Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00073356 (transcript) - C. hemisphaerica

Overview
NameTCONS_00073356
Unique NameTCONS_00073356
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length4132

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00073356 ID=TCONS_00073356|Name=TCONS_00073356|organism=Clytia hemisphaerica|type=transcript|length=4132bp
AAGAAACATGCGACTAATTTTGATAGATCGTCACTATTTGTGTTCTgaat
gattgtttaatggtcacgctcacgtagatatcaattatatgtgttaaatg
cataaccaggtaggtccataaaagtatcacttgttttataTGCGTTAATG
AGGTAGGCCACTTTGAACATTACACCTTACTCGCAGTTGACCGAGTCACA
TCATGTTACGGAACTGTTCCGTTTCGTTACACCGATCAGTAAACACTTCT
TATCCATAACAAATACCATACCGGAGCGATAcaaaaccgtaacgtctgaa
tcTGGTCTTAAAATAAAACCATcattttcctttgtttcagaaCATACGCA
ATCGAATACTAGATTTGAATGCACCATTACCACAAGAAAATGATTACGAA
GAAGATGCAAGAAGGAAGACGTTCGTTGTTTCCGGGTCAGATTCCATCCC
TACCGATCCTTCTCATCTGGAAGAGTCCATATCTAATGGAAAAACACCGG
CAGGTTATCGCTTCAGTGTTGGTCAACTTCCATTATGGGCTCAAAAACAG
ATGGGCAACGGTCAAGATGGAAATGGACAGTCTAAAGGTCAATCTCAACC
GATGGGCAGATGGGGACAGGGTGGACTTGGACCTGTCACTGAGCAAGCTC
TGGAAATCCCGCATCGAAAGTTTTCTGAAGATTCTATCGCATCCGCGcAC
AGTGAAAACCCTATTGATGGCGAACCGgaagaagTCATTTATCCTCCTAT
CGAAGAAGACACTGCAATGATGGATCCTGAAAAGACTTTTTACGTCACTG
AATCACGTGGTTCACAATCAGCCAATAAGACGTTCAATCAAAATGGTGAA
ACGATTGATTTAAATGGAACAGAAGACGTTGACACAGAAACGGACCCGGA
AAAAGAGAGCGATATGGACCGACAATCAAGTTCCGATGTTGAAAGTGATA
ACGATGAAGCTTTCTCACCTCTCATGGAACACTTCGAGGAGTTGGCTACA
CCTGCCAAGATTTTATCCGCGTCAAGATCTCGCAGTAGTTCTAGTACGGA
ACCAGTTGAGCCACAGAATGCATTGCAACAGAAATTTGTACCGGGACACC
GTGCGAgtatttcagccaaatttctaTCAAGATCACAAAAATCTTCTTCA
ACAAGGTCGAGTACAAATTCAACAGGAACAGCAGACGAGCAAAGAAAACG
ACTTGAAAATCTTAAAGCTAAGCTCGGTAACCACCCTTCATCAGCATCAC
AAACAACATCTACTAATACCAACAACATAATTCATGAACGCCCACCGCCC
ACTCAAGCCTCTGCACCTAACCTTTCAACCGCCCAACGAGCCGCCAATCG
AAAAGCGTCAATGGATGCTGCAGCGTGTATGTCTCTAAAGAATAAGGCTC
GCAACGTCATCACCAATAAcctaaagaaaacaaagaacatTAGTAAAAGT
TGCGTCAACTTATCTTTCACGCAAGAGCTCGACGACTTAAGAAACTCTAA
AGAGAAATTCAAAAACACGATTCCGAGTACCCCGTCGGCAAGTTCAATCA
ACGATTTATTGACATCTGATCCACGACGTAGTAGCACACCTATGAACAAT
CATAATCGCAAGTGGAACAACAGGCGGACGACTAATGCATGGTCATCTCA
GAAACCACAATCCCCAGTCGGCTCACCGCTCGCTAATCATCAATCGCAAT
