Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00073365 (transcript) - C. hemisphaerica

Overview
NameTCONS_00073365
Unique NameTCONS_00073365
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1644

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00073365 ID=TCONS_00073365|Name=TCONS_00073365|organism=Clytia hemisphaerica|type=transcript|length=1644bp
TTGCAATCTACTTATAAATATTGTGAAAGTAAAAATCACTCTTCATTTCG
ATTTGTTTAATACATGAATATGTCTGCGAAGATAttaaaaagatgttcaa
attAGATTTGTGAGTGTTTCCAGTTTGAAAGTTGATCACTGACCTCACTG
TATTACTAAGTGTGGAATTATCAAACATGTCAGAGGACGATACCACGCAA
TCTTCTGGTGACTTACCAACAATTGAAGTGACCACTGAAGAATATGATAT
TATTGAAGTGTCAGAGCAAGTAGAACTTTCTGAACCAATTGTTATTGAAG
ATGATATAGAAGTTGACGTAGAGGTTATTGAACAAGTTGATTCAAAAGAT
TTTAGCCCTGTTACTGTTGTAATTGCACCTCCTGAGAATGAAATTGATGC
ATCTGACTCTCCTCAGGGAGAGAAAGATGCTCACGAAGCCGAGGAAGAGG
AAGATGttggagaaaaagaaaatgagaaagaagaagaggTTGAAATGCAA
GAGGAAGAAGCTGTAAAAGCGGAGCCTAatattgaagaagaagaagaaga
agaagaaactgaTAACGGGGAAAATGTAAATGATGAAACAACTGGAATCG
ACGATGTGGATATCGATGTGGAGGATGAAGATGATGATCATATCCAACCA
TCTGCACCATCCATCAGTCTATTGGTGGACCATTCAGTGGATACCATCGT
GGAAGATAAAGAAAGTGAAGATGAACAGGAAGAAGTTGCAAAAGAAGGAA
AAACCGAAGACATTGAAGATGGAGAAGACAGAAAAGAGATTACTGTTGCT
GAGGAAACTCCAAAAGAAGAAGAATCTGGCAAAGATTCTCATGAAGATTC
AAAACAACTTGAAGGCTCTGAAAATGTGTCAGATCTTGTTCCAGTCGGAA
TATCTAGTCCATGTCCTTGTGATGAGGACGACAAAAATGTCGAGGAAGTC
GAAGATTCTATAGATGGTGAATGCAGCTATGGCAAAATTCGTCTCTTATT
CTTCCGCGAACCAGAAGACGATATTATGAATGTGAAGGTCTTTCGTGTTG
ATCAAATGCCATCTACTACAGAAGGTGGTTCAAAAGATGTCAGCATCCAT
CTCTGCTTAAAACCAGCTTCCAAGCAACGATATAAAACAAAGATGAAATC
AACATCTAAAGCAAGATTTGACGATACGtatgaatttcgaaaaatcaacA
ATGAAGCAATTGAATCTTCAACATTGAGGATAAGAGCTTATGGTAAATGT
AAGAAGATCATTGGTGAAGCTCATATTCCTTTATCAATGGTCAAAGATTT
TCAATATCAAGAAGTTTGGTATTACTTCTCACCATTTGACAAAAAGAAAT
CCAAGACGAAGAAAAACAGTGAAGCTCCAGCAGTAGGAAAATGGTATTTT
GCAAAGAATGAATTACTTTAGTTATTACCCTATCTAAATCATACAAACAA
GACAACGATCCAACGATTTTGGGGAGGTGTAAAGATCCCACACTGATGGA
TCAGAGTACCTTCAATCATTCTCATACCATTTTGACTTTGGGTCAACCCT
GTCATATATTTTGATATATATTGAAGTAGTGCATTTATTCATCTATAAta
ataaaatactaaaaattcaTACCAGGAAAAGAATTGCCTTAAAA
Run BLAST on NCBI

protein sequence of TCONS_00073365-protein

