Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00073361 (transcript) - C. hemisphaerica

Overview
NameTCONS_00073361
Unique NameTCONS_00073361
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1537

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00073361 ID=TCONS_00073361|Name=TCONS_00073361|organism=Clytia hemisphaerica|type=transcript|length=1537bp
GAACCCTCACAACAAAGATGGCTGCCGGAAACTCAAGCGCGACCGATGGA
GCAAAGTACCATTGCAATTATTGCCACGCAGATTGTTCTGGATTGAGGGT
GTCGTGTGCTGAGTGTCCAGACTTCGATGCTTGTATTCAATGTTTCGCAT
CGGGTGCAGAGATGGGCAATCACAAACGAGGTCATGATTACCACCTCATT
GATAACGGTACATTTTATTTGATCGTCAAAGGATGGACAGCTGATGAAGA
AATGTTATTATTAGATGCCATTGAACAACACGGCCTTGGAAACTGGGACG
ACATATCCGATCATGTTGGAACCAAATCACCGCAAGAAGCACAAGACCAC
TTTGAAGAAGtttatttgaagaaaaacattGGAAAAGTCACATTACCGAA
ATCAGTATCACATATTCCTGATCATGCTTCAGTTGAAGGTCAGTTATCAC
CAACGCTTTTGAAGCCAATGGAATCACTTGATTTACCGGTTGCCGAGCAA
CAAGAACTTGGCTATATGATGTTCCGTGATGATTTTGAACGGGAGTATGA
CAATGATGCAGAAAACTTGATCAAAACGCTCGTTTGTAGTCGTGATGACG
ATGAACTAGAAACAGCTTTGAAGTTACAATTAGCTGACATGTATTGGAGG
GTACTTCATGAACGTTCCAGATGGAAAAAGATTGCTCGTGATTATGGGTT
GATTACAAGTAAACATCGGTTAATAGCTTCAAGGAGGAAACTGAGCAAAG
AAGACAGGGAATTCAAAGATAAGATCAGACCATTTGCGCAATTCGTTCAA
CCTCAGCAATGGGAAGAATTGGTTAATAATAGAATCAGagaaagagaatt
aaaagcACGAATAAAAGAATTGACAAAGTATCGGAGATACGGCATCAAAA
AGTTAACTGGTTGTCAAGAATATGAAGATTTGAAAACACAACGGGAacgg
aaaaaagaaaacagaaagcGAATGCAAGTTATATCACCTCCTCGTACAAC
GAAAACATCTGGTAAAAAAGAGTTTTCATCGGACGATTCGAGAAAGAAAG
ATGATATAGACACAACGAAAGAATTTGAAGAATTCAAAGAGAAAATGTCG
TCCGATACTTCTTTCCAATTACTGTCCgataaagaaaaacatCTTTGCGC
GACCGTCCAATTACGTTGTTCGCGATACATGACTTTGAAATCTTACCTGC
TCAACGAATACGCCTCTTCTCGTATGAAAATACCTCACAAGACGAAACCG
CCACACTATTTAACGCCCTCGTTAAGGCTCGCCCTACAAGAGTTCTTCAT
ACAATGTGGTTGGATAAGTGAATAAAGATAATCTTCGATATAAATTGTGT
AGTGCTTTCTTTTCTTAAATCACTCGATTTTTTTATTCATGAAAATtcat
atatttatatttttgtttaataatttgtaaatttttttatccaTATTATA
GCCAAATACCTTATAACACTAAATCATTTGTTCGATATTCCATTTGTGTA
CAGGAGACTCCCGGTTATATTCGAAGGTACCTTTCTC
Run BLAST on NCBI

transcript from alignment at scaffold_90:196096..241827-

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00073361 ID=TCONS_00073361|Name=TCONS_00073361|organism=Clytia hemisphaerica|type=transcript|length=45732bp|location=Sequence derived from alignment at scaffold_90:196096..241827- (Clytia hemisphaerica)
GAACCCTCACAACAAAGATGGCTGCCGGAAACTCAAGCGCGACCGATGGT GAGTATTTTTATTTACAGTTTTAATCATTTATTATATGCAAAAATGGGTT TGGTTACCTACCTACCTACCACNCAGTTTTAATCATTTATTATATGGATT AATCATTTATTATATGGAAAAATGGGTTTGGTTACCTACCGGGACAAGTT GAAAGTACTAGATATGGTCATGCGACCGTAGACCTGCAATCATGATCGAA ATATATTGAGAATTTGTATTTTAACTCCAGTTGAGTTTAGCTAAAAAAGG GAGTCCAAATTTTCAAACAAAATAAAAAATAAAACTAGGCTCATCTGATA GCCCTAAGCACAAGAAGAAATAGCCTACAAAGATTATGTCATACTCATGC AGTCTGCTTGCATGAGGTTAAAAATCTGTCAACCAGCATTTTTAGGGGTC ACTCACATATCGATTCTTCCCACGACTAACGTCAAATTGACGCGATATGA AGGGGTGGGTGGGTTTGAGTCTTTGACGCTAAGAAATTTTATCAGAAAGT TTAGAAATTATCTCCATTATTTTTTAAATGTAAACTGCCTGAGCAAGCCG TAGCGAAATTAAAGATGGCTGACGAAACAACGATGAAAGTGAAGGAGAAA ATTTTCATCGATTTTTGATAATTTTTCAACTTTGACGTTAAGAGGTGGGG GTGGGGGGTTTTCAAATTAGCGTCAATTTGACGTTAGTCGTGGGAAGAAT CGATATGTGAGTGACCCCTTAGAAGAATTGCAATCACATATAGCTGTCAA CAACAAAGAAAACAAATCAAAGGCCAGGCCCACAGGGCTCGAAATAACGG TCGGACATCGGACATTGTCCGACCCAATTGCTGAAATGTCCGACCCAAAT CGATTCTAGTCGGACATCATGTCCGACCCNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN TCAGAAGCTTGTATTATACTTGAAATATACCCCACATAAAAATCAATCGG ACATGTCCGACCCATTTTACTTTAAAAGCCTTAGGACATGTCCGACCCAG ATCAATTTTTGATCGGACAATGTGTCCGACCACCTAAATATCGTTATTTC GAGCCCTGGGCCCAATTGATTGTTTTGTCCTAGAAGCTTTGAAAAATGGG TCGGTCGGTTGGTAGCTAAAATTGGAACCTTTTTTTCCTTTTCCCACCAA AAACCCCAATTTTTGAAATTCCTCAAGCAATCGCACATACCTGGAATACA TTTCGCTAAATGCTCAGAGCGCGACGGCCCATTTTCCCTTTCCTATCTTT CACCTTACCTGTTTATTCTACTTTCTGAGACCTAGTATCTCATTTCTGAC TGAGTTTTCATACCTGTCAATCATTTGTCCATCAATTTCGTCCAGTCTAA TTTTCGCACCGAGTGGGATTCGAACCACCACCAAAGAAATACCTTCAGAT TCGGAAACCAGCGCTCTATCTGTTGAGCCATCGCTGCACAGCAAAATTAC GCAATTCATAACATATTATACCGCTATACCGAACTGGCAAAAGACTGGGG TAATGTTATTATAATATGGGTAAAAGTACCCCTTTTTTAAACCTGACTGA AATTTGAGCCGTTACTAGCAACCCTGCGGGGCCCAAGGCGCCAAGTATGC ACCCGGCACAGTCATGGCTGGAACCCCCCTGGCCCCCCTCAGGCTAAAAG GTCGAGCAGCAATTGGTACCTGATTTTAGCCTATGGCTAGGGGGGACTAA CCATGTTAAGGGTCACCTAAATTTTTTCAGATGGACCTGGGGGCAAGATT CTATGTTTGGTGATTGAATTATAAGCAGCCTACCAGACCAGGTTGACACT TACTCATCTTATATTTTAATCTAAGCAATATGCTCAAAAACTGACAATTT GGTATCTAATATATTATCTGCAGTGCCGTAGCAACTGGGGGGGGGGCAAG GGGGGCTATGCCCCCAATAATTTTTTCANNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTTTCTTTT TTAATTTGTCATAATTGTCTTATAAGTGCATGTTTTGAGTGCATTTTCAA GCAATCTAGAGCTCAAATTTTCAAAATTTTCTCCCTCGGGCCAAACCGTG GTTGGCCCTTGCGGTGTTACTTAACTTCCGCCCCCTAATATGAAAATGCT TCCTACAGTACAGCACTGATCTGTAAAAATTCTTTAATCCTGTTGCATTT GCTTACATAAAAAATTGGTCTGGCAAGGGATCTGCACCCTGACTTACAAA ACCTTGATAATCTGGCACAAACTTTCAGTACTTAGCTTATCTCTTATTTT TTAGGGCATTTATTCTATTTAGCAATAAGCTAAACCAACGATGTAAAAAT AATAGATAACCAACTTGCCTTGATTCTCAAAAAACATCCGTGTTACGGTT GTAAAAATATTAATGACATTTTAGATTATAAAAAGTGCAATTAAATAAAA ACTTGCTTCATTTGCAACCTTCTATTGGACAGAATCGATCACGTGATGTA TATTTTTCCAAAATTTGGGTTAGAAAAAGTNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNATTCGTGAGATATCGCACTTCAAATCACACATATATT TTTCAGATAACAGCATTTTATGAGCGTTTATTTATCCAGACGAAGATTAA GTGGTATCAGGCCGATCCTTAGTCAATTTGTCTAAAGATTGTTTGAAAAC AATTCCAAAATTTGCAGTAAATAACAATTCAAATTTTCTATCAATTCAGT GGATGTCAAAAAGTGTGTCAAAATCTAGCTAAAAGCATAACACGCANNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNTTTGGAACTTTGAATTTGTCTAATGAAAATAT TTAACAATGGATGATGATAAACCAGGAAAGGTAAATAAAATTAAATTCTA CTATTCCTATGATGGCCCGAGCAAATCCGTATCAATTGTAAATACATGGC CCGAACATGGTCCAAACAAAAATGTTCAGGCCGATTCAATAATACTTTTT TGTGGCCCGAGCATGGCCCGAACATGTTCGGGCCATGCCGTGATTCGTTA AAATAGCCTAAAGCCCGGATCCATAAAGGCATGCGTCGCGATCGCAAGAT AATTCTAGTTCGAGATTAGGGCGTTCACGGCGTTGCTTAAAGGAATACAG CTGTGACTCTCTGCTTTTAGGTGCCTCATATTTGTTTTTAAATATGGGTT ACACCGGGACATTTTCTGTGTGCGAAGTGAATGTTGTTTATAGAAAAATC AAAGCACTCAGTTAAAAAAGAATCACAGAGAAAGTTGTTATCATGTAAAA GGAGGTAAAATTGTTTTGATTTCGTGATTTTTCTGACTCAAAGTGAAACA CTTTTTCTCAAAAATTTAGAGTCGATCGGAGGACACGAACCAAACTATCA ATTGGGCCTGGCCAAACTTCGCCTCACAAAAATGTGGGAGAGCTCCAAGT GGGAAAAATTTCCCCCGTTAATCCATTTTTTCCAAATCTCGTTGGATGCA GTATTTGCATCACAAAAATTGTCATTAAAAATGAAAAAATACGCCCTCAA AAAAATCGCGAAACTATTTCTTTAGAAATCTTTGAGAATTTTAATGTTAT AAAGTCTTGATTATTTTGAATGACTTTACAATGACAATAACTTAATATTA TGAGAATGATTTAATCCAAGACTATGCTAGTAAAGCGAGCAAGAAAACTT TACAGATTTAGTTATCGAGGTCTTATATATATTTTTAGAGTTTCCTTGTG TTTCAGATAATTATTTGCTTTTCACGTTCACGCTAAAAATCTCGATTCAC GAATTCAGGTGGAAAAATCTTATTTTCACGTTCACGCTGATATCTCAATT CACGTATTCACGTGCTAAAAAAGTCAAATTCACGCATTCACGTCAGAAAA AAGGCTCATTCACGTGTCACGCCAGCCCCTGGAGCCTTTGTTACTTTCTT CTTGTTTCTAAGATCACTTTTATCAACCCGCTTTCTTTGTAACTTTTAAG GGTGTTTCGGTGTTTCTAAAATTGCTTTTGTCATCTTGCTTTCTTCGTAA CCTTCTTTATTTCTAAGATCACTTTTATTAATTAAATTTATCAATTCGCT TACTGCATAACTTTCAAGGGTGTCTCTTAGTTAACTTTTATTAATTCACT TTCTTCGTAACTTTCAAGAGTGTTTCTAACATCACTTTTATCAACTCGCT TTCTTCGTACCTTTCAAGAGTGTTTCTAAGATCACTTTTATCAACTCGCT