CGGTGACTGATTTGTTTCGTAACCCGGCTCCCCTTTCACCTTTATCCAAT
GAACGAAAGACTTTTCCTGAATCCTCACCCGTTAGTGTGAGTACAGAAAA
TGTTGTCCGCCGATCAGGAGCACGAAGAAATCGCTCGCGTCCGCGCTCAA
TGGTAATTGAACCAACCACAGTGCGAGACAAGCGCAGTGAGATTCGCATC
AGCCGCGCGGACTCATTACGCACGCCTTCCCAATCGCATTCCGATACAGA
AATAGAGGAAAGTACAATTGAGAATTCAGTTTTTAATTCAATCACTAAAA
CACAATCAGTCGTTACATCACCAACACGCCCAACACAAATTCCTGAAATG
CCCGTTACCGCCCATATTTCTGAAACGACCGTCGCCGCTCTTATTTCAAC
GCCCACCAAAGACGGTAAGCGTGAAATTGACATCGATGAACAATTACTGA
GCGAAAGCGAAGCGGAACGCGTCCGACGTATCGCACAACAGATCAACGAC
AATGTACGACACTTGCAACAACAGAACAGTTTGAACGGCAGTCGTGAGAA
TATTGAGGAAGACGAGTTACGAGATACTAAAGAATTGATACGACTTTATG
AGACGGGTTTGATAGGAACACACGGAAAATTGATCAGCTGTTCGCCTCCA
GAGCGTGACGTACCAAGCTCTACTAGCGAACAACAGAATTcttcaaagat
tgaagaaaaagatGAAGACACGCACAAAGAAACTGAAAACCATCAAGATG
AAGATCATTTGCAAAGTGATCATGAACAAGCAACATGTGATAATGTCGGC
AATGTGACTTTGGAAGAATGTAAACAAAGTATGGACCGGTTGGTTGAATC
GTTTAGAAATGCTTCTGAAATTGAGAAAAGATTACTGAAGCAGCCAACTT
CAGATCAACAAAGAGAATTGCTTACTGTGATCAACAAGACGTACCAAAGC
CTCCAAGAAACACTCACTGAACGCACCTCAAGGCTTCAACAATATGATGA
CATCACGAAAAACAATTTACACGTGCTTAATTCGGATACTTTTAAACAGT
TCCAGGATTCTATTGCAAAAACGCAGACGACGCCAGAGGTCTCGGAACAA
GCTACTAGTGTTGACGTCATAAATATGTTAGATAAGTATTCGAATGTTCT
TGTTGACATGATAAGCTCTAAAATCAGGACCAAAGATTCGCTGACCGAGT
GATGAAAAATTTTATACATGTGAATAGTTTATTCATGCCTATGATTATGG
CATTCAAATTAGCTCTAATTTTCGAGAATCTGGTGACGACTTTATCATAC
TTGGGATCTGGGATCTAGtgtttaaacaaaaattatttgatgCTGGTTAG
CCACCGAATTTAGTAGTTGTACGTTAAAAAATCCACGAAATGATCATTGT
TATGCATTGTACCGTTACTTGAATATGCATGAAGTTGATTGTAGagattt
ttaatcaattttttgttgtttaattttttgtcttctttttgTTTGTGTTG
ATTTCAATCATCTTTTGTGAAAAGTTTTTCTagtcattttcagattttgt
caCATTCACATCATTTTCGAGTTTTATAGATCAATATTTACTTGATGTGT
CAGAAAATATTCCCAAAagtaatagtagggggaaatttgtaaaatcgctc
gaatttttttagtcaaagcacttgttatacatttttggaaagctaaggga
taggggaatcaaaataacttgggtgccaattttttttcggacactttggt
gtgattttcggacaaatacgacggtctcaggcaaaaaccatagggtgaaa
aattaatgaaaattttggtttgagaaaacggagacctgttgtatattttt
ggaaagctctcaaaaaattaagattaatgATATATTgtgagtataggtga
tttcagtacctaactcgaggtattgagcttccgaaagcgcaaaaactgga
caaaacatcTGTTTCTGgttgaaaaacactgaaaaacactgtttttaagg
attaatatctcgagttaggtaaagaaatcacctatactcgcaatatatca
ctaagtataacaagtgctttgactaaaaaaatcgagcgacctcaaaaaaa
cgaacaaattcccCCCTACTATAAACGAGAGGGATTTAAAAATTCCATTG
TTAACAACTGAGGTTTGTTTGCTTGTAATTGGCATCCTAAAGGAAGGCTG
ATTCATCATCTGTGGCTAtaatgagaaaattaaaaactttagtTTATTTC
GCGTTTAGAGATTTTACATATACAAACATatataaaattgagaaaaatat
tatgaaaacagaaaatatttttttgaacgTTATAATTTTTGTAGGaatag
tatttttgtccatcgaaaaaaaaattgtaccgaaaattaagaaaagaaaa
tcgggttttatagaattatatttattttgaag
Run BLAST on NCBI

protein sequence of Putative cnidarian restricted protein

>TCONS_00073356-protein ID=TCONS_00073356-protein|Name=Putative cnidarian restricted protein|organism=Clytia hemisphaerica|type=polypeptide|length=783bp
MGNGQDGNGQSKGQSQPMGRWGQGGLGPVTEQALEIPHRKFSEDSIASAH
SENPIDGEPEEVIYPPIEEDTAMMDPEKTFYVTESRGSQSANKTFNQNGE
TIDLNGTEDVDTETDPEKESDMDRQSSSDVESDNDEAFSPLMEHFEELAT
PAKILSASRSRSSSSTEPVEPQNALQQKFVPGHRASISAKFLSRSQKSSS
TRSSTNSTGTADEQRKRLENLKAKLGNHPSSASQTTSTNTNNIIHERPPP
TQASAPNLSTAQRAANRKASMDAAACMSLKNKARNVITNNLKKTKNISKS
CVNLSFTQELDDLRNSKEKFKNTIPSTPSASSINDLLTSDPRRSSTPMNN
HNRKWNNRRTTNAWSSQKPQSPVGSPLANHQSQSVTDLFRNPAPLSPLSN
ERKTFPESSPVSVSTENVVRRSGARRNRSRPRSMVIEPTTVRDKRSEIRI
SRADSLRTPSQSHSDTEIEESTIENSVFNSITKTQSVVTSPTRPTQIPEM
PVTAHISETTVAALISTPTKDGKREIDIDEQLLSESEAERVRRIAQQIND
NVRHLQQQNSLNGSRENIEEDELRDTKELIRLYETGLIGTHGKLISCSPP
ERDVPSSTSEQQNSSKIEEKDEDTHKETENHQDEDHLQSDHEQATCDNVG
NVTLEECKQSMDRLVESFRNASEIEKRLLKQPTSDQQRELLTVINKTYQS
LQETLTERTSRLQQYDDITKNNLHVLNSDTFKQFQDSIAKTQTTPEVSEQ
ATSVDVINMLDKYSNVLVDMISSKIRTKDSLTE
Run BLAST on NCBI

transcript from alignment at scaffold_90:124668..137455-

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00073356 ID=TCONS_00073356|Name=TCONS_00073356|organism=Clytia hemisphaerica|type=transcript|length=12788bp|location=Sequence derived from alignment at scaffold_90:124668..137455- (Clytia hemisphaerica)
AAGAAACATGCGACTAATTTTGATAGATCGTCACTATTTGTGTTCTGAAT GATTGTTTAATGGTCACGCTCACGTAGATATCAATTATATGTGTTAAATG CATAACCAGGTAGGTCCATAAAAGTATCACTTGTTTTATATGCGTTAATG AGGTAGGCCACTTTGAACATTACACCTTACTCGCAGTTGACCGAGTCACA TCATGTTACGGAACTGTTCCGTTTCGTTACACCGATCAGTAAACACTTCT TATCCATAACAAATACCATACCGGAGCGATACAAAACCGTAACGTCTGAA TCTGGTCTTAAAATAAAACCATCATTTTCCTTTGTTTCAGAACATACGCA ATCGAATACTAGATTTGAATGCACCATTACCACAAGAAAATGATTACGAA GAGTAAGGACTCCAGATTTTTTAATTTGACCAATGAATGGAAATTTTAAA ATTAAGATCTTGTTATTAGACAATTTTTGCTAACCACCGAGTTTCCCAAA TTGCTTTTTTTCCATTGATTATTCAGCATTCTTTTAACTAGTCCAGCATG CTAAACCCGGGGGGGTACTAGGGTTGCGAGCTGACGGGTATGTACCGCCC GACTTTAGACCCTCGGACCCTTAGCGGAACTAAAAAGGAGAAAAAATATT AAAATTTTGCCTACTTGCTTGAGTACCCCCCCCCCGGATGCTAGACGACT AATTCAGACCGTTATTATTCCGTAACAATTATCTTATTGCCATCTAACCT ATATCACACGGATTATAAACGACTCAATCTGTCCTCTGATAAAATCGGTA CTAATTTATATTGAGCCCTAAATCTTGTAAATAAACATGTTTTTCTGTTA TCTACCTTACAGAGATGCAAGAAGGAAGACGTTCGTTGTTTCCGGGTCAG ATTCCATCCCTACCGATCCTTCTCATCTGGAAGAGTGTACGTAATTTTTT TTTTTATTAGAAAAAGAGAATCCATGATATGCACCACTCCAATGTCTTCA ACATCACGCCATTAAACCAACAGCTAATTGGTTGAAAGTGACGTAAAATC AGTCAATACGTCACCTGCAACCAATCAGCTGTTGGGTCCATGGTGTAATG TTAGAAGACATTGCAATGGTGCATATCATGAATAGAAGAATATGGAAATA GATAGGTTTGCATTATGGTGATTCGATTCACTTTCCTTGCTTCACAAAGT GAATTTTAAATTCATGATATGCACCACTGGGGAGTCTTCCGATAAATTTT CCACCCAATACGTCACTTAAACAATAGAAAAAAAGGAAAGAACGCGAGAT AATAAAGCAATGGCATCATAAAGCAAAAGAAAAAACATCGAAAGAAAATG AGAAGAGTCATATATGGAAAGTGAGAGGTAGTCCTAGGACTAAACTCTTT TTAAAGAAATTTACGACGGAAATAACATCATGATTGTAAGAAGAGTGGGT CAGAGGCCCAGTAACTGTAAAACTCTATAATAGAATTGACAAACTAATGG AATGATAAGATCCATAAATTGTAAAGATGTAAGATTGTTTCATAGAGGTC AATAGACCTGAGAAATACACTTCTATGAATTAAGATTAAAAAGTGACGTA TTGGGTGGAACAAAAACAGAAAAGTTGTATAATTTCGTGAAGTCATTGCA GTGGTGCATATCATGAATTGATACAATTTACCTGGAGAACTCGTCGGAAA GATCTTTACGTTTAAAGAGATTATTATTACTTCTTTTCCAATAGCCATAT CTAATGGAAAAACACCGGCAGGTTATCGCTTCAGTGTTGGTCAACTTCCA TTATGGGCTCAAAAACAGGTAAGATTTTGCTTTCGTTTCGTTTCAACGTT GAATTATTAGGTATCAAAAATTATCGGAGTACATTAAATTTAGGAATCAG GGCTAATAAAATAATGCCTTTTTTGAACCGTTTTATGATTGGGTTGCTCA AACAAAACCTTTAAATTTCTGAATTTGATTCTATTGAACGTTGTAGATGG GCAACGGTCAAGATGGAAATGGACAGTCTAAAGGTCAATCTCAACCGATG GGCAGATGGGGACAGGTAAGGCATTATGATGTGATGAACATATTTTGTTC TGTTAAACACAGACCCAATATATATCAATCTTAGAATGAAGAAGATATAC GGAGAAGGAAGAATTTAGGTTGCTTTTGAATTAACACGACTTAAACTCGA TCGGGACTGATATTCCCATATTTTTTATTGCTGGGGATTAATTACCTTCT TTTGTCAGAAAATTCACTGGAATGAGAAAATAGCACAATATTTTGCAGTG AGGATTAGTTTATTTGATTATTTTCAGGGACAAAATTGGAGGGTAATTTC CCATGCCACCGGGGACGATAATTTTGCCGATTTTTTCAGTGGGAAGGGTT TCCAGTCGGTCTGTGAGAAGGGGGTGTTTTTAAAATTTATGACCAAAAAC TCTCAAACTTTTCCTTGTAGTAGCAGATCTTGAATTAGCTTTCACCTCGA CTACCTTATTACACGAATATTTTACCATGCAAGTATTCAACAGCCTTGAA ATCAACACGCATAAAATTAACACGCATAAAATTAACACGAATTTTATTTC CTTTTTCAAGGATTTTCAAGGCTGGTTTTAATTAAGGGGGTTTTTATTAA CGGGAAATTTTTCCATTCGTGTTAATAAAATGACTAGTAATATTCGTGTA ATAAGGTACTTGTTTTTCCCATGCAGTTTTAAATATGAGGCGAAATTTTC GACTTAAAGTCGTCTTGTTTGTTTTTCGAAGGTGTTTTTAAGTATTAAAA CACATGATCGCTCTCACGATGTTATATTTTACGTTACATAAAAAAGGCTA GAAAAAAAACTAAAAAAACATTTAGAAATCTGTTATGGGAATATTGTGAT TGTGAATATTGTAAATCCCCGAAAAAACTGGTAAATTTACCAAAAGAGAG TCATCTACAACCTGTATCTTAGCGTTCAAAAGAAGCTCTAGAAAATATTT CTTCACTCATTTACTTTGCTGCTCTTATGAGTCTGGACCTTAAAACCTGT CTGGAAACAACTGTTGTTTTTGGCCTTGTTTTATAAAGAAGACTCGCTCT GCTACAAATTCTAACTCTAATTATAATCGATAACAAACTTCTTCTTAAAA GGGTGGACTTGGACCTGTCACTGAGCAAGCTCTGGAAATCCCGCATCGAA AGTTTTCTGAAGATTCTATCGCATCCGCGGTATGTACCTTACTCTTTTTT TAAATCGGTAATCCAGAAGACCTCGATTTTTTTCTTCTTGCTGTAGCCCA AAGCTGTTGGTTTTTTGTAATGTCATCACGATTAACTAGGCTTTTTATCA TCCATCAAACTTTTTTACAATGATAAANAGGATTAACTAGGCTTTTTATC ATCCATCAAACTTTTTTACAATGATAAATGATGGTTCATCTCTTTTTTCA TCATTTTCAGCACAGTGAAAACCCTATTGATGGCGAACCGGTATGTCCAC AATTATATCGATACCCAGTTAGCACACAACGTTGTTTCAACGTTCATCTA ACGTTATATGGACGTTGTGAACGTTAGATAAACGTCGAAAAACGTTGTGT GCCAGCTCGATATTCCTCCCAACTATTACAGTTTTAATATTTTCCCGAGC CTAAAGTCTGTCTCAATATAATCTGCAACGAATAGAAAAATGGCCATAAC TTTCGATATCAGTTTAAAATGTCACTCTATCTTGATCGCAAATCGAAACA AAATGGGTTTTTTTTTAAAGGAAGAAGTCATTTATCCTCCTATCGAAGAA GACACTGCAATGATGGATCCTGAAAAGTAACATCGTCTTTGTTCTGTTTT GTCTTGGCCTTTTATTCTTTTATGCGCATATATCGACCTTCAGATTTATT GATTGATGTAAGAGAAAACAAACTAAGCTCTTAGATATCCTTTCATCGCA AGAAGCATAGCTTGGATAGATTTTTTTGGCAATGGATTTTTTACTACTTG ACTGTCTATGAACTGAAAGGGAAATTAAGAGAGTTTCAACTCGAGCTACA ATCATGGTCGTAATATTTGAGAAAAAAGCGAAATCCATCGGGAAGTTTTG AAACCACGATCGATTTGTAAGTGCTCTAAAGTAGTTTGGAAGGGTAGAGT TTTAACATGAGACTCGAGACTTAAGAGGATCCAAAAGTTCAAAAATGGTC CAATAAGGCTCATAATATAGCCTAGAGGTCTATAAACCCGAGCCAAATTG AAATATCCGATTAAATTTGAGAGATGGCCCAAAATCGACTTTCTCGCCCG TACTCCAAATTTCGAAAACCGAGGAAATAAGCTTAATTCTCAATAGATTT CGACCATGATTGTAATATTGCCAGTTTGAAACACTGATCATTTAGTAGTG TCTTTTTAACTTTAAATCTCTATGACTCGACGTCTCAAGTTCTAACAATG CCTTATAATCATAGTTATTTCAATCCATTTTCAGGACTTTTTACGTCACT GAATCACGTGGTTCACAATCAGCCAATAAGACGTTCAATCAAGTAAGTCA CGATTTATTAGATTCGGGCGGTGGGTTGTCCAAGTTTCTTTTACGAGGCT TAAAGTTTTCGAACTGCAATGTTTTAACATTTCGAATTCTAGTGTGTTAA TTTCAAACCTTTGTCAAATATCTGAGAGTTTCAAGCTTTTATTAGATTTC GCACTAAAATTTGTCTAATTTTGAGGTAAAGTTGTAAAGGAGACACGGAA AAGCAAAGGCCCAGTAGATCATTTCATCTTTTTATCAGCTCTTTTTTATT CATTTGTTTTAGAATGGTGAAACGATTGATTTAAATGGAACAGGTAATTG GCTGAATGTTAACATTTGTAAATACATAGTCAATTCTCTCTATTTCGAAC CTCCATAACTCGAATGTTTCTATAATTCGAACTAAAACATTGGTCCCCTC AGTTGGAAGGTAGTGTTAAATTCTCTCTGCAATATGAATCTTCCCTAATT CGAAGAAATTTCTTGGTCCCTTGAAGATCGAATTGGCAAAAATAAGCTGT ACAGCACCTCAAAAATTGATGACTTGCCCATTTTATGAATTGGTATCTAC CAAAAAGTTAGCTATCAGATTGCCCTTTTCAGTGGTTACACAAGGTGTAC TGCTTCATAAATTAGTTAGACTTTCCTTAATCTCGTAGTTATCCTTTTTT TTCTCATATAGAAGACGTTGACACAGAAACGGACCCGGAAAAAGAGAGCG ATATGGACCGACAATCAAGTTCCGATGTTGAAAGTGATAACGATGAAGCT TTCTCACCTCTCATGGAACACTTCGAGGAGTTGGCTACACCTGCCAAGAT TTTATCCGCGTCAAGATCTCGCAGTAGTTCTAGTACGGAACCAGTTGAGC CACAGAATGCATTGCAACAGAAATTTGTACCGGGACACCGTGCGAGTATT TCAGCCAAATTTCTATCAAGATCACAAAAATCTTCTTCAACAAGGTATGT ATGCAGCTATTTTCCGAACGCAAACCAGTGTGCTAAGTAAGAACCACAGA AGCCGACCGACTCTTCTCTAAACTTGTCGACTTTTATTGTTATTTCGACG AAGAGAAATTTTTTTTCAAAATTTACAAAATGTAGACGAAAATTCCATGA ATGACCAAAATAAAAAAAATTTCGGACCGATCGACCCACCTCCAAAATCT AGCGTCGGGTGACGGCAAACCAAGAACTTTTTAAGTCCAGCCTCATTTGT TATTAGAGAATTTCTAACGAAAATAAACACGGTGATATCGATTCATACGT TCATACGCGTACATACAATTAACACTCGCCGATTTGAACTCGAGCGGGGA ATATATTTGTTCAAGCTACATACAAATTCGATCTAGAGAAAGTACCTTTA TAGAAAGAGTTTCTTCTTGACAGGGAATGGAAACAAGTTATAGAAAGATT CGAATAATAGAAGTTCGAATAAGCGAGAGTTTACTGTAAAATGTTTGTTC CCTTGAAGATTGAATTAGAGAGAATCAACTGCTAACAGTACATGTCATCT TCATCCAAATATTACAGTACAAATAATGCATTGCGCTCAATATCCGAAAC GTAAACTTTATCCGTACCATCAACCACAACACCGTACGGTTGTTTGAAAG TAATTTCACGACCATGACTGTCCGTGATTCCCGACACGCGTGTCGTCGTG TTCGTGTGAAGATCAATGATCAATAGTTGAGCGTTCTCACGATCGGTGAC TAAGATACTTTACTTAGATATGAAATAACATTTCCGTTCTAAAAGAAATA TGATTTGGATAAAATTGTAAAAGAATGTGCTATTATTGAACAGATTCTTT TTGACAATTACAACCCTTGTTAGATTGAAGAAATCCTAAAATGAAAAAAA TTTGCCTTTTGATTAATTATAGTACACGAATTTTATTATTTTCCCAAATT TAAAGAGTCTTTTTCATTCTCTTTCATTTTTCTCACCCCTTAAAGAATTT TCAGCTCAACCTTTCTTGCAACTCCAAAAAAAGTGGATTAACTAACAACG CTTTTCAATTCACAAAGGTCAGAGAATTCCACGTAGACGTGGGACATTAT GCCCATCTGAGGCATCCCTTCATCAGTGTAGGAATCAAAAAGTTTGCAAT AGAAAATTTCTAAAGATACAGATCAAAAATAACAACAGAAAAAAGGGGAG TAGTGTTTGAAAAATAATCTGCTGTGATTTTCACGACAATCTTATCTTAC TTTCCTTTTTCTTTTGTTGTTATGATTTTTGTGAGAGATTTGTATGAGAA TAAATAGTGCTTTGAATACTAATAAAAACATCTTCGTGAAGCATCAGTTG GGTTTAAAGTTTTAGAGTAAGAAATTCAAAGAATTTCTGTCTATCTTCTA TCGGGAGAGATGGCAGAGTATCATATACATTTTATCCTAGTTTGGACCAA GAGTCGCGCCAGAAAACATTTTTTCTTCAATTATTTATCCAATTTTCCCG TTCCTTTTTGTTACTGTTCTTGTTCTGATCATAGTGGCCCTTCATGGAAA CAATTCTTGAGCTGTCTAAAAGCTCAAGGATTTTTCGGAGCCAGCCACTT GAAACATTCTTTATTATTATCATTATTACTATTATTTATCCTGCACCCTG ACTAGATTGTATATAGTTTATTGTAGTAACGAACAAAAAAGTAAAATCAA CGTGTTTTACTATTATATAGTAGGTAAATAGAAGTTTGTTTCAAGTTTGT CTTCTACTTACTCCGGCTATTCACATATTATTTGAAATGATTTTTACTGT AAACGTTCGTCTATTAAAAGGTTAAATACCAGGATTTTAAATACGAGGTA CTTTGACCCTAAAGTTTTTCTAATCAAAGTTTTTGCTTTTTCAACGGTTA AAAGGCACATAATTTTTTATACCAAAAATTCTATCGTTTTTAGGTCGAGT ACAAATTCAACAGGAACAGCAGACGAGCAAAGAAAACGACTTGAAAATGT AAGTCACTCAATTTTGAACAGTCATAAAACTTATTTATTGCATTTGCCCA TTTAACGTAAGATCACAGTTGACAGATAGGCTCCCTTATTCGATGAAAAT CCAATTCCCCTTGAAGATCGAATTAGAGAGCATCAACTGTATAATTTTGT TTACCTAAGCTCTTGCACTTCAATATCGCTGTAAGAATTGAGACCCCTTC TAGCATGAATTTAAATCGTCTTATTCATACTTTGGTGTACAACAAATTTT GATAAAATCTGTTAATCTGTGGCGTACAATATTTGCATGAAGAAATAAAT ATTCATGCATGGTTTGCACTAACTCCAGGCGAGACTTTTCTTGCATAATT ATACACTAAGTTAATCATTGCTTAATTACATGTTAGTAACAGATCTTCCT TGCTCTTATCAACACTAAGTGTATTTGCACCCTTAAGTCTAAACCTTAAT TTCCACTACCTCACCATATGCAGCTTAAAGCTAAGCTCGGTAACCACCCT TCATCAGCATCACAAACAACATCTACTAATACCAACAACATAATTCATGA ACGCCCACCGCCCACTCAAGCCTCTGCACCTAACCTTTCAACCGCCCAAC GAGCCGCCAATCGAAAAGCGTCAATGGATGCTGCAGCGTGTATGTCTCTA AAGAATAAGGTATTGTATACACAATAAGCACCAAGCCATATTTCAAATAT GGTAACATCCGCGAATTCCCTTTTCTCTAATTTTCTTTGGTTAAAGGTTT TGTAATATTGTTTGCTAACTCGTCACTTTTAATTTACAAGCTTTTTCACA TTGGATTGACACGGATGTGGGGCAAGATTGGTCAGAAGGAGGAAAAGAAA AACATTTTTTGTGTCCCGATATGAAATATATGTGTCTGATATGAAACGGG AACACTTATGTAAAAATAAAACCCTTAAACTTTATTTGTTAATAAGTAAC TTAATATTGACTAACACATAATAGTATAATAGATATAGGGTATTTTTTTC AATAACTCGGTTAACTTTAGTGGAGTCTCTATAACTCGAACCCGCGCNCT TTATCACCAAATTCATATACAGTGGAGTCTCTATAACTCGAACCTGCAAG AGGAACACAAATTTGTTCGAGTTAAGGAAATTTGAATTTTGGAGTAAGGT TTATAAGACATTTTTAACCGAAGGGATTATAAAACTTTCTTGAATTTAGG AGACATTCGAGTTATAGAGGTTCCAGTTATACAGACTCCACTGTAATATC AAAACCTTTTTTTTCACGTTTTTCAAGGCTCGCAACGTCATCACCAATAA CCTAAAGAAAACAAAGAACATTAGTAAAAGTTGCGTCAACTTATCTTTCA CGCAAGAGCTCGACGACTTAAGAAACTCTAAAGAGAAATTCAAAAACACG ATTCCGAGTACCCCGTCGGCAAGTTCAATCAACGATTTATTGACATCTGA TCCACGACGTAGTAGCACACCTATGAACAATCATAATCGCAAGTGGAACA ACAGGCGGACGACTAATGCATGGTCATCTCAGAAACCACAATCCCCAGTC GGCTCACCGCTCGCTAATCATCAATCGCAATCGGTGACTGATTTGTTTCG TAACCCGGCTCCCCTTTCACCTTTATCCAATGAACGAAAGACTTTTCCTG AATCCTCACCCGTTAGTGTGAGTACAGAAAATGTTGTCCGCCGATCAGGA GCACGAAGAAATCGCTCGCGTCCGCGCTCAATGGTAATTGAACCAACCAC AGTGCGAGACAAGCGCAGTGAGATTCGCATCAGCCGCGCGGACTCATTAC GCACGCCTTCCCAATCGCATTCCGATACAGAAATAGAGGAAAGTACAATT GAGAATTCAGTTTTTAATTCAATCACTAAAACACAATCAGTCGTTACATC ACCAACACGCCCAACACAAATTCCTGAAATGCCCGTTACCGCCCATATTT CTGAAACGACCGTCGCCGCTCTTATTTCAACGCCCACCAAAGACGGTAAG CGTGAAATTGACATCGATGAACAATTACTGAGCGAAAGCGAAGCGGAACG CGTCCGACGTATCGCACAACAGATCAACGACAATGTACGACACTTGCAAC AACAGAACAGTTTGAACGGCAGTCGTGAGAATATTGAGGAAGACGAGTTA CGAGATACTAAAGAATTGATACGACTTTATGAGACGGGTTTGATAGGAAC ACACGGAAAATTGATCAGCTGTTCGCCTCCAGAGCGTGACGTACCAAGCT CTACTAGCGAACAACAGGTAAGTAACTCCCATTGAGTAACAAGTAACCCT TTTGCATTTCGTTTTTCTCTTTTAACCCCAAAACAGGGGACTTTTCATTT CCTCCTGGAAACATAGTAAAGGAGTTTGACATGAAATTTTGTGTTTACGT CACCCGTATTTTTTATGCACGTAATTAACAAGAAACAACATGACATTTCC CGTCATTTGGTTGTTAGTGAGGTACTCGCTATGTTTGCTCGTGGAGATTG ATATCCTCATGCTAGCCACCTGAATAACTCGCCATAACTTAATTTCATAC AATGTGACCGATCAGAAATCAGAATTTAAATTTCCCACTGTTTCTTTTAG AATTCTTCAAAGATTGAAGAAAAAGATGAAGACACGCACAAAGAAACTGA AAACCATCAAGATGAAGATCATTTGCAAAGTGATCATGAACAAGCAACAT GTGATAATGTCGGCAATGGTACGTTATATCAATTTCAGTTTCAAACAACA TTATTTTCATGCGAGGCATAGTCCAACTAAAGAATAGTATAGAAAAGATT ACAGATGGAGGCCATAAAATGGGCTCTTTCCAGAACACGTTCCTATAGGG GGTGGAGGATATAGTGTCCTGGGGGTAGTGAAAAAAAATCTACAAAACTT GCTTTGTCCTGGGTGTAAACTTTCTTTGTTTGGGGGTAATTTTGCTCTGT TTTAGGGTAATTTTGAATGTCCAGGGGGTCAACTGATGCCTGTCCGGGGT TTGGGTCTGCTGTCCGGGTTGGGGGGTCAAAAGTCACAATGTCCAGGGGT AATTTTCATATTCTAATCTTTTCTGGAAAAGCCGATTCCAGAATTACGCT TAACTTTTAAAGACCTCCATTAAGACGAATTTACGTTCTGTGTTTTCTTT CAGTGACTTTGGAAGAATGTAAACAAAGTATGGACCGGTTGGTTGAATCG TTTAGAAATGCTTCTGAAATTGAGAAