACATCTTGGCG
TGATCGAGTGACCAGGCAACGGCAAGTGCTTCTCCTTCTGGTGGANATGA
CGAACATGCGGCTTCGCATTAGGTTGAATATGGATGTGGGCAGGTTTTGT
ATCCATGGATGGAAATGGTCCGTCTCTGTTGAACGTagatttggaaaatt
gttctaaTAGGTAATGTTTGAGTTTTGGAACATTTCCCACTGTGGGTTCA
AAAGGTAATTTTTCTGGACGTTTAGGTAGATTACTTGGCAGGGTGTCAAC
GGAGGAAACGGTTGCTGACATAGGATATGGAAATGTCTCTGGTAGAATGT
TCAATTCTGTACACCCTTTACGACTGACATAAATTCTGTCAACTTTTTCA
CAAATGTATAGCGGTTGAGTAGTAGTGTGATTGTCTATTGTGA
Run BLAST on NCBI

protein sequence of TCONS_00073370-protein

>TCONS_00073370-protein ID=TCONS_00073370-protein|Name=TCONS_00073370-protein|organism=Clytia hemisphaerica|type=polypeptide|length=141bp
TIDNHTTTQPLYICEKVDRIYVSRKGCTELNILPETFPYPMSATVSSVDT
LPSNLPKRPEKLPFEPTVGNVPKLKHYLLEQFSKSTFNRDGPFPSMDTKP
AHIHIQPNAKPHVRHXHQKEKHLPLPGHSITPRCSSSAATT
Run BLAST on NCBI

transcript from alignment at scaffold_90:109966..110508

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00073370 ID=TCONS_00073370|Name=TCONS_00073370|organism=Clytia hemisphaerica|type=transcript|length=543bp|location=Sequence derived from alignment at scaffold_90:109966..110508 (Clytia hemisphaerica)
TCACAATAGACAATCACACTACTACTCAACCGCTATACATTTGTGAAAAA GTTGACAGAATTTATGTCAGTCGTAAAGGGTGTACAGAATTGAACATTCT ACCAGAGACATTTCCATATCCTATGTCAGCAACCGTTTCCTCCGTTGACA CCCTGCCAAGTAATCTACCTAAACGTCCAGAAAAATTACCTTTTGAACCC ACAGTGGGAAATGTTCCAAAACTCAAACATTACCTAttagaacaattttc caaatctACGTTCAACAGAGACGGACCATTTCCATCCATGGATACAAAAC CTGCCCACATCCATATTCAACCTAATGCGAAGCCGCATGTTCGTCATNTC CACCAGAAGGAGAAGCACTTGCCGTTGCCTGGTCACTCGATCACGCCAAG ATGTTCGTCCTCGGCTGCAACAACCTGATCATCACAACAGACCATAAACC ATTGCTGGGTATTTTCAACGATCGGGACCTCAGCTCAGTAAAGAATCCTC GCATTCAAAAGCTAAAGAGCCATTCCCTCAGATTCAGATTCAC

Coding sequence (CDS) from alignment at scaffold_90:109966..110508

>TCONS_00073370 ID=TCONS_00073370|Name=TCONS_00073370|organism=Clytia hemisphaerica|type=CDS|length=426bp|location=Sequence derived from alignment at scaffold_90:109966..110508 (Clytia hemisphaerica)
ACAATAGACAATCACACTACTACTCAACCGCTATACATTTGTGAAAAAGT
TGACAGAATTTATGTCAGTCGTAAAGGGTGTACAGAATTGAACATTCTAC
CAGAGACATTTCCATATCCTATGTCAGCAACCGTTTCCTCCGTTGACACC
CTGCCAAGTAATCTACCTAAACGTCCAGAAAAATTACCTTTTGAACCCAC
AGTGGGAAATGTTCCAAAACTCAAACATTACCTAttagaacaattttcca
aatctACGTTCAACAGAGACGGACCATTTCCATCCATGGATACAAAACCT
GCCCACATCCATATTCAACCTAATGCGAAGCCGCATGTTCGTCATNTCCA
CCAGAAGGAGAAGCACTTGCCGTTGCCTGGTCACTCGATCACGCCAAGAT
GTTCGTCCTCGGCTGCAACAACCTGA
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_045524XLOC_045524Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073370-proteinTCONS_00073370-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073370-exon-scaffold_90-1491911889:109966..110508TCONS_00073370-exon-scaffold_90-1491911889:109966..110508Clytia hemisphaericaexon
TCONS_00073370-exon-scaffold_90-1510915933:109966..110508TCONS_00073370-exon-scaffold_90-1510915933:109966..110508Clytia hemisphaericaexon
TCONS_00073370-exon-scaffold_90-1575043694:109966..110508TCONS_00073370-exon-scaffold_90-1575043694:109966..110508Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_90supercontigscaffold_90:109966..110508 .
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
1.04277 0.677385 2.49789 2.0757 4.65613 3.77533 2.65346 3.07922 1.41404 1.26554 2.12399 0.876316 0.565153 0.306757 0.360359 0.412393 0.398542 0.408652 0.131085 0.387644 0.451136 0.888649 0.121791 0 0.456178 0.222117 0.14565 0.196964 0.117897 0.120118
Blast
The following BLAST results are available for this feature:
BLAST of TCONS_00073370 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 0
Match NameE-valueIdentityDescription
back to top