>TCONS_00073365-protein ID=TCONS_00073365-protein|Name=TCONS_00073365-protein|organism=Clytia hemisphaerica|type=polypeptide|length=414bp
MSEDDTTQSSGDLPTIEVTTEEYDIIEVSEQVELSEPIVIEDDIEVDVEV
IEQVDSKDFSPVTVVIAPPENEIDASDSPQGEKDAHEAEEEEDVGEKENE
KEEEVEMQEEEAVKAEPNIEEEEEEEETDNGENVNDETTGIDDVDIDVED
EDDDHIQPSAPSISLLVDHSVDTIVEDKESEDEQEEVAKEGKTEDIEDGE
DRKEITVAEETPKEEESGKDSHEDSKQLEGSENVSDLVPVGISSPCPCDE
DDKNVEEVEDSIDGECSYGKIRLLFFREPEDDIMNVKVFRVDQMPSTTEG
GSKDVSIHLCLKPASKQRYKTKMKSTSKARFDDTYEFRKINNEAIESSTL
RIRAYGKCKKIIGEAHIPLSMVKDFQYQEVWYYFSPFDKKKSKTKKNSEA
PAVGKWYFAKNELL
Run BLAST on NCBI

transcript from alignment at scaffold_90:258587..261632-

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00073365 ID=TCONS_00073365|Name=TCONS_00073365|organism=Clytia hemisphaerica|type=transcript|length=3046bp|location=Sequence derived from alignment at scaffold_90:258587..261632- (Clytia hemisphaerica)
TTGCAATCTACTTATAAATATTGTGAAAGTAAAAATCACTCTTCATTTCG ATTTGTTTAATACATGAATATGTCTGCGAAGATATTAAAAAGATGTTCAA ATTAGATTTGTGAGTGTTTCCAGTTTGAAAGTTGATCACTGACCTCACTG TATTACTAAGTGTGGAATTATCAAACATGTCAGAGGACGATACCACGCAA TCTTCTGGTGACTTACCAACAATTGAAGTGACCACTGAAGAATATGATAT TATTGAAGTGTCAGAGCAAGTAGAACTTTCTGAACCAATTGTTATTGAAG ATGATATAGAAGTTGACGTAGAGGTTATTGAACAAGTTGATTCAAAAGAT TTTAGCCCTGTTACTGTTGTAATTGCACCTCCTGAGAATGAAATTGATGC ATCTGACTCTCCTCAGGGAGAGAAAGATGCTCACGAAGCCGAGGAAGAGG AAGATGTTGGAGAAAAAGAAAATGAGAAAGAAGAAGAGGTTGAAATGCAA GAGGAAGAAGCTGTAAAAGCGGAGCCTAATATTGAAGAAGAAGAAGAAGA AGAAGAAACTGATAACGGGGAAAATGTAAATGATGAAACAACTGGAATCG ACGATGTGGATATCGATGTGGAGGATGAAGATGATGATCATATCCAACCA TCTGCACCATCCATCAGTCTATTGGTGGACCATTCAGTGGATACCATCGT GGAAGATAAAGAAAGTGAAGATGAACAGGAAGAAGTTGCAAAAGAAGGAA AAACCGAAGACATTGAAGATGGAGAAGACAGAAAAGAGATTACTGTTGCT GAGGAAACTCCAAAAGAAGAAGAATCTGGCAAAGATTCTCATGAAGATTC AAAACAACTTGAAGGCTCTGAAAATGTGTCAGATCTTGTTCCAGTCGGAA TATCTAGTCCATGTCCTTGTGATGAGGACGACAAAAATGTCGAGGAAGTC GAAGATTCTATAGATGGTGAATGCAGCTATGGCAAAATTCGTCTCTTATT CTTCCGCGAACCAGAAGACGATATTATGAATGTGAAGGTCTTTCGTGTTG ATCAAATGCCATCTACTACAGAAGGTGGTTCAAAAGATGTCAGCATCCAT CTCTGCTTAAAACCAGCTTCCAAGCAACGATATAAAACAAAGATGAAATC AACATCTAAAGCAAGATTTGACGATACGTATGAATTTCGAAAAATCAACA ATGAAGCAATTGAATCTTCAACATTGAGGATAAGAGCTTATGGTAAATGT AAGAAGATCATTGGTGAAGCTCATATTCCTTTATCAATGGTCAAAGATTT TCAATATCAAGAAGTTTGGTATTACTTCTCACCATTTGACAAAAAGGTAT GTTTGATTTTAACACGTACATCTCTCTCTCTTTCTCTTTCTTTTTCGATG GCCAAAATACTAAAAACAAGTTAAAACACCCAGTTTCTTAGGGAATTGCA ACTCAAAATCTCAAAAAGCTACAAACATCCGAAGGCCTAAAAAATCTTGG ATGTTCTTATAATAAAGGGCTAGATTAGGGCCCCTATCCAATTATTAGCG AATGTGAAAATTAGTGAAATGAAAGCTGTCTAAACCCACTACATGATTTG TGGCCTGTGGTTTTGTAAAGGTCTGTGATTTCCACTATGTATAGTAGAGA TGGTCACGCGGTAATTGTAATCCTCCTATCATTATATAATTTTGCAATAG TGGATTGATGATAGTNTGAAGATTCAAAACAACTTGAAGGCTCTGAAAAT GTGTCAGATCTTGTTCCAGACGGAATATCTAGTCCATGTCCTTGTGATGA GGACGACAAAAATGTCGAGGAAGTCGAAGATTCTATAGATGGTGAATGCA GCTATGGCAAAATTCGTCTCTTATTCTTCCGCGAACCAGAAGACGATATT ATGAATGTGAAGGTCTTTCGTGTTGATCAAATGCCATCTACTACAGAAGG TGGTTCAAAAGATGTCAGCATCCATCTCTGCTTAAAACCAGCTTCCAAGC AACGATATAAAACAAAGATGAAATCAACATCTAAAGCAAGATTTGACGAT ACGTATGAATTTCGAAAAATCAACAATGAAGCAATTGAATCTTCAACATT GAGGATAAGAGCTTATGGTAAATGTAAGAAGATCATTGGTGAAGCTCATA TTCCTTTATCAATGGTCAAAGATTTTCAATATCAAGAAGTTTGGTATTAC TTCTCACCATTTGACAAAAAGGTATGTTTGATTTTAACACGTACATCTCT CTCTCTTTCTCTTTCTTTTTCGATGGCCAAAATACTAAAAACAAGTTAAA ACACCCAGTTTCTTAGGGAATTGCAACTCAAAATCTCAAAAAGCTACAAA CATCCGAAGGCCTAAAAAATCTTGGATGTTCTTATAATAAAGGGCTAGAT TAGGGCCCCTATCCAATTATTAGCGAATGTGAAAATTAGTGAAATGAAAG CTGTCTAAACCCACTACATGATTTGTGGCCTGTGGTTTTGTAAAGGTCTG TGATTTCCACTATGTATAGTAGAGATGGTCACGCGGTAATTGTAATCCTC CTATCATTATATAATTTTGCAATAGTGGATTGATGATAGTATACTTGTAC GGTTTTCCAACTGTCTGAGACCCATATACAAAGTCATTATTTATGGTTAA AACTGGATAATCTAGGAGTTAGGGCCTACTTTTCTTTGACATTGTTGAGG CTTTCATCTATATATTTACTAATCCACCAAAATATTTTCTCGTTTTAGAA ATCCAAGACGAAGAAAAACAGTGAAGCTCCAGCAGTAGGAAAATGGTATT TTGCAAAGAATGAATTACTTTAGTTATTACCCTATCTAAATCATACAAAC AAGACAACGATCCAACGATTTTGGGGAGGTGTAAAGATCCCACACTGATG GATCAGAGTACCTTCAATCATTCTCATACCATTTTGACTTTGGGTCAACC CTGTCATATATTTTGATATATATTGAAGTAGTGCATTTATTCATCTATAA TAATAAAATACTAAAAATTCATACCAGGAAAAGAATTGCCTTAAAA

Coding sequence (CDS) from alignment at scaffold_90:258587..261632-

>TCONS_00073365 ID=TCONS_00073365|Name=TCONS_00073365|organism=Clytia hemisphaerica|type=CDS|length=2490bp|location=Sequence derived from alignment at scaffold_90:258587..261632- (Clytia hemisphaerica)
AAATCCAAGACGAAGAAAAACAGTGAAGCTCCAGCAGTAGGAAAATGGTA
TTTTGCAAAGAATGAATTACTTTAGATGTCAGAGGACGATACCACGCAAT
CTTCTGGTGACTTACCAACAATTGAAGTGACCACTGAAGAATATGATATT
ATTGAAGTGTCAGAGCAAGTAGAACTTTCTGAACCAATTGTTATTGAAGA
TGATATAGAAGTTGACGTAGAGGTTATTGAACAAGTTGATTCAAAAGATT
TTAGCCCTGTTACTGTTGTAATTGCACCTCCTGAGAATGAAATTGATGCA
TCTGACTCTCCTCAGGGAGAGAAAGATGCTCACGAAGCCGAGGAAGAGGA
AGATGTTGGAGAAAAAGAAAATGAGAAAGAAGAAGAGGTTGAAATGCAAG
AGGAAGAAGCTGTAAAAGCGGAGCCTAATATTGAAGAAGAAGAAGAAGAA
GAAGAAACTGATAACGGGGAAAATGTAAATGATGAAACAACTGGAATCGA
CGATGTGGATATCGATGTGGAGGATGAAGATGATGATCATATCCAACCAT
CTGCACCATCCATCAGTCTATTGGTGGACCATTCAGTGGATACCATCGTG
GAAGATAAAGAAAGTGAAGATGAACAGGAAGAAGTTGCAAAAGAAGGAAA
AACCGAAGACATTGAAGATGGAGAAGACAGAAAAGAGATTACTGTTGCTG
AGGAAACTCCAAAAGAAGAAGAATCTGGCAAAGATTCTCATGAAGATTCA
AAACAACTTGAAGGCTCTGAAAATGTGTCAGATCTTGTTCCAGTCGGAAT
ATCTAGTCCATGTCCTTGTGATGAGGACGACAAAAATGTCGAGGAAGTCG
AAGATTCTATAGATGGTGAATGCAGCTATGGCAAAATTCGTCTCTTATTC
TTCCGCGAACCAGAAGACGATATTATGAATGTGAAGGTCTTTCGTGTTGA
TCAAATGCCATCTACTACAGAAGGTGGTTCAAAAGATGTCAGCATCCATC
TCTGCTTAAAACCAGCTTCCAAGCAACGATATAAAACAAAGATGAAATCA
ACATCTAAAGCAAGATTTGACGATACGTATGAATTTCGAAAAATCAACAA
TGAAGCAATTGAATCTTCAACATTGAGGATAAGAGCTTATGGTAAATGTA
AGAAGATCATTGGTGAAGCTCATATTCCTTTATCAATGGTCAAAGATTTT
CAATATCAAGAAGTTTGGTATTACTTCTCACCATTTGACAAAAAGAAATC
CAAGACGAAGAAAAACAGTGAAGCTCCAGCAGTAGGAAAATGGTATTTTG
CAAAGAATGAATTACTTTAGATGTCAGAGGACGATACCACGCAATCTTCT
GGTGACTTACCAACAATTGAAGTGACCACTGAAGAATATGATATTATTGA
AGTGTCAGAGCAAGTAGAACTTTCTGAACCAATTGTTATTGAAGATGATA
TAGAAGTTGACGTAGAGGTTATTGAACAAGTTGATTCAAAAGATTTTAGC
CCTGTTACTGTTGTAATTGCACCTCCTGAGAATGAAATTGATGCATCTGA
CTCTCCTCAGGGAGAGAAAGATGCTCACGAAGCCGAGGAAGAGGAAGATG
TTGGAGAAAAAGAAAATGAGAAAGAAGAAGAGGTTGAAATGCAAGAGGAA
GAAGCTGTAAAAGCGGAGCCTAATATTGAAGAAGAAGAAGAAGAAGAAGA
AACTGATAACGGGGAAAATGTAAATGATGAAACAACTGGAATCGACGATG
TGGATATCGATGTGGAGGATGAAGATGATGATCATATCCAACCATCTGCA
CCATCCATCAGTCTATTGGTGGACCATTCAGTGGATACCATCGTGGAAGA
TAAAGAAAGTGAAGATGAACAGGAAGAAGTTGCAAAAGAAGGAAAAACCG
AAGACATTGAAGATGGAGAAGACAGAAAAGAGATTACTGTTGCTGAGGAA
ACTCCAAAAGAAGAAGAATCTGGCAAAGATTCTCATGAAGATTCAAAACA
ACTTGAAGGCTCTGAAAATGTGTCAGATCTTGTTCCAGTCGGAATATCTA
GTCCATGTCCTTGTGATGAGGACGACAAAAATGTCGAGGAAGTCGAAGAT
TCTATAGATGGTGAATGCAGCTATGGCAAAATTCGTCTCTTATTCTTCCG
CGAACCAGAAGACGATATTATGAATGTGAAGGTCTTTCGTGTTGATCAAA
TGCCATCTACTACAGAAGGTGGTTCAAAAGATGTCAGCATCCATCTCTGC
TTAAAACCAGCTTCCAAGCAACGATATAAAACAAAGATGAAATCAACATC
TAAAGCAAGATTTGACGATACGTATGAATTTCGAAAAATCAACAATGAAG
CAATTGAATCTTCAACATTGAGGATAAGAGCTTATGGTAAATGTAAGAAG
ATCATTGGTGAAGCTCATATTCCTTTATCAATGGTCAAAGATTTTCAATA
TCAAGAAGTTTGGTATTACTTCTCACCATTTGACAAAAAG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_045519XLOC_045519Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073365-proteinTCONS_00073365-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073365-exon-scaffold_90-1575043694:260287..261632TCONS_00073365-exon-scaffold_90-1575043694:260287..261632Clytia hemisphaericaexon
TCONS_00073365-exon-scaffold_90-1575043694:258587..258884TCONS_00073365-exon-scaffold_90-1575043694:258587..258884Clytia hemisphaericaexon
TCONS_00073365-exon-scaffold_90-1510915933:260287..261632TCONS_00073365-exon-scaffold_90-1510915933:260287..261632Clytia hemisphaericaexon
TCONS_00073365-exon-scaffold_90-1510915933:258587..258884TCONS_00073365-exon-scaffold_90-1510915933:258587..258884Clytia hemisphaericaexon
TCONS_00073365-exon-scaffold_90-1491911889:260287..261632TCONS_00073365-exon-scaffold_90-1491911889:260287..261632Clytia hemisphaericaexon
TCONS_00073365-exon-scaffold_90-1491911889:258587..258884TCONS_00073365-exon-scaffold_90-1491911889:258587..258884Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_90supercontigscaffold_90:258587..261632 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0.0123616 0.0602725 0 0 2.55055 1.83106 0.0476783 0.148786 0.19792 0.193545 0.200383 0.115258 9.06809 7.50482 0.975685 0.677952 0.46399 0.646781 17.7661 42.971 1.66131 1.08433 1.31814 1.52053 2.21644 4.24052 0.135601 0.162807 0.0137204 0
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR000008C2_dom
Blast
The following BLAST results are available for this feature:
BLAST of TCONS_00073365 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 0
Match NameE-valueIdentityDescription
back to top