TTCTTCGTAACTTTCAATAGTGTTTCTAAGATCACTTTTATCGACTCGCT TTCTACGTAACTTTCAAGAGTGTTTTTAAGATCACTTTTATCGGCTTGCT TACTTCATAACTTTCAAGGGTGTTTCAAAGTTTACTTTTATCGACTCGCT TTCTTCATAACTTTCAAGAGTGTTTCTAAGATCCCGTTTATCGAATTGCT TACTTCATAACTTTCAAGAGTGTTTCAAAGTTAACTTTTGTCAACTTCCT TTCTTCGTAATGTTCAAAAGTGTTTCTGAGATCACTTTTATCGGATTGCT TACTTCATAACTTACTGAACAAGCAGAAAAAAGATTTTTAGAATAAATTT GTACACGTGCGATTGATCACACGCCTGGCTAGATTTTCATGATTTATGGC GTGTGATAAATTCCACACCTAAAAGGCTTTTAGGCGTGTGCGGAGGCGTG CGCGTGCGTTCGCACGCCTCGTATGCCGAAGCCTACTAGACAATCCTCAA GGGACAAACACATAAATATACAAACAATACGGCACTATACAATACAATAC ACAACTCCCTAGACACATAATATAGACAATACACGTGGAACTAATACAAA TCATATAGTAATCATTTACAGTTTCACTACAAAAGTCCTATCAAATAATA AATCTAAGTACAAAGGAAATAATAAAAATAAACGTAAAACTAAAAGACAA CTGCATTTTGGCAGTTACACTAAAACTTTGTATGTTTATCAGAAAAAGGG TGAGGAATTCAAAAATCACATTCACTAATTCTAGTTCTTTCATTTTCATG TAGCTTTTTTCACTTTTTTGCTTCTTTAGCATGGGAATGTCCCAAAAAAA GTTTTTATTTATTTCTGTCGAATTGGATTTTCTTTTCATTTGGGGTTTCT CCTTTCAGAAAAACTTATTCTTTACTTATAACTTTTGTTCCTTCATTTCC AGAGGCTCCTTGAAAATGGGTCCTACCACTTTTTTTGACTCATTTCAACC TTTTCCAAGCTGTTCCAAGCTAAAAAAGCTACAAAAGCTACAAAAATAAA ACAATGCAATGCAGGGCTCGAAATAACAATATTTAGGTGGTCGCACTACT AGGTCTTAAAACATCAATTGTGGACACGGTTGATGTTTTTTATCTACAGT CAATCATTTTTATGGACAGTCAATATCCAAACATCGACTGTCAATATCCA AACATCGACTGTCAATACTTTTCATCAACTGTTGAGATTATTTAATTGAC TGCTGATGTCTGGATATTGACTGTTGATATCTGGATATTGACAGTTGATG AAAAGTATTGACAGTCGATGTTTGGATATTGACTGTCCATAAAGAATGAT TGACTGTCCATAAAAATGATTGACTGTGGATAAAAAACATCAACCGTGTC CACAATTGATGTTTTCAGGCCTGGTAGTGTCGGACACATTGTCCGATCAA AAATTGATTTGGGTCGGACATGTCCTAAGGCTTTTAAAGTAAAATGGGTC GGACATGTCCGATTGATTTTTATGTATGNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNT CTATTAACAATTATGAGTAATCTTTACTTGAATGAAAATACACCTGACAG ACTGCACTTACTTCCAAATCTATATACTTCAAGTCTAATACAAGCTTCTT ATAGAATTTCACATAGATCACGAAGAATCTAAACAAATGCCAATTAATGG TCAGAAGCCTTTGATTTTTACTTGAAGCATGCTTTCATTTGTTGAGAAAA AGCATCACACAAAATGAATATCTAACACTAATGATCGCAACTTTGAGAGT GTGTGTAAATAAAGAAGTTACTAATTCTATGTAAATTATAATTTCTTTTG GAAATTTCACAACGCATCTGACAAATTTTCGAAGGCACCGGAAGTAATTG GGTCGGACATGATGTCCGACTAGAATCGATTTGGGTTGGACATTTAAGCC ATTGGGTCGGACAATGTCCGATGTCCGACCGTTATTTCGAGCCCTGGCAA TGTCTTCTTTTTTCAACTAAATTACAAATATTTTTATATGATTATATTCT AACACCATCAAAGAATTCTCCCTCCAAATTTCAGGTCTCTAGCTACACTA AAAAAAGAGATATGCAAAATTAAAGAAGCATGACTGGAAAATTTTTTTTT TCTTTTTAGACACATTTTTCGAATTATTACAAGCTATTTTCCTAACCCTT TTTTTGACACTTTTAGTCAAATTTTCGACACTAAAATTTGAATATCTTTA CAACCACTTATCAACTGGAGGCCTATGACTCCTCATTTTCTTTCCTTTTC AAAGCTCTACAAGATAGAATAGGTTTTGAATTAGAAATTTCAAGGTTTTG AAATAGAATTTGGAAAATCTTCTGGAGTTGCTACACCAGTATCAAAAGAA AGCTTATTCTTTTGTATGTCTTCTCCAAAAAAAATTGGCACGAAAAAACA ATCACTTCAAGCGCGACGACCGTTTGAAGGCAAACTGTTGGAACTTCATT CTTTTTTTATTGTATTCTCTATTGTATTCTCTGATAAATTTTCTACAGAT TGAAAAAAAGAATGAACCAGTTTGAGTGGATTATGGTAAAGATATGAAGA AAGGAAAATAAGAAATATATTTTTTTATTTTCATGCACGCAAAAGATCGT GACTTCTGAGGTCAGTCGAAATTTCAGACTCATTTGCAAAATGTCAAACC AAGTTTAATGACAGCCCTTATCCTCAGAAAAAAATGAGGGGTCACTTATC TTTCAACTTTTAGTAGTTTTTCAGATATTCCATTCTGAAGTTCCTTTTTT TTTTTATTTCTATACAAAAACCTCCCGCCATCTTGTAACATCCCCACAGC ACCAAAATTCAAGAGTGTTTTTTCGTAGCCATAGACGGGGTACAATACCA TTAACTTTCCCTTAGCGGAAAGAAAGAACATTTATATCTTTTTGAAATAT TAAAGTTGGTTTTAAAAAAATTGTAAATTTAGAGGAAAAAGGTTGCTCTA GTCAGGCAACATGGTACGCTTCGAAAGCTAAAATATCACGGGGGAAAATG CAAAAAAATCAGGCCAATATCTGTATCTGGTGCCAAACACTTTTGATTTT AGTGTCCCCTGGTAAAAACTTTCCCATGCTGTGAACAAGAAGTTTGAAAA AGCGCACCCGCGAGTACTCATTTTCAAATTTTGAAAGAACGAAAAGACAT ATCTTGATAATTTCTTTTGCAAAAGAACGCTGAATTGAAGTTGGAAAAAA CACTTATGCTAAAAAAAGTTTCCTTACTGGAGTTATGTAAGTTGGAAGAT TTTTTCAAAAATTCTGTTTTTGTTACTGCCGCAGGCACAAGCTTAAACTT CCTTATCTAAGACCTATTGCCCGATTTTCACACCTCTTCCCATTGTTACT TTATTCTCGCATATAGCTCAAAAGAAGCATTTAAACGAGATGGTTACGGA AAGTGCTGGGTCAAAATTTAGATTAAGCTAATTTCAAGATATTGAAAAAA CACGTCATAGGTAAGATTCAAGTTGGACGTATTGAAAAGCGGTGATAACT TCAAATATATTTAATGCAATCAACACCAAATTTTGACTGGAGGCATTGAT TATTAATTCTGAAATATTTCATGAAAACATTTTTGAATTTTTTAATGACA TCATCCAATGGTTGGCGTATTTAAATTATTAGATATTACCGACAATAAAA TGGTGTCAACCAAAATTTAAGAAAATACCATTTTTGACACAATACATTGA CAGACAANGCAATAAAATGGTGTCATCCAAAATTTAAGAAAATACCATTT TTGACACAATACATTGACAGACAATCCCTGTGAGAAATTTATATCAAAAT CTGCAACAAAAACAAAAGTGGTCTATCTCTTCTAGTTATTGCTTCCGGGT GCTCCTTCATGGACTGTTTATGAAATTTCCAACAACGAGATTCCTCATTT CATACGGCCCTTCTTTTTTTGGCAACCGTGGTCATTCAGTGCTTTGCATG ACTGGCAGCTGTAAAATGTCACTTTATAAAATGCCTCTTTAATATGTTTA AAGTCTGTGATCCTTTAGAGGTAGGCTTTTTCTCATCTTCAATTCTCTAA GTAGCAGTGGGCTATAGAGACCTTTTTTTTCAAAATTAAGTTTGCATAAT TTTATTTGGTAGGTTGGGACCCAAATAACATAAATCTAAGATATTTTTGG ATATTTCCAAAAAATGGCGGTTCTCCGCCCTTTTTTATGCCCAAAAATGC AAAATGGGCCATTTTCGGGCCATTTTGCTTGGAAAAAAAATCTAAAACCT GCTGTGTTGGTGCTACAACCATCAAATTAGGCTCAAAATGATCCTTGGAA AANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNTATATCCGCCATTATGGAATTGAAATATGTGTTAA AACTGGCTAAAATACAACGTTTCAAGCAAAAGCCCCGTTTTTGAATAAAA ATTGCTCTAAAATGGCAATAGACATGGACCAAATTTTTTTGAAGTGATAG TATTCTGTGAATATTCCTGGAAAAACAAAATCATTTCAGTCTGAGATTTG TTTACATCCACCCTTATGGAAATGAAATCTCTGTTAAAATGCTACATATT TCCATCTGATACATCATAATTGACTAAATATTTTGTATATTATATTAAGC GAGGAATGTGAATTTAAAATCCTTTAATTTAGAAATACTAGTTGAAATAT ATTATTTAAAAAATCCCATTTCACTCAACAATTCTTTATAGCCCACTTAC ATTTCAATTTTCAAGACTTGTTTCGTCAAAAAAGATTGAATTTTAGCTTG AAATATTATATGCATTTTAAAACTGGCTTCAGTTTACAAATTGCGGTCCC AGAAGCATGTTATACCTGAATAGTTTTTACCCCTAGAGTATTACAGAACA CTATCACTGCAAAAAGATTTTAGGTTCATGTCTATTGCCATATTAGAGCA GTTTTTAAGTCAATATGGGATTTTTGCTTGAAATGTTGCAATNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCTTGGGAAAAAGTA GGAATCGAATGTAGCAATTACATACCTCTACCACATATATAAAATTCAAA AATTAGCTATTTAGGCCGAAATGGACCGAAACCAGGAAGCGACACTTGTT TTTGCCTGGAAATAAAACCTAAAATCTGGCGCTGTTCGTGCTACAAACCT CAAATTAGGCTTAAAATGTTCCTTGGAAAAAAGCAGGATAAGAATGTAGC AATTATGTACCTCTAACCATGTATATATATAAAATTTAAAAAATTAGGTT TTCAGGTCAAAATGGACGGAAACCGGGAACCGTCAATTTTGGCCGAAAAA CCTAATTTTTTAAGTTGAGGTATATAATTGTTACATTCTAATCCTACTTT TTTCCAAGGATCGGTTTGAGCCTAATTTGATGGTTGTAGCACCAACACAG CAGGTTTTAGATTTTTTTTCCAAGGAAAATAGCACGAAAATGGCCCATTT TGGGCATAAAAAAGGGCGGAGAACTGCAATTTTTTGGAAATATTCAAAAA TATCTTAGATTTATGTTATTTGAGTCCCAACCTACCAAAAAAAATTATGC AAACTGAATTTTGAAAAAAAATGTCTCTATAGCCCACTGCTACCTAAGCT GAAGAAATTGGGAATTTGATGCAGAAGTTAGATTGTCAGTGCTGCAAAAA ATCCTCTAATTGAAGAAGAATTTACAGTCATATATATTTTCATTTTTGAA GATTAGGTGCTAAAAAGTGAAACATGGAATAGTTTCATTTTTTATTGTTT TGTTTTTTTGTGCAAACTCTCCCTTCTTAGATGAGAAGGATGTCAACATT ATTAGACGAACTTAGGTATACAGGGCTGCAAATAAATATGTTTGGCCACT CGGACATTATGTCTGACTAAAATCAAATCCAGTCGGTCAGACTCAAAATC CTCTCAGTCATTCAGTCGTCATAATTTTTCAATTAGCAGGATATATTTTC TAACCTCAATAAGAGGACAGTTTTTGAAAGTTAGATAGAAAGCTAATATG TAGATAAGAGTGACCTTGGAACAACTCGTACATATACAGTAATTAGAGAA AGTGGTAAGTTGATAAAAGTGAAATTAGAAACACTCTTAAAAACTACAAA GAAGGCGATTTGATAAAAGTGATCTTTGAAAAACTTTTAAAAGTTACAAA GAAAGTGATTTGATAAAATGATCTTTGAAAGACTCCTAAAAAAGTAACAA AGAAGGCGATTGGATAAAGGTGAACTTAGAAACACTTTTAAAAGTTATGA AGAAAGTAATTCGATAAAAGTAAGAAAGAAAGAAAGAAAGAAAGCGATTT GATAAAAGTTGAACCTAAAAACACACTTAAAAGTTAGGAAGAGGCAATTT AAAAAAGAATAGAGCAATAGAGTTTAAGAAACAGGGATGTACAGGAAATT TTCTCTCAAATCAAAATAATGGTTTTATTCATTTTTTCATTCGGACATCA TGACCGACACAAAAGATTTTCAGTCGGTCAAATGGCCTTTTCAGTCGGAC ATTGACCAATGACCGACACTTATTTACAGCCCTGGGGTACGTGGTGTTTC AACAAAAAGTGCTATCAATTAAATCTCTTCAAAGAGGAAATGCTTATATT TTGAGCTAAAGCATAGAATTTGCTTCACCCCTTCAAAAATTATAACAAGA ATAGGAAGAAAAAAAATTGTTAAAAATGAAGGCTGGTATTTTAATGCTCA AACTTATCATCAGCAACATCTAAAGACTCAAGTAACTTTTGAATGATATG ATCATCAAAGTCTANATCATTCTAACTTTTCTTTGTAATTTTTACAAACG TCTCGTGACCAATTTCATTGAAAAAGCCTTATCATTTTTAGCAGTACAAT TTATCGATAGAATTTTTTAACAATAAAACTTTATAGAGGAAAGACTNGAA GTAACTTTTGAATGATATGATCATCAAAGTCTATGAAAGAAAGAAGAAAT TTTATTTACAACACAACAGTTAAAACTTTTAAGTGACTAAAAAAAATCAG TGTAAATGAAACGATTGTACAAGAGTCATAATTCAAGGAAGATCTCCCTT ATCTAAGAAGACCCCCCCCCTTAGGTAAGAAGACCCCCCCCCTTAGGTAA GAAGAACCCCCCCCCCCCTTCACTGACAACTCCCCCTTAGCAGGGACCGA ATTAGCGTATTGCATTTCGCAATTCGCGATGCGTTTTTGGATTACTTACA AACTAAAAATTGAAAATTGATCCATTTTAGGATGCAAAATCATGCTTATC AAAAAGTTGCGATGCACTTGGTTGCATGAGTTACGATAACCAAGTTTTTA ACACCCCTGTTTCTTAGCCACAACTTTTGTTTTGCCGATCCGTTTGTAAC ATTTTGCTTCTCTAAAGCATTGTTTTTTTGTTCATAAATTTACCTACAGT TTCTAATGCACACTTTTATCAACTTGTTTTTCTTTGTAAGTTTTAACAAT AAAAGTCAACAAATGTCAACTTGCTTTTTTTATAAAATTAAATTTTCACG AGCGTCTCTTATGCATACTTTTATCAAATCGCTTTCTTTGTAATTAAATT TCCACGAGCGTCTCTCAAATGCTTAGTTTGATCAATTTGCTTTCATTCTA ACTTTTCTTTGTAATTTTTACAAACGTCTTGTGACCAATTTCATTGAAAA AGCCTTATCATTTTTAGCAGTACAATTTATCGATAGAATTTTTTAACAAT AAAACTTTATAGAGGAAAGACTTTCCAACGATAGATTTCATTGAACTTGC TTATCAATACAAGCCAGCCTATCGATGAAGAATCTACAAATCAATAAAAT CGATCGTGGTAAGATAAGTGGTAAATATTAACTAGTTTTTCTCACTGTTT TTAATGAATTTTGTCATTTTGGATAGGTCAAAATTTTCAGTTTTTTCAAC TTCTGATTGAATGAACCGATTTTAAAGTTTTACATACCAAAATAAAAGTT AGCCTTTCCTAATAGAATAATAGAATAAAAAAAGAATTAGCAAAAAACCT TTAACCTTAAGATCGCAATAACTTTACAAAACTGAATACTTTTTTTGGTG CACCTGGTAGTTTTTTCTATTAAATAACATCATTTTCATCACATTTTTTG CCACCCTAAGTAAAAACTTTACAAATACAATATTTTTTAAATCAAATATA TTTTACCAAATCACTTGTCTTCATCAAGTATCCAAAACTGTCCAAAAGGC AATTATTTAAAAGACTCATAAATTATTTACAAATAAGTCATTTTCTCCTA AATTATGTGGAGAAATCGTTTAATTCTTTTGCATATATCATCTTCTTTAA AGATAAAGTACTTGTGGTACCCATATTAGATGTGCATACTTCTTATTTGA AGTTGCAATAAACTTTACAAAAAGTCACTTGTTTCGTTGATTTCCAAGTA CTAGACTTGCACTTTGTTTTGTCATGCATGAAGAAATTTGTTGTCGAACA ACTGTCACATTATTCTCTTTACGATCCAACAAATTTATGATACGCTGTGT GTTCATGATCAGCAAAATTGAGAGGTGGGAAAGAACCAATGTGAAATTTA AAACATAGGTTTGGAGATGTTTGTCTTGGCGTTGAACATTGAACAAAGTT ATGAAAACAATTTGAATGACAATATTTGTGTACATGGCATAGATGATGTA TCTTGTACTTTTGAATGATTCTGGTAACCTCCTTGAACGGACTCCTTGTA CAGTGCAAATGATTGATAGGAACATTGTGTAGATCAATTGGATGTGTAAT TGATTTCCAACATTGCAGTAATGGAATTTGGTCAATAGCTCATGGTCATA AAGAATCATTGTTCTTGAATCATTTTGCATCATAGAGACCATTGTTACCA AAAAAGATACTGATGTGATTGCAGTGACGATCATAACAAGCACTGTTGTT TGTTTACGTTTTTCTCCCATTGAAATACGTGTGTTTGATTCGAAAATCCA AATGACCGTCTGCGTTTTTACCAATATAATACTAAATAAGAGAATAGTTG ATGGACCTACTACCAATCCCACTATCCAACACGATACATTAGTTGGGGTG ATACTTCCTAATATTATCAAAATAAATACATTACAATGTAGAAGAAGTTG ACCAAGTGTCAGTTTTAATTGTGAGGACTTTGCAACAGGGGTATTCCTGT GGCAAACATAACATGTGAAGTATGAGAAAGAAGTTAAGATGCCAACCAAT AATGAAATGAAAAGCATAATTCCTTCAATTGTATCAAAGTTAACAGGTTT GAAGTTCTTGTATGGGCTATAACAGCCAGTATGTAGAGCATTTGCTTTCG TGTATTGAGGACATTTTTTGCAATTGAAATCTCCATATGCATCCTTGTAA AAACCTTCTTCACATTGTCTGAGAAACCAGCTTACTTGATGATCCCATCG AGTTTTGTTTGATGGTACCGTGCCACATGCCTGATAAAAACCAGGGGGTA TATTACTCTGGTTTCTGCATACTATTTTAGGAGGTTTTTTTAGGTTTCCA GGCCATATGACGCTACCATATAACCAGGATAAACCATCCAAAAGTGTCTT TCCTTCTTGGTATAGGTTTTTCATGTTGGTTACTGCAAACATTTTAAGAT TGACTAGAAATCGAGTATTTAGGTAGCCTGCAATGTTATTTATAGTGAAC CATTTATAAGCTTTAAGTAGTTCAAGCTCATATACCCGATTTAAAAGTAG CTGAAGGTTTCGTATACAGCATATTTTAAAGTGATGTCTTCATACTTTTG GAGCCTTTGGAGAGCTGAGGTCTTACTTTCATTTTTTTGAGAATCCCAAG TAGGATGATATCCAATTTTCAAAACCGGTTTTGTCAAATAGCTATGGTTA TAATCTCTTGGAATGTCTTTAATATCATTAGTTAGACCAAAATTACTGAT ATAGAACAAACCTTTAGCTAAATTCCTTGGTATTGACCAGCTCTTTGAAT CTGAATCTAAAAACAGAACACGGTTATAAACACCATTTTGATCAAGCGCC TTGAGAAATTGAAGTGTATCCTTTTTATTTCCCATTGCATAAATTGCTTT CAAATCTGTTCGATTTTGAAGCAATCTGATTGTTTTGTCAAGTTTTGTTT TTGTCGCAACGTTGTCCATCCTGTAAATACAGGTAGATTTTGATTGTTGG AGAGCTTCGTAAAATAGTTGTGTCCTTTTTTGATAGATTTTGCTTTGTGA TAGAGTTAAGATAACAATGGATTTCCATTCTGAATAATCAAAGAAGACTT TGGTTTTGTATGCTATTTGATGCTCCGTCCCTACTTGATGGATCCTTTCT AAGTTTCTCAAATCTCCCCACGGTTCTTCCTGGAATCTAGTTTTGTTGTC TTTGGTATTTAAGATAACAAAGGGCGTTTTACTTCTTGGCACTTGAAATA TTTTCTTTGCAAGCCATGTTAAATGTTCAGTCATGAAGCTGTATATGACT AAGTATTTTGGTACCTCTTGTTCTGTCGACGAGGCTTCTCTTTGAAATAA CTCCTCTCTTAAATACAGATCTAAGAATGCTGAAACCAATAAATTTTGAC TTGCACACACATCAATAGAAATCGTTTCAGCAGTTACATTATAACGTTTG AGAAATAACTGATTGTAATATGCACTTGTTCTTTCAAATGCTAAGAAAGT TTGGTAAGCTCTGTTGTAAAACTTCTGATCCTGTAAATCATTTGGGTTGG TTGAATTTCGAGTTTCTTCTGATGAGCATGTTGAAAACAAGCCAATGATG TAATAGTCTGGTTCTGGTGTGGTAGTGCTGTTCGCAAAACAGCAACAAAT CATTGTTAACAAAATGTTGTATTTGAACCATGGCCCCAATGACATCGTAC CAATCATTTTATTATATTTTCCAAAACAAAACCAAGCCTTTTCAGAACTG GATACAAAGGGAAAAAGATTTAGCTTCTTTGATCTGGTTTGATTGTAGTT TATTAGATCAATCCATAAACTCAAAGTCCAAATGTTTTAAAAGTTGAACT GAACGTGTCTTACTTCAGTTCGTTTGACTTGATCGAAGAAAGGATGATAA TCTTGGCGAGTTTTATATCTGTAGGTTATCCATTTAACAACTTTTCATCT GCTTCTGTTCTCAATTTCCCCAGCTGCTTCATTTTATACCTCCTCCTTAT GGATGTGAGAATTAGCAAGCTTTTCGATGTTATTTATCGCCTCTTTTATT TAAACTTTATTCTTCTTTTGACTGGGAGTAATAATTAATGTTTACAATAA AAAGGAAGTCATAATCTGAGTATCCAGGAACTAAACGAGTTCTGTAAATA CACTGGTACATATTGCTTTAATTATAAGAATATGAAAAAATATCTGGTTT GATTTTTTCCAAATTTACTTTCTGATAACTATTTCCATTTGATCACCGTA TTTAAACTGTAATGTGTATTATAAATATTTGTGCAAGTTATCATGTAGGT TGATTGATGATTTGCTGCTAGAATGAAGGCTAGGAACTGCTTGGAAAGAT TTTATGATTCATGGTTTCTTATAGAAATTAAAGAAAGTCAAATGTTTATA ACGGTCTATTAAAGATTCATCCATATGAGTTTCTTGGAAATTACTAACAC CAATACTACAAACAAAAGTTTTTCATTACAACAAAAAACAATTTCAATCT TTATAAAGTTTTAAAAATTTGGGCTTTTTTATATATCTGAGCAAAAATTC TCGAGGAACAATTTCAAATCCACTGAAAAATTAAAAGGAAATTCCCAAAG GGAATGTTATCATTCACCGAAATTTCGAAAAAAAGACCAGAAAATTGTTT TCGATCACCATGTCCCACATACTGTCAATGTTCCTCTCCTCCTGACTCCT CAGGATATTGAAAAGATTCAACAGAGCGCTTGATAATGATTCTACTTTTT AAATAAAGACGAAAATGTTGTGAGTGAAATATTGAGAATTAAAAATACTT TATATGTTATGCTTCTGATAATTAGGTCGAAAATCGATCAGAAAATGAAG ATAGAATGAGTTTAAATCTTGATAGAGATCTCTCATAATAGTGCTAATGT AATGTATTTTTGGCAGGTCTAAAATCTTTTTCATTTTTTTTACAGGAGCA AAGTACCATTGCAATTATTGCCACGCAGATTGTTCTGGATTGAGGGTGTC GTGTGCTGAGTGTCCAGACTTCGATGCTTGTATTCAAGTACGATTTCTTT TATTTTCATTTGTTTTCTCAATCTTTCATTTCTTTTCCCCTTTACTATCA ATAAAGAAGCTTTAAACCCCTGGTCTGTAAAATTTAGATTATCTGACCCG ACCGAATATCCGTATATAGTCTGAGGTTTTCAAGTAAGTATGCCAAGCAA GGCTGCATTCATTCAAGGAAAATTTTGGAAGTTCTAATCTTGAACTTAAA GAAGTGCACCTTGATGAATTTCGGTCTTGATAAGGTGTCCACGGCCTTCA GAAAATGATGCTCAAATATGCAAAATATCGATGAAATTGAACTGAATAGC TAAATTCTTCACTTGCATATTTATAATAGGGAAAAATGCAAATATATCTT ATATAAAATACTTGATAGAGGCATCCTGTCTTTCTTAAGCCATTGCCGTT GATCCAGGTTGATCAATGATGCTTCAGCCAGGGACAGGGTAGCGCTATCA AGTGTATTCATATGAGACTTATTACACGTGAGTAGCTATTAGTAGTAGTT ATTAGTAGCTAAATTCCACACTTGGATACTTTAAAATGAGAAAAATTCTT TTCTTTCTAATGCGGCTTTTTTTATTTTTTCAACAGTGTTTCGCATCGGG TGCAGAGATGGGCAATCACAAACGAGGTCATGATTACCACCTCATTGTAA GTTTGTTAAGACATTACCAGTTTCGTAATACACTCTATGCGCATAGTCTG TTTGATAAAAAAAATTTATCTTTCATTTTTCGGAATTTTGACAACGATTG AGGCTGTTTCTTAATTTACTTAATGATTGTCACCTGTGTGTTAAACCTGC TCGATAGTTTGATCTGAATCAAAAGAAAAAGCAAAGGCTCACGAATGCCT TCTTTCGAAGTCAATTCAATTATTGTTCGCTTGTCTGGATGTTTCATGTT CGCAGGCTAGATCAAAAAATAAATCACCTCCACGAAAGATGTTTGAGGAT AGTGTATTCTGATCATACATCTACTTTTGAGCATCTTTTAGAGAAAGACG GTGCCATCAAAATCCACCATAAAAATCTTCAGTTGTTAGCAATAGAACTT TTCAAATGTAAAAATAACATATCAGATCTAACTAAAGAAATTTTCAAAGA TGATGAAAATATCAAAGTAAATCGCAAACATAGTGTGCAGACGGGTCTGA ACCCCCCCCATTAATATTTCATCCCCCCTATAAAGGTATCCCCCCTATTT TTAAAATCTTTTGATCCCGCACCATTTACAGGGGTCCGAGCCCCCAGCAT ATAATTTGTACTCCCAGTATTGGGGAAGAATTTTGATGAATGAAATATAT TTTTCAGTGTGAATTCGTACCAATAGTCAATGAACTTGAAAACACTAGCA AATAAACAGTAAAACTAATAATTTTTTAACCAAAAAGTTACTATCCCCCC CCCCATTTTTATTTGATCCCCCCTATAAGCTCAAACCCCCCATTTTAACT GGGAAATTGCCCATCCCCCACTATAAAGCCTTCCTTGAAAACTCGGATCC CCCCCTTAAAAAAGGGGGGGTTCATACTATGGCAAAACGCCTTTGCTTTA GATCAAGAGAAATAAACTCTGTTTTTCACGGTTCAGAGTCACTTTCATTT TTAGGGCCAAAAGTTTGGGAATTAATTCCGGATAAGTATAGAGATATAGT CGATCTTAGTATTTTTAAGGAAAAGATTAAGCAATGTAGGCCTACATCAT GCCCGTGTAAAAACTGCCGGACCTATATTGACGGTGTCGGCTTTTTGTAA TCACCTTACAAATTTTAAAGTAGCGTTGACTTTTATTAGCCTTTGTTGCT ACCTGTTCGTCAACTTGAAATAAACTATTACATACATACATACATCTTGT GTGTAATTTATAGATACCACAGATAGTGTACCGGGTGCGCCAAAAAATAT ACAGTTTTGTGAAATTGTGTACCATTAAAGGCTTTTCGTTGATTCTTTTT TTATTCTATAGAGGCAATAACCAAATTTATTTCTGGTTCATGATATGTTT TGATTCATTCAAAAAAAATGGCATTACGAAACAACGTTGAAACGAATTTA CTTCGGATAAGTTACTACGCGTCGTAATTTTTTAAAATTCCAATTTTTCT TTAAATCGTCTATCAAATTTATAAAAGGCGATTAAATTAAATNGTAATTT TTTAAAATCCCAATTTTTCTTTAAATCGTCTATCAAATTTATAAAAGGCG ATTAAATTAAATGAATTTGATTGTTTGATTAGGAATATCACACTCAAACA CTAGACAGCTGATTGTTCTACCTATCAGATAACTTTGTTTTCCTTTATCA TTATTTTATAAGAACTCTTAAAAAATTAGCGAAACCTTTGCCTACTCTTT GGCTTCAAATCTTTAAAATGTAACATATTTAGTGCAGTTTTTAGAAAAAA CTATTTCAAAAAAATCTGGGCGATATATGTTGATCCTATAACAAGTAGTA TATGGACAAAGGTCTAATTTGGCTTCGAGACCCTTACAAAGTCAATTTTC GACTTTCTAAGGGTCTTTGGGAACCTACCGGCCCTCAAATGTTCTTTAAA AATTTCCTCCAATTTTGCTAGCTGGATTATGATGATGATTTCGGAGCCGG ATTTTAAACATTCTTTTTTTGAGATATTTAGGATTTTCTCTTTTCTATAT TGTATTTTAAAATATATCTCATTTGTCCAAAATCGTAGAAATTTTGTGAT GCATACATAATTTTTTCTTAAACTAAAGGATGCTCTCATTTCAAACGACT GGAATTATTGTTTGAAGAGCAAAATTTTGGCGATTTTGGCTTTGTGACCA ATATGAACCATCCATACCTTATTCTGCTGAAAATTCTGTTGTTTCAGGCT CACAATCATGCTTACTTTATTGGAACTAGTTTTCGCGGGAACTAATATTC CTAGGGATTTTTCAATTTTTTTGATAAAATTGGAAAAAATAGTATTTTGC GGGTTCAAATTTTCACGGTTTTGTCAAAAAAACGCGAAAAATGCTAAAAT TAATTCCCGCGAAAATTAGTTCCATTGAGGTTAATTATTTTTTTAAATGT TATAATCTTTGGCGATTCTAAGCCACCGTTATTCTTCTAAAATTGTTTAA CATTGATAAAAAAAAGATGAAGTAATATCCCCCTCGCCCTCCTTTCTTGA GCTTTACTGCAGTGTAGTTCGAAAGTTCTAGTTGATCATTGAGCAGAGAC AAAGATTTAATTGCCACGCCTTGAAAATGTGTCCATGGTGTAAAAAAGAG TGTCTTGTCTTCACAACGAGATGTTAAAAAAAATGAAAAAGATTGTGTTC CCTAGAGGACTTCTATTATTTTCCCAATCAGCTGATTCTCGCATGTTGTC CCTTGTGAGGGCACCATTAAAAGAAAAACGAGGTTTAAAATCTCACTAAA ACTTAGCAAAAGGATGTTAAAAATCCTTGAATACCACACAGTCTCCAGTC TGACTTACCAGACTTTTTACACAAAATTCTTAAAAATCAATATTAACCCT ACAAATATATACCTCTGTTTTTTTGTTGGGTTAATTCATTGATTATAGTC ACGCTTCAGGCTCGAGCTTTATTGAATTAGAATATTTTAATTCAATTTTT GAGTAATTTTTAAAGCTTTAATCAATGACTTTAATAAAATAATTTGTTTA AAACATTTTTTCGAATTTAAATTTGATATTGAATGGAATTATAAACTCGC AAATAAGTGTTAATAGCACATTCGATAATATTTAAACACTGAAAAATGTT ATATGAATTCGCGAAGGCCTGAATCAATACAGCCAGTCTTTCAACGAGGA ATATAGAAGAATCGAAAAACCACCCATAAATTGCCTTCAAAGAAAACTAG CACCCTCAGGCACTCTTCCAACACTTTTTATAAGAACCAAAGAGTTATTA TAGAGAGTTTGCAGCATTTTATTTTTTAGTATTTTAAGCCTCAAACTGTT CTTATCCTGTTCTTATTTCAGGGCAAACTATAGATAGTTCCAGATAGTTT AGTTCTTGTGTGTTTTCCTACTTAAATTCTTCTTCCTTAAACTTCAAAAA TAACAGGCTTATGACCGTTCTTAAATTATTCTTATAATATGTGGCATTGT ACAGTCTATTGTTCTTATGAAATTGTTCTTATAGAAATAGAGAGTGTCCA ATTGAAATTTTAAGTCAAATTTGATCGTAATTTAATTTCTTCGTATTATT ATTGCATGTCTTTTTACGGCCAATGTTTACTATTTGAACAGTGTTTTGAT AATAACATTAAGAGGCTTTAATGGAATCAAGTCAAAGTGTGCCGGCTACT ATCACTTGCTATATACAAAGTCTTGCTATGTTAGTACAGGCAACCAAATT AAAGGGAATTAACATTTAATATCCATTTTATAAAAGAATTGATATAAATT ATATAAAAGAAGTACCTTAACAAAGAGCTTTTTTCTATTGTGTTGGTTAG TTCTTGCGCGTGCGATGTTTCCATTTATATTGTATTATATTATTGTCGTA TACTATTTAAACGATTCTGGTGGCATCATTCCTTAATCATTTTCATTCCA AACGTCGAAATGGAATCACCTACAAGATCAATCACGCCCTCTTGTACGCC ACCGCCATCTCTAGCGACGTTGAAGCGCCCTGACAGTTGTTACTCAAGTG GTGGCGAGACGCCACCTTCAACTGATAGACATTGCAGTCCAACTTTCTTC ACAACAGATGACCAAGACGTCACTTTGGTTTGTGAAAATCTGATAAATGC TGCTAAATTTGATCGCCTTGAACGTTTCATATGGGCTGTTCCAGCTACTG AGAAATCCCGTAATGCGGAAATTATATTGATCGCTAAAAGTTATTTAGCG TTTCGTAGTGGACAGTTCGAATTGCTGTACGAGCTTCTACAAAGACGACC TTTCGCCAAAAAGTATCACCGGCAACTGCAATATCTATGGCGGACCGCCC GCTACATTGAAGCCGAACGTGCACGAGGACGCGCGCTCGGTAGCGTGGGA AAGTATCGGATTCGCAGGAAATTCCCGTTACCTTACACCATCTGGGACGG AGAATGCATGTCTTATTGTTTCCGTGAAGAAGCTCGTGAAATTTTGAACG CCATGTATAAAAGAACGCCTTATCCGACCGCCCAAGAGAAATATAGCATC GCTCAACGTGCTAACCTGAGTGTAATGCAAGTCAGCAACTGGTTCAAGAA TAAACGACAGCGTGCTCGAGCAAAGAAAGCTGAAGCTAAAGACAGGTAAT TGACGGATATATTCTGACTTTGATACTTTTAAAATCTTTGCGTTAAGGTG GTCGAACATTTCTGATTAATTTTTATTTCACAGAACTGCCTTCCCTATGT CTTGGTAACTATTTTAAAAAACTTTTTGTATCAAAAATTATAATNTAATT TTTATTTCACAGAACTGCCTTCCCTATGTCTTGGTAACTATTTTAAAAAA CTTTTTGTATCCAAAATTATAATCTGTGTATTTTTATTATATTTAGTACC GAAACCAGCATCAATGAAGATGCCAGTATCACCAGAACCAAATTAGATGA CAATTATCATCATCATCCTCACACTATCAAAATGGAAGATAACCTTCCTT CTCCTACGATCCCCAAAAGATGTTCTTCTCCACAACAACTTTTAAAACCG ATGATAAAAATGGAGTATCAGAAACCAACATCATCGTTCAAACCTATTCC TCATTTACCAGCAATGACGCAGGACCTGCTTCACCATTCAAAATCACCAA AGCGAAGACTATTCATGACTCCGACACCGTATCATCCATATCTAGCCTCA CTTCATCATCTCCCACGTACAGAATACAGGCTAATGCCACCAGCATTGAC GTCATCATATTATAAACTTAGTCGTGGTCACATCCAACCTTACGTTGTTG TGCCAAGAAAACGAATTTTAGTCGATAGACCTCGTTTGGTACCAGACTTC TATAGAACACCTCTGGATTATCGGCATCATGCGATTTCTGATCGACATTG TGAACAATGCAACAAAGACCTACATTAAATTATGATGGATTTTTGAAAGC ATGTCGTTTAAAACGATCCTTGTCATATTTATTAAAATATAATTTATTTC CATTTTTAGGACTTTAGGTTTTGTTGTTCTTGTGAGAGTTTTTAAAATAA TATTATTCTAGATATATCCTTGAAACATAATTTATTTGTAAAATACAATA TTAAAAATGAAACTTAAACTAAATTGAAAATTGTCATTATTATTGTACGT GTCATAATCAATTGTAAAGTCTCCTTCTTCGTATGGAATTGTTGGTATAA AGAGACGGACTTACACTTTAAATCAGACGTCGTACCCCCTCCCTCCGCTC GTCCCGTACCCTCACTAAATATGTTACCGCCCATGTCTTAAAAATCGGGA ATTTTAGGGCTTTTTCATGGCTAATTTAGTTTTCCCCGTCATCAGGGTGT ACTCTTAAGGGCGGCGTTTACCCGTACCCTCCATTTTCATAGGTACCCCC GGTAAGACTCGGTAACTAAATATGGGTCTTGGATTGAGAGGGACTTATTC AAAATAAAAATGTGAAACGTAATTTCAATAGATTAGACACAGTCAGAATA AAGAAAACGCCAGTATGTATTGGTCAAGTACACTCTTTTTTTTATAAGAA CAATAAGGCTAAAAAAAATTGACAAAACTAAGAACTGGAACTACTACTGA GTTTCAAGAATTTTAATGGTCGATGTATCAAAAAATATGTATGAATCCTA TGATACCTCCATTTTTGCCTTAATTATAAGAGAGCAATTTGAGACTGAAG GTGCCATTAATAAAACTTTTTTTCAATAAGAACAAACTGTATAAGAACAT AAGGCTTAAAGAGGAATATGAAAAGAAGCATATGGCTAAAATGTTAATAA GTTAAGAATATTTTAAGGCTTTCCGACCCGATTCCTTAAAATAATGGACA AAAATGCTCAAAAAATGGCGAAAGTAAGTATGTTAAGAATATTTTTAGGC TTAAAACTCAAAAAGCTAAGAACATCCCAAGGCTTCAAAAATTTTGGATG TTCTTATAAAACAAAACGTGTAGAAAAACCGAGCCGTAACAAAAATTTAC GTGTTCTTATGAAAAAGCGTTGTAAGCGCTTAAAAGCAATATTTGATCTT CACGTTTCAGCGTGAATTGATCTTAATTTGACTCGTGTCCAAAAAGCAGT GTTTATTCAGTGGTTCGTTATACGATTACACGTTTTTTTTTTATAAGGAA CACGTTTATAAGGAACTCGAGGCTGAAAATGGTTCAAAAAATAAGTAATT GTTAAGGAACTGCTCAGGCTGAGAATAAGTGGATTTGAAAATAATGTACC TTATTGGGACTAATTTGACCAAAATTTGGTCTTTCAAGGGGCAAAAAGTT CAAAATTTCCTATGTAGTAAGGAACTCGATAAGGAACTTTGAGACTGAAA TTCTCTGTAAAAATAAGGAACTCCAGGCTCAGAGCCAAGTTAAGGTTCCT TATAAAAAAAAAACGTGTAATGAAAAAATACCTTATTTATAAGATGGTCA ATGGTAATTTGATATTTTATCTTGTTAGATATAGCAAAATAGTTATCAAT CAATATTGTTTCATCTGTATTTACTGTATTCCTTTAACATTTAACTTTTA CCTATTTTGCTAACCTGAGAACAGATCATAATCCTTTTCTGCCTACTGCG CTGAAACTCTAAAGGGATAGGTGAAATCAAATGGTCTTAACTCTTCAAAC CTGATTAACGTGTGGCCTAAACATAGAATGTTTTTTTGAAAGAGTATAAA GATACCAAAGCCGTTGTCTAACTAACTATCAAGTTTTGTAGAATAACTTT ATGAAAACCAGTCAGGCTAAAAACTCCAAGGGTTAACAAACACAGGTCTT TTGCAAGAATTTACTCTATAAGAATGTACATAATGATGAAATTGTCTAAA ACATTTAGAATATGCGAATAATATCAGCGTCATATATCTATATCTGACAA CAACACCTAAACCTTTTTCCTGTAAATTAACAATAATCCCCAAGTAATGT TCAAGACTTTAATAAAAATGTTAAATATTGCTGGTTGGGTTTGAATCCTA TTCAAGGAATACATTTAAGAAAATTTTATGATGATATTTCTCAAAAAGTT AAGAATGTTCACGATGAAAAAACAATGACAAAATCTGGAGAAACTTCTCT CAATTTTGAGCTTTTGCCTAGGTGGATTGTAAAATTGTCATACATTTTTG TTCATCGGAATGTTTTGTGTTTTTCATTCGAAATGGTGGCTATTGAAATG GCTACCTCGTCAACTGCTTCTAGTCTACTTCACTAGATTCAGCGTCACCA AAAATTACCAAAAAAGCAAAGCTCATCAAGAAGTCCACTCTCTAGTCTAT TCTATCGGATAGGTCACTTTTTGAGTACCTAAAACACTTCCTTTACCCTC GGGTACACGTTTTTTATAAGAATAAACTATTTAAGAACATAATTGACCTT GATGACCAAAATTTTAAGAACAAGTTAAGAACAACATTTTAAGAGTTAAT TGACATGGAAATTGCACAAAAGTACTCACAAAAATTATGAAATTTAAACA GAATATGTTGAGAACATTTTTAGGCTTAAAACTTAAAAAGTTAAGAATAT CCGCAGGGTTCAAAAATTTTGGATGGTCCTTATAAAAAAAGCAAGTGTAA TTGTGAAGTCGTTTCGTTATTTTCACATTTTTGGTGATTCCATTTCGTTA TAGGATAACGGTACATTTTATTTGATCGTCAAAGGATGGACAGCTGATGA AGAAATGTTATTATTAGATGCCATTGAACAACACGGCCTTGGAAACTGGT AATTATCAATTTGAATAATTGTGGTTCCTTATGTTTTAACTTTATTGGTC CAAATCATCCTGTCGAGTTCGTGTATCTATGTTTTTCTGTGACACAGACG GTTAGCTTATCATTCTCTAGATCCTGGTTTACTGAGGATGACTTTTACCG CTCTCGATTTCGCGGGTCAGAACTGCTGGCTTTCCTCAAAAGTGCAAATA CATAAGCTCGCTATAGGCCATTTCACAGTCAAAATGAATCATGGGTAATA AGGACTGGTTACGCTCTAGTAACGACTTCCTGTTGGCTAAACGCAAAAAT CTTCAAAAAGTTTCATCAAAACTTAATTTGGACCAATAGAAAGTCGTTAT TAGCGCGCAGTTGTCTTGATTTCCCATTACGATTTGCGACTGTGAAATAG CCTTGAAAGTTTCGAGCACATCCTGTGTTTGTCATACAGTATCACTTTTC CATATTTCTGATTTTCTGGAAGAATTACAAGCTCCATTTTGAATTTAGAA AAAAAAATTTTAGATCATAAATATTTTTTGATCAATATTTTGATAACAGG GACGACATATCCGATCATGTTGGAACCAAATCACCGCAAGGTACTTAAAT TCATTTGCCACATTATTAGTAACACATTGTAATTTATGGCCAATAAGGCA AGACAAATTCAATTAGTTCTTGGATGAATTTACACTTTTTGAACTTGTTC AATTAGAAATACTTTAGACGTGCAAATTTTCGCGAGCAGAAACTTTCACG ATTTTCGCGAATTTTGGCCTTTCTCGCGAAAGTAGATGAAATTTCTATGA AAATTCTTAACAGGGCAATTCGCGAAAGTTTATACTCGCAAAAAATTCTC AAAAAAAATTGGAAATCTATAAAACCTCGAAATCGTTATAACAAATATCA AATTTTCGGCATTATTTTAGAAAAAACAGGGTCGGTCGGGCCCGTTAATA AACAATAAATTAATTTGATCTCGCCTAATTGAAAAATATTTAAAGGGGTA TAAAATTGTATTTAGATTTAACATTGAATTTATGAGCTTTTGATTACAAA AAATATCTTTTTCAGAAGCACAAGACCACTTTGAAGAAGTTTATTTGAAG AAAAACATTGGAAAAGGTATTTCAATTTGATTTTCAGTTTTCTTCATTCC GCTAGCTTTCCATAAGTGTTAAACATCAAAGAAAGAAAATTTAATTTTTT TCTACACCCATCCTTGTATCGATATACGTAAGTCATAGTTTCTATTTTTA GTAAAAGAAAACGGTCAAATTCCGACTTTTTTCGGGTGTTCCCCCTAGAA AATAACTTTCGCTAGAATAACTGGTGATAGTAACTTAAGATAGAATAGAA ACCATTATGGAAAAGAATACAGTGCTAAAATTTATTCAATCTCAGATGGA TTTTTGTTTCAGTGAAGTATATGAAAAGGTTTTTTTTCTTCTCAAAATTC GACATAATGCACCAAAAGTATATGATTGGCTAATTTGCTATATATAAAAT CCATTATCCGTCCCAGACGGAAAACCTTGCTTTGACCACTGAAAGAAAAA TGAAAAGAAAGAAAAAAGGAAACAAAAAATGATATTTCATTCTTTTCTTA CAGTCACATTACCGAAATCAGTATCACATATTCCTGATCATGCTTCAGTT GAAGGTGAGTCCCACTAATGAATTGAAAAGAACATTCAGAACGTTCCCAG CTGTAATCTCCGAGCAGCTCCTGATACTCCGCGCATAGCACGTATTCGCT CTCCGTGAGAGAATCTGCCCTAGGTTGGCGCTCGAGTAGAGCGTGGGATG CGCAGAATGGACGATCTGTTATGAGATTATCCCAGCTGGTACATAACGTT GTTTTAACGTTTGTTTAACGTTCGTTTAACGTTGATTGGACGCCAGATAA ATGTTTTACAAGCTTCTATACAACTAAAGAAACACTGTCGAAAAATTCTT TCTAAATGATGCTGGAATAACTTTTTCATGATGTGCACCATTGCAATGTC TTCTAACATTACATCACGGACCCAATAGTTGATTGGTTGTAAATGACGTA TTGATTGATTTTATGTCGCTTACAACCAATCATCTGTTTGGTCCGTGATG TAATGTTAGAAGACATTGCAATGGTGCATATCATGAATAGGAAACTTATT CTCGTGAATTCGGCGAATGATTTTATGGAATAAAAATCTTTGTTTTAAAG GCTAATTTTAAGGTTCAAAAAGAACCAATTTAGATTGCCATTCGCCGAAA TCAGTTCTCGCGAGGATTAAATATTTTAGGAATTTTGCTGCTTGCGAAAG GTATTTCTCGTCGAAATTGGGTAAACTAATTTAAAGGTGTATAAAATTAT TCATTTTACATGAAATCAGACTATAAAAGCAGCAAAGTTTGGACCATTGA AGACCAAATTAAGTATTTTGAATGATAAACCAAGTTTTAACGCACTTTAG GTCAGTTATCACCAACGCTTTTGAAGCCAATGGAATCACTTGATTTACCG GTTGCCGAGCAACAAGAACTTGGCTATATGATGTTCCGTGATGATTTTGA ACGGGTATGTTTCAATTTGGTTTTTCTATTCATTTATTCAAGCTAGGGAA TCTTACTGGATTATTTGCGCTTATATATTAGGTTCAAACTAGTCTGAATC GCAGACCTCTATAAAACCCCATGTAGTATATATAGTCATGTCACCAGTGC ACGAACGGCCCCAGTGCACGAACGAGCGTCTTTGAACTTGAAAAAAAACA ACCAAAAACAAACTTCTATAGAACTTTATTTGTGCAGCAGAATCCTCAAA CTATCCCTTGCAATCTCTCCAAAAATTAAAATAAACGGAGCACTAGAACA ACACCAAACCGATTTTGAACGACGCCAAGTAAAAAAATCACGAAATTCGG GATTTTTGTAAACATGGCTGATCGCGAGAGAAAATGTTTTTTATAAGAAA ATTTGCGCAAGAAGAGTTCTGAAAATGACTTTCCTCTNTAAAAACCTTTT ATCTTCCATCACACAAAATTTCATTGAAACATGTTAGCTCATTAATTCAA AATTAATAGAAACATATCACCAGTAGTTGATATAAAAAAGGTTCCAGTTC GCGAACGATCCAAACACCATATTCAAAATGAAGACATTGCAACGTCAAAA CATTCGAAAGCGCTGGCGATCTCAATTAAAAAAGAACAAAATAAGGCAAA ATAGAACAGATTTACGCTGTCATTCGCCAAAATTAGTTCCCACCAAAATT AAAAAAAATCCCTATTCGCCAAAATAAGTTCGCGCCAAAATTAGTTCCCT TAAGGTACATTGCCGCGCTTTTCGATGAGCAAAACTTGAAAAAGAGAACA AAAAAATGGACGACAAGAAAATATTTACAAAAGTAAACAGGTTAGTAAAA CGCTAAAGTTCTTTGGTGAAAAAGCGCGTGGTTTCGAAAAGTTCAAATAC CCCTGTATCATCTCGGAAGAGAGTTAAAGTATTACCTACGAGCGGAGCTC TAATTTTTTCTTTCAAAAGATCGTTCGCGCACTGGTTCTTCGTTCGTGGA CTGGGTCCGAATAGCGCTCGCTTTAACCACTTATTATTCCAAGAAGAAGG CTTCAAATAAAGTGAAAACAAACTGAAAGAAGGACTTCAACCTTGTCTAC AAGATAGTCAAAAAGGATTTATGTAAAAACTAAAAGTAAGTGAAAAAAGT GAAAAATAAGTTTGGCGTTCGTGCACTGGGGACCCTCCTCTATAGGAGCA CGAATCTGTTAGTGGATGTCAGTAGCCTAGATACAGACTTGATTTATACA GTGGAGTCTTCATAAATCGAACCTCTATAGCTGGAATGTCTCGTTAAATA AAACTCGATAAACCGATCTCCATAACTAGAAATAAATTAGGGTGTTCCAG TTATGGAAACTCACTTATATTATACAAGGGGTGTCGGCACGGCGTATGAT AAGGTACGGGGAAATAGATGCCAATGGAAAGGAAATTGAAAAAAAAATAA ACAAAACTGAATTTCAATGCTCGTCATATTTAAAGATACAGAGATTTTTT AAATGCCATCTCTCTTTTGTATGTTGTTTATTTGCCATAACATTGCAAAA GAAGATACGCCCTCCAATAGCAGTGACGACCCGTATTTGTCCACACGCAT TCAAGTCTGAATCGAGTCACGTAGTTGCAACCCCTCTTTTGCCCTAAAAA ATGAAAAATTAAAAATGAATTATTATCTACCTATAGTATGACAATGATTA TGAGCTTTTTCCATTATATTCTGTATCCGTTAACACTTATTACATTGTCA TCTGGATTACACTTAACTCTCTCTAATTCGAATCTCTATTATTTGAATGT CTCTCTAATTCGAACTGAAGCATTTGTCTGCTCAGCTGAAAGGTCATTCG TTATATTCGAATATTTCTCTTATCCATTGGAGAAAATTCTTGGTCCCTCG AAGATCGAATTAGAGAGAGTCAAAAGGCAATCATTCAATGAAAACATGAA AACACCTTTTTTAAAAATTTTTGCTGTTTAAATAGGTGCACGGTTACAAG TCATTTACGGTTTTCCTTTGAAAATTTCATACAGTCAACGCTCTCTAATT CGATTTTCAAGGGGAATTGGATTTTCATCGAATAAGGGATCGTATTGAAT AGTAGAGCATCGCTTATGAGAGTTTCTTGTTGACGGTGACTTTCAATATT ATCGAATAATGGGGTGTATTGAATAGTAGAACGTCGAATTAGAGAGCGTC AACTGTAGTTCATATGTACAACTTACTCGATTGGTCCTGTATGTTTTGTC CTTCTTCAGAAAGTCTGTAGATTGGGAATGATCCACAATATTGTTGGATG GTCAGAGGAATATTTCCTGGTTGAATGACAGAGCCAGTTCCTTTGAAATT CTTAGTGTCTTTCACATCGTCAGGAACTTTCCTACCCAGCTGTAAATGAA AAGATTAAAAGATATCATTATCTTAAGATAAATGTATATTCTTAAAAGCT AACAAAGACTAAATTTAATTATGTTTGTAATTTTTACTTTGTCAGGGAAG TCTTAAAAACAAAAAGTTTGAAACTATGGTTCATCAGCTAAAGCACGTGT GCAAAAAAGAGTCAGCTCTCAGCTCCCAGTAATTTACCGCCTAGATCAGA TTATTTAATCTCAGCTACTCATTTGCCGAGTTGACGGTAGCCGGGGATCG AGCCCGCAACCTTTGGATTGTATGAGACGAAAGCTCTACCGACTAAGCTA TTCGAACAGTGGAACTTACTTTGTTCAATCGGTGTCTGATCTTGGCATTG GTGTCTCCGTACTCATCTTTCATTAGGAAACATTTCTTTTCACCCGTAAT CTTCATCACACTTAAACCCTAAACAAAATGAAGGTGGAGGTTGTATGACC AATATTTTTTTATAGAAAAACACTAATAGCTTTTGAAGAAGTATTAGATT GATGGGTTTTTCGAAATTCAGCTTTAACGAAAAAATGAAAAAGTATTCTG TGTGATATACAGGGGTCGCGAAAATGCCGGGTAGGTAGAAAACTTTCCAA ATTTAAAAGTCGGGGGTCGGAATAAGAATGTTCTGAGTTAAAAACTTCCG AAAAAAACGTAAAAATAAAGCTGTACAAATGAATAGCTTTCAAAAACATC TATCCAAGAGCTAATTAGAAAAGAGTCTAGTATAAGAATGTCCTAGGTTA AAGATTTTTCCAAAAGAAATAAGCGTGGGTGCTCGTTATGTTTTGTGTCC ACAAGCGAACACATTATTTTTTATAAGCAACCAGTTTGCTCAGGCTCGAG GGCTCAAATTCGCCAATTTTAGTAAGTAAAGTAAAAGCTTTTCAGATAAC CATGGCAAAAAATAGTCCTTGACTCAATAAGCATAAATATGGTATAATAT CAGGGGAGGCCAAAGCATTTTCGGAAAATGAGCTGGAATGCTAAGTAACC CAAGGGCTGGGAGTTGGTTATAAAAGATTTGTATGTACTGACTCACAGTT CTATGATCTACCAAAACCCGCGTTCCTTTTGCTTCGATCACATACTCCGT AGTTTCATTCTGGTCATCGAAAATCACTTTCTCGGTCAACTTTCTCCCAT TTTCGTTGAATTCAATGTCAACATCTCCTTTTTGTGGAATACCAAACACA AATGCTGTCAGGGAAATTCCCACGATGAAGAATAATTTGAAGGCCTGAAA GTGTAGTGAAAGAAAAAGGTTCGTTTTAAACGAGCTCATAGAATGGAGAA GAAAAGCTATTTCGAAATAACTAGCATTTTCATATTGTAGGGGCAAATTG AGAAATAATAAGCTGATGGCTAACCATTAAAAATTTCCAATTTAAAATAT CTAGACTGGTGAGAAATGCATCTAAATATTAAGGATCATTTTCTTACCAA AATAAACAAATGAGATCTTTGAAACTATCAAATCGAAGGATTATTTGAGG AATAAATGTTTCTGCTACCCACGCCTTTTTCCCCTGCTTGTTTTTACGGA CTGTCGAATCCTTTATTGGGCTCTTCCATTAAATTTCCATAAAGGGGGGG TGGGGTGGACGAACCTTTTCAAGGCAAAAAAAGTTTCTTAGAAATGTGGG GATACCTCCTGGAAAATGGCAAAATTTGCAAAAGAACCCTTAAAAGAATT CTTTACATACCTTAAAAGTAAGGGTGGACGAACTAAAATCAGTCTTTTAC CCCCTAGAGGTTTTAGAATAAACTTTTACCTCCTGGAAAAATGAAAAAGT ACTCAGTTATACCCCCTGGAAATTATTCCACCCCCTGCATGGATAAAAAA TGGAATGACCCATTAAAAGCTGTCCAGTCAAAGATGAAATTTTCTTTATC TTACCATTACTTCTTTTGGTTGTCTTGGTTACGTCTGCTTTCTGTTTCTT CACAAATAGACATACTTTTGCCCCGTACTCCTCCCTTATTTATACTGGAA GTTTCGACTAACTTCATTACCAGTGCCCTGGCACAGAAGAGGTTTGGGTT CGTGTTTTTCACTAATATTTCAAGTTTTACACGGAAGAATTTTCTGGGTA AAAAATGTGTTCAAATAAACTCCCTTGATTAAGCAAATACAAAGATGAAA AGGTGTTGTTTCAAATTTTATCTTCCTACTTCCTATTTTGAACAGCAGTG ACTGCTCCAATATAGCTGAAACCTTATGGAAAGACTCAAAATGATGCGAA AACACCCCCTTCTCACAGACCCACTGGGACCCCTTTACACTGGAAAAATT GGCCAAAATATCGTCCCCGGTGGAATTTATCCTCCAATTTTTGTCCCTGC TGAAAGTAATCAAATAAACAAAGCCTCACTTCAAAATATTATGCTATTTT TCCCATCCCCACTGAATTTTCTGGATTGAAAACAAAAGAATTGAAATCCT CAGGCATAGAAAATATGGGAATATCAATCCTCATCGAGTTTCAGTCCGTT ATTTTTATCCCCAAATGCTGAAAAAATTCTACCGGGTTTGTGAGCAGGGA GTGTGCGAAACTCTATTTTCTCGAAATACTAAATATCAATATGGACCGTA GATTGCCAGTCAAAGCCGGACGACATTATTTTGAGAGCATGAAGTAATGT ACTGATAAACTCGAGTCAAATCCTTTGTTGCATTAGGGTTAACATTATAA TAAAATTCTTGGATGGGATGTTTTAATATTCTCTTTTTCATTCATGACAG GAGTATGACAATGATGCAGAAAACTTGATCAAAACGCTCGTTTGTAGTCG TGATGACGATGAACTAGAAACAGGTAACATACCCTTTTACATATACCCAT AGAGGCTCGTCTTTACTCTAGCCTAGTCTAAGGCCCAGGGTTTTTGACAT TATCCCAATGTTGGGTATGTGCGGATAGACCTTTAAAAGCCTTAGAGAGA CTAAATTTTAGCGAAAAAATGGCACTCGGAGAGACAAAAATGGCGAAACA ATGACCTTTAAAAAATAAATTTTCGAAAAATCTGTATGGGAGTGTACTCT AGGAAAGCCTTTTATCCCAATTTGAAAAACAATTGAATTTTTTGGGCCAA ATCACCATCTCATATGGAGAAGTGTTGTCCGTGTTGGCAATAGCTTCTTC ATTTTATGGTGACTGAATATGACCCGGACAGTATAAAATAGCTAAGCAAG CGGTCTGTAGAAAAAATATAATACTTATGTATGTTAATTCAAGCTTATGA TCAAGTTTTTTTCTGTTTCAGCTTTGAAGTTACAATTAGCTGACATGTAT TGGAGGGTACTTCATGAACGTTCCAGATGGAAAAAGTAATCTTTTCATGT TTTAATAGCCATTTCAGTTCATAATTTTCACGATTCTTCGTGAATCTTTA ACTATTTTGAAAACTGATATCACCCTTATTCACAGTATACGAACGTGATT TTCATATTATTGTTCGATTATGTACCCTATTATTGTCAGGCTTTTTCGGA TTTTGTATTCTCAAGGGGGGGGGGGGGGTTTTCCACCAGCCTTGTATAAC TTTTGATCTAGAAAANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNAATGGAGATTTTTCAATTCTGTTTTGA ATTTCTAAAAGCCAAAAAGAATACCTTTAACATATTTGCCGGTTTTTAAT ATACTAATAAAATCGAGGCTTAAAATCCGTGCAGAAAATGAGTAAATTTT TTCAAAAAACAATGACGTCATTTATGATGACGTCAGCAGTTTTTGAAAAT TTTTAAAATATTTTTGAAAATTTATCATTGGTCCCTAAAACCTGTCAAAA TTTGAAGTCAATTGGATGCCTAGATCAAAAGTTATGCTAAATTTAAGATT TTGGGATTTTACAGGGTTTTAGCTGGATTTTATGATATGCNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNCCCCCCCCCCTGATAAAAATAGGGTTA AGCTATACTGATCTATTCAAAGCGTTCGTTCTTTTAACTCTGAACCTTAT TCTTTTTAGGATTGCTCGTGATTATGGGTTGATTACAAGTAAACATCGGT TAATAGGTATAGCAGAGTCTCTATATAGGCTACGCGCATCCCGTCCGAGA ATAGTATTTTCATTGCCACTACTACTAATTTGATAAGACTGATGTGACTC CCCATTCGTTTTTCGATAGGGGGGTAACTCTCCGGACGGGAATTTTATAC ATGATGCGCATCCCCTAAACCAAAACATATCATGCGTGCAGTCTACTATC TATGTTTCTTTAGATTGGGCTTTTCCAGAAAAAAATTGAATATGTAGGTG GAGGATATAACATTTTTAAAAGTTTGCCCCCCCCCCCCCNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNCCCCCCCCCCCGGAAAAGGCAAATTTTGTAGATT TTTCACTACCCCTCGGACACTATATCCTCCATCCCCTCCCCCATATATGG ACATTTTCTGGAAGAGCCCATTGAAGTCCTGTATCATTTTACTGACTGTG TTTTCTCAACACTTTACATCTGACTGTCTTGTAATATTTCAAATTTTATT CAAAATTGGAAATAAACATGATTTTTCTTGCTTTTTTCTTTAGCTTCAAG GAGGAAACTGAGCAAAGAAGACAGGTATCGTCTTTTAGTTAGACCGTTTG TGTCGTCTCCATTTTCATCTTATTTTTAAAAAACTAGTAAATTTGGCTTA ATATTGGCTGTACTTCATTTTTCTGGACTTTAAGGTTTAATATTTTAGGA CTGTTCTTACGATGTTCAATGTGTATCCAGCAGCATCGACTATTTATTCT CTTCGTTTAGGGAATTCAAAGATAAGATCAGACCATTTGCGCAATTCGTT CAACCTCAGCAATGGGAAGAATTGGTTAATAATAGAATCAGTAGGTTACG TTATCTTGAAACACAATTATCTAATCTAAGACCATGCTCGGACGTTACGG TTCCGTGTCGTTCCGAAACGGAACCGGTTTCGAAACAAGTGTGAACATCG AAAAAAAGAAGACGTTACAAAGCAAAACAGATCGAAACGGTTTCGCTCCA CTTTTTTCATCGGAACGGAACTGTTCCGTTTTCTTGCTCCGAAACCCTCC GAAGCCAATATAAACACTCTCGATTCATAACGGAAACCATACCGGAGCGA TACGAAACCGTAACGTCTGAACATGGTCTAAATTTACAAGGAGTCTGGTT CGAGTTCATCACACTCGAATAACGTCAAATGTATCTGTGGCCATGTCAGT GTAAAGAGTTTCTACATTTGACGTCACTTTTCCATAACGCACATCCCTTT GACATGCAGTTTTCGATGCTAGGTGGATCGAAACCGTTCTGAACTATAGA TGAACACATTGAGGTCTTTGATCGATTTTATATTATTATAACAACAGGTG ATTAAAGGTCGCAAAAATGTAATGAAAAATGAAATGAAATGAAAAAGAAA TTTCTTTTTTGATCAAGAGAGAAGAATCGTTAAATAAGATATTTACGTAT CATATCTTCTAGGAAATTTAGTTCAGATCTGTTTCTACATATGAAAAGAA ATGATCACTTAAGTCAAGGAAGAAAACTCATCATAATTTGATGGTATTTT CTTAGGAGAAAGAGAATTAAAAGCACGAATAAAAGAATTGACAAAGTATC GGAGATACGGCATCAAAAAGTTAACTGGTGAGTTTTACGTTTTCTTTGGT GAAAGTTCACTGTGTAATAAGTGGCAAGACAGTGAGTTTGCGCCCCAAAT TCCTAAAATTTATAAACGATGTCAAAAATAACGCTAATGGCTCTACTGTA AGACCTCCAGAAGAAGGGGTACATTACGTCATGCTCATTCTTGACTGGAT ACCGCTAGTAGTGAACTAGGAGCGCCGCTACCCATGGACCATTTGATGCG GTTCAATCGGGCATAGACTATCTACAATCGTGCTCAATAGTTTCTTGGAA TGGCCCTGTAACCATTTCACTTGTGTCATTTGGAGCCTAATTGCATTTTT GAGAACCCCGATGCAAGGATGATGGGTACATGTTTTTTTCATAAGCAAAT GTCTGTCCCTATATCAGGCTCGCATTATGCTTAGTATTCTATTGTTCTCA AACAATAGATCCATTGTTTAGGAACTAAAAACTGAGCCTGTATATGATTA TAAACGTTATGCTTATAAAAGAAAAAATAAGTACTCAACTAATAATCTTC GAAACCTTTAAGCGATGAAAACTCCTCCTAAATCTCCTCCTAAATCTGTC AGTAATTGTTTCAATTCATGTGTTTGTATGAATTTATGTTTCTTTACAGG TTGTCAAGAATATGAAGATTTGAAAACACAACGGGAACGGAAAAAAGAAA ACAGAAAGCGAATGGTCAGTGATGATGATGATAATTTAGAATTTTGTTCG AATCTTTCAATAACTCGAACTAAAACATCGCAAAATGCTCTCTTATAATT CGAATCCCTTTTTAATTCGATCCCTTGATCCCTTGATCTCTTGATCTCTT GATCTCTTGATCTCTTGACCTCTTGACCCCTTGATCTCTTGATCCATTTG ATCTCTTGATCACTTGATCCCTTGATCTCTTGATCACATAGTGTGCAAGG GGGTTCCAGGTCCCACCTTATCCTAAAATTCCCACCTTCAGCCCAGACTC CCAGATTCCAGCTAAAAACAAAAAAAATATACCAATTCGAGGAACAAAAC AAAATTTCTTTACCGTAATATGAAGATGCAATATATTACATATGAAATAT TGATATGTCTATTATATACATTTAAAAAGCAGATATATTAAGGCTCTCAG CTTATGCAAAATAAAAGCAGCTCTATCTATCTAAAAGAAATTTTACTTTA ACTTTTTCCAAAACACCCAAAGTCCCACCTAAAGAAATTAACTCCCACCT TAACTTGTTTCTCCCACCTAAAACCTGGAAAACCCCAAATCCCACCTGAA AATTTTCGTCCCAAATCAGCAAAGCCCCCCCACTATTCTGGGGGGTGCAC ACAATGGATGATCCCTTGATCCCTCGATCCCTTGAAGATTCGACAACGAG ACAACGGTGGAGGTGGTTTCCATACTCCAAACTACATGTAATCTTGAATC TAAAGTATGTACCGGACGGGTTTCTGTGTGTGGGCATCCTGGAAACTTCA TCGGTTGAATTTTGACACACAAGCTGCTTCTTGTGTGAATATGTGGGGGA ATATTTCTATCTTTTTTAAATTTGATTTACAGGACATAGAATTGTTTTAA TGATTTTGACTTAAGGTGAAATGCATTGTTTTCTTCTTGTTCACAGCAAG TTATATCACCTCCTCGTACAACGAAAACATCTGGTAAAAAAGAGTAAGTA CGAATCTACTACTAGACGCTACGGCTTTTTTTGCGCCGTAATGAAAAATA CTGGTTATTGCTGAGGTACTCGCTAGACTCCATTCTCCTTTTACAAAAGA TATTTCTTGTTATGATCGCGTATGCAATGTTTTCTCGAAAAAGATCTCAA TTCAATTCACGTCACGAAATATTCCAAATTCATATGGAGCAAACAAAATA CTCTGAAGAGTTTTAAGTAATTTTGACTACCTATAAGCGATTCATCAAGC ATTTGTGGTGTTTTTAATTGCATAGTTTTATAATATTCTTTTGCATCCAT CTAGGTTTTCATCGGACGATTCGAGAAAGAAAGATGATATAGACAGTAAG TTGCGATATTTGGGTCATTCCTTTTTATATCCATATCCAGAGGGTAACGA ATAAATTTCCACGGGGGGGGGGGGGGGGGGGGAAGAATTTTCAAGGGGAA AAGTTCGTGCGTCCAAGCTCAATTTTAAGGTCTGAAAAAAAAATTTCCAG GGGGGGGGGGGGTCGGGGAAGAATTTTCAAGGGGAAAAGTTCGTGCGTCC AAGCTCAATTTTAAGGTCTGAAAAGAATATTTCAAAGGGCTCTTGTGCAA ATTTAGCATTTTTCCAGAGGGTATCCGCATATTTTTAAGAACCTTTTTTA CCTTGAAAAGGTTCGTCCACCCCCAAATTTCATGGAACAGCCCGTTGCTA CTACATGATAGTATTAGTTTGTATTAAAAATATTGCGTTTCATGTTTTCT TACCATACCCCTTTTTGTCTTAATTTTAGTTGTGTGTCATGCTAGGCTAA GATTGTTCGAAATTTGATTCTTTCCCCCCTTTACAAGCTTGAAAGAAAAA TTGTTGTAATAGTGTTATATTTTTCCGGCTTATGAATTTTCTTCTTTCCC TTTTTCTCTCAGTAGCAACGAAAGAATTTGAAGAATTCAAAGAGAAAATG TCGTCCGATACTTCTTTCCAATTACTGTCCGATAAAGAAAAACATGTAAG TATTAGTGTTAGTGATTCCGATTTATCGAATTCCATGAAAAAAGTGAAAA CTAAAAATTCTCGGCGTTTCGGTGTCTTCTTTACACTATGATCACAAGTA CAGTAAAGAAAATTCAAAATCGAATTTCAATTTATAGACATTCAAAAAAT CATTAAATTAAAAAATTACTATCATTAAATTCCTGTTAGGAACGTCTACC TCTTAAGGGCTCTGGCCATAGTCAAAAAATAGATTTTAGTATTTGAACAT GAAAAATTTTGCTTTAAGTTCTTTAACACTTTTAACAAAGAATTGCCTTT ATAAATTGCTTTTTAATGAAATCCCTTAAGAGTAATTAAGAATTTAATTG CAAAAATGACGTTGTGAACTTTAAAAAGACGTTAATAATATGTTGCATTA CCTTCTTTTATAAAAAGTACTAAGTTTTCAGTAATTAACCTTTTAGTTTC GAAGTTTTTTCAAACTGTCAGCAAAGAATTGAACTGTTTTAAATTTTTCG GAAAACTTTCTAAATTAATGCATCAAAGGTTATGGCTGTTTTTTTATGAA ACATTGGGATAAAAAATTGGTCAAAAAGCACTATTTTCAAGATTTTAAGA CAAATAAGCTTTTAGAAAAATTTTCCAAAAATACATTTTTAGTTCGGTAA AAGATACACCATCTACCGCAAAAAAAATTCAAAATGTTTTTTCTTCGCCG AAAATAAGCTCTTCAAAGTTGAAATACTCTTCTTCACAAAAATGTTCATT TTCTACTTCATCAAATTTTTTCATTGCAATTCTTACATTTTCAGACAGAA AATGTATAACATGCGACAGTTTTGTGTGCTACATCAAGTAGAAATTTATA TTTTTTACGTGGCAAATATTAAGAACTCACTATGGTCAGAGCCCTTAAAA GAACTCGAATTCATTTGAACGAATGGAATACGGACTTCCCGTCAACATTT TAAAAATATGTCGTGCGATGTTGTCTTCTGACATTACATCATAAACCAAC AGCTGATTGGTTGTAAGTGACGTAAAATCAGTCAATATGTCACTTGCAAC CAATCAACTATCGGGATGTGATGTAATGTCAGAAGACATTGCAACAGTGC ATATCATGAAAAGCCTATGTTCAGTTTCCTCTTTCAGCTTTGCGCGACCG TCCAATTACGTTGTTCGCGATACATGACTTTGAAATCTTACCTGCTCAAC GAATACGCCTCTTCTCGTATGAAAATACCTCACAAGACGAAACCGCCACA CTATTTAACGCCCTCGTTAAGGCTCGCCCTACAAGAGTTCTTCATACAAT GTGGTTGGATAAGTGAATAAAGATAATCTTCGATATAAATTGTGTAGTGC TTTCTTTTCTTAAATCACTCGATTTTTTTATTCATGAAAATTCATATATT TATATTTTTGTTTAATAATTTGTAAATTTTTTTATCCATATTATAGCCAA ATACCTTATAACACTAAATCATTTGTTCGATATTCCATTTGTGTACAGGA GACTCCCGGTTATATTCGAAGGTACCTTTCTC
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_045517XLOC_045517Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073361-exon-scaffold_90-1575043694:241780..241827TCONS_00073361-exon-scaffold_90-1575043694:241780..241827Clytia hemisphaericaexon
TCONS_00073361-exon-scaffold_90-1575043694:220541..220632TCONS_00073361-exon-scaffold_90-1575043694:220541..220632Clytia hemisphaericaexon
TCONS_00073361-exon-scaffold_90-1575043694:219882..219941TCONS_00073361-exon-scaffold_90-1575043694:219882..219941Clytia hemisphaericaexon
TCONS_00073361-exon-scaffold_90-1575043694:211680..211774TCONS_00073361-exon-scaffold_90-1575043694:211680..211774Clytia hemisphaericaexon
TCONS_00073361-exon-scaffold_90-1575043694:211088..211128TCONS_00073361-exon-scaffold_90-1575043694:211088..211128Clytia hemisphaericaexon
TCONS_00073361-exon-scaffold_90-1575043694:210562..210612TCONS_00073361-exon-scaffold_90-1575043694:210562..210612Clytia hemisphaericaexon
TCONS_00073361-exon-scaffold_90-1575043694:210024..210074TCONS_00073361-exon-scaffold_90-1575043694:210024..210074Clytia hemisphaericaexon
TCONS_00073361-exon-scaffold_90-1575043694:209124..209227TCONS_00073361-exon-scaffold_90-1575043694:209124..209227Clytia hemisphaericaexon
TCONS_00073361-exon-scaffold_90-1575043694:203905..203977TCONS_00073361-exon-scaffold_90-1575043694:203905..203977Clytia hemisphaericaexon
TCONS_00073361-exon-scaffold_90-1575043694:203393..203456TCONS_00073361-exon-scaffold_90-1575043694:203393..203456Clytia hemisphaericaexon
TCONS_00073361-exon-scaffold_90-1575043694:202122..202168TCONS_00073361-exon-scaffold_90-1575043694:202122..202168Clytia hemisphaericaexon
TCONS_00073361-exon-scaffold_90-1575043694:201354..201384TCONS_00073361-exon-scaffold_90-1575043694:201354..201384Clytia hemisphaericaexon
TCONS_00073361-exon-scaffold_90-1575043694:201088..201167TCONS_00073361-exon-scaffold_90-1575043694:201088..201167Clytia hemisphaericaexon
TCONS_00073361-exon-scaffold_90-1575043694:200301..200372TCONS_00073361-exon-scaffold_90-1575043694:200301..200372Clytia hemisphaericaexon
TCONS_00073361-exon-scaffold_90-1575043694:199614..199678TCONS_00073361-exon-scaffold_90-1575043694:199614..199678Clytia hemisphaericaexon
TCONS_00073361-exon-scaffold_90-1575043694:198635..198681TCONS_00073361-exon-scaffold_90-1575043694:198635..198681Clytia hemisphaericaexon
TCONS_00073361-exon-scaffold_90-1575043694:198283..198323TCONS_00073361-exon-scaffold_90-1575043694:198283..198323Clytia hemisphaericaexon
TCONS_00073361-exon-scaffold_90-1575043694:197633..197712TCONS_00073361-exon-scaffold_90-1575043694:197633..197712Clytia hemisphaericaexon
TCONS_00073361-exon-scaffold_90-1575043694:196096..196490TCONS_00073361-exon-scaffold_90-1575043694:196096..196490Clytia hemisphaericaexon
TCONS_00073361-exon-scaffold_90-1510915933:241780..241827TCONS_00073361-exon-scaffold_90-1510915933:241780..241827Clytia hemisphaericaexon
TCONS_00073361-exon-scaffold_90-1510915933:220541..220632TCONS_00073361-exon-scaffold_90-1510915933:220541..220632Clytia hemisphaericaexon
TCONS_00073361-exon-scaffold_90-1510915933:219882..219941TCONS_00073361-exon-scaffold_90-1510915933:219882..219941Clytia hemisphaericaexon
TCONS_00073361-exon-scaffold_90-1510915933:211680..211774TCONS_00073361-exon-scaffold_90-1510915933:211680..211774Clytia hemisphaericaexon
TCONS_00073361-exon-scaffold_90-1510915933:211088..211128TCONS_00073361-exon-scaffold_90-1510915933:211088..211128Clytia hemisphaericaexon
TCONS_00073361-exon-scaffold_90-1510915933:210562..210612TCONS_00073361-exon-scaffold_90-1510915933:210562..210612Clytia hemisphaericaexon
TCONS_00073361-exon-scaffold_90-1510915933:210024..210074TCONS_00073361-exon-scaffold_90-1510915933:210024..210074Clytia hemisphaericaexon
TCONS_00073361-exon-scaffold_90-1510915933:209124..209227TCONS_00073361-exon-scaffold_90-1510915933:209124..209227Clytia hemisphaericaexon
TCONS_00073361-exon-scaffold_90-1510915933:203905..203977TCONS_00073361-exon-scaffold_90-1510915933:203905..203977Clytia hemisphaericaexon
TCONS_00073361-exon-scaffold_90-1510915933:203393..203456TCONS_00073361-exon-scaffold_90-1510915933:203393..203456Clytia hemisphaericaexon
TCONS_00073361-exon-scaffold_90-1510915933:202122..202168TCONS_00073361-exon-scaffold_90-1510915933:202122..202168Clytia hemisphaericaexon
TCONS_00073361-exon-scaffold_90-1510915933:201354..201384TCONS_00073361-exon-scaffold_90-1510915933:201354..201384Clytia hemisphaericaexon
TCONS_00073361-exon-scaffold_90-1510915933:201088..201167TCONS_00073361-exon-scaffold_90-1510915933:201088..201167Clytia hemisphaericaexon
TCONS_00073361-exon-scaffold_90-1510915933:200301..200372TCONS_00073361-exon-scaffold_90-1510915933:200301..200372Clytia hemisphaericaexon
TCONS_00073361-exon-scaffold_90-1510915933:199614..199678TCONS_00073361-exon-scaffold_90-1510915933:199614..199678Clytia hemisphaericaexon
TCONS_00073361-exon-scaffold_90-1510915933:198635..198681TCONS_00073361-exon-scaffold_90-1510915933:198635..198681Clytia hemisphaericaexon
TCONS_00073361-exon-scaffold_90-1510915933:198283..198323TCONS_00073361-exon-scaffold_90-1510915933:198283..198323Clytia hemisphaericaexon
TCONS_00073361-exon-scaffold_90-1510915933:197633..197712TCONS_00073361-exon-scaffold_90-1510915933:197633..197712Clytia hemisphaericaexon
TCONS_00073361-exon-scaffold_90-1510915933:196096..196490TCONS_00073361-exon-scaffold_90-1510915933:196096..196490Clytia hemisphaericaexon
TCONS_00073361-exon-scaffold_90-1491911889:241780..241827TCONS_00073361-exon-scaffold_90-1491911889:241780..241827Clytia hemisphaericaexon
TCONS_00073361-exon-scaffold_90-1491911889:220541..220632TCONS_00073361-exon-scaffold_90-1491911889:220541..220632Clytia hemisphaericaexon
TCONS_00073361-exon-scaffold_90-1491911889:219882..219941TCONS_00073361-exon-scaffold_90-1491911889:219882..219941Clytia hemisphaericaexon
TCONS_00073361-exon-scaffold_90-1491911889:211680..211774TCONS_00073361-exon-scaffold_90-1491911889:211680..211774Clytia hemisphaericaexon
TCONS_00073361-exon-scaffold_90-1491911889:211088..211128TCONS_00073361-exon-scaffold_90-1491911889:211088..211128Clytia hemisphaericaexon
TCONS_00073361-exon-scaffold_90-1491911889:210562..210612TCONS_00073361-exon-scaffold_90-1491911889:210562..210612Clytia hemisphaericaexon
TCONS_00073361-exon-scaffold_90-1491911889:210024..210074TCONS_00073361-exon-scaffold_90-1491911889:210024..210074Clytia hemisphaericaexon
TCONS_00073361-exon-scaffold_90-1491911889:209124..209227TCONS_00073361-exon-scaffold_90-1491911889:209124..209227Clytia hemisphaericaexon
TCONS_00073361-exon-scaffold_90-1491911889:203905..203977TCONS_00073361-exon-scaffold_90-1491911889:203905..203977Clytia hemisphaericaexon
TCONS_00073361-exon-scaffold_90-1491911889:203393..203456TCONS_00073361-exon-scaffold_90-1491911889:203393..203456Clytia hemisphaericaexon
TCONS_00073361-exon-scaffold_90-1491911889:202122..202168TCONS_00073361-exon-scaffold_90-1491911889:202122..202168Clytia hemisphaericaexon
TCONS_00073361-exon-scaffold_90-1491911889:201354..201384TCONS_00073361-exon-scaffold_90-1491911889:201354..201384Clytia hemisphaericaexon
TCONS_00073361-exon-scaffold_90-1491911889:201088..201167TCONS_00073361-exon-scaffold_90-1491911889:201088..201167Clytia hemisphaericaexon
TCONS_00073361-exon-scaffold_90-1491911889:200301..200372TCONS_00073361-exon-scaffold_90-1491911889:200301..200372Clytia hemisphaericaexon
TCONS_00073361-exon-scaffold_90-1491911889:199614..199678TCONS_00073361-exon-scaffold_90-1491911889:199614..199678Clytia hemisphaericaexon
TCONS_00073361-exon-scaffold_90-1491911889:198635..198681TCONS_00073361-exon-scaffold_90-1491911889:198635..198681Clytia hemisphaericaexon
TCONS_00073361-exon-scaffold_90-1491911889:198283..198323TCONS_00073361-exon-scaffold_90-1491911889:198283..198323Clytia hemisphaericaexon
TCONS_00073361-exon-scaffold_90-1491911889:197633..197712TCONS_00073361-exon-scaffold_90-1491911889:197633..197712Clytia hemisphaericaexon
TCONS_00073361-exon-scaffold_90-1491911889:196096..196490TCONS_00073361-exon-scaffold_90-1491911889:196096..196490Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_90supercontigscaffold_90:196096..241827 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
6.84254 6.86905 1.93631 2.96894 0.790494 1.28607 3.52555 1.17284 3.14423 2.25149 1.38678 6.26265 4.18582 1.28965 2.69355 2.75146 5.13999 4.18928 1.46499 0 1.28038 0 10.5489 6.6079 1.24437 1.23342 1.04416 0.611131 2.55007 6.83388
Blast
BLAST of TCONS_00073361 vs. Swiss-Prot (Human)
Match: TAD2B (Transcriptional adapter 2-beta OS=Homo sapiens GN=TADA2B PE=1 SV=2)

HSP 1 Score: 326.635 bits (836), Expect = 6.402e-106
Identity = 174/436 (39.91%), Postives = 261/436 (59.86%), Query Frame = 3
Query:   51 AKYHCNYCHADCSGLRVSCAECPDFDACIQCFASGAEMGNHKRGHDYHLIDNGTFYL----IVKGWTADEEMLLLDAIEQHGLGNWDDISDHVG-TKSPQEAQDHFEEVYLKKNIGKVTLPKSV-SHIPDHASVEG-QLSPTLLKPMESLDLPVAEQQELGYMMFRDDFEREYDNDAENLIKTLVCSRDDDELETALKLQLADMYWRVLHERSRWKKIARDYGLITS------KHRLIASRRKLSKEDREFKDKIRPFAQFVQPQQWEELVNNRIRERELKARIKELTKYRRYGIKKLTGCQEYEDLKTQRERKKENRKRMQVISPPRTTKTSGXXXXXXXXXXXXXXXXXXXXXXXXXXXMSSDTSFQLLSDKEKHLCATVQLRCSRYMTLKSYLLNEYASSRMKIPHKTKPPHYLTPSLRLALQEFFIQCGWIS 1319
             K +C YC A+ S LR  C EC D + C +CF++GAE+G+H+R H Y L+D G F L       GWT+ EE LLLDAIEQ G GNW+D++ HVG +++PQE  +H+  +Y+  N+GK  +P ++ + + DH    G  LSP+L  P+  LD+ VAEQQ+LGYM  RDD+E EYD DAE LI  L  + DDD++E  LK    DMY R L ER R K IARDY L+ +      K +  A +RK++KE++E + K+RP  QF+  +++++L  N  +E+ L+A+I+EL +YRR GI K+    EYE  + +RE++KEN+     ++  +  K  G                     +     + +   F+LLSD+EK LC+++ L  +RY+T+K+ ++ ++   R  IP K++ P YL   L+  +  F  + GWIS
Sbjct:    5 GKKYCVYCLAEVSPLRFRCTECQDIELCPECFSAGAEIGHHRRYHGYQLVDGGRFTLWGPEAEGGWTSREEQLLLDAIEQFGFGNWEDMAAHVGASRTPQEVMEHYVSMYIHGNLGKACIPDTIPNRVTDHTCPSGGPLSPSLTTPLPPLDISVAEQQQLGYMPLRDDYEIEYDQDAETLISGLSVNYDDDDVEIELKRAHVDMYVRKLKERQRRKNIARDYNLVPAFLGKDKKEKEKALKRKITKEEKELRLKLRPLYQFMSCKEFDDLFENMHKEKMLRAKIRELQRYRRNGITKMEESAEYEAARHKREKRKENKN----LAGSKRGKEDG--------------------KDSEFAAIENLPGFELLSDREKVLCSSLNLSPARYVTVKTIIIKDHLQKRQGIPSKSRLPSYLDKVLKKRILNFLTESGWIS 416          
The following BLAST results are available for this feature:
BLAST of TCONS_00073361 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
TAD2B6.402e-10639.91Transcriptional adapter 2-beta OS=Homo sapiens GN=... [more]
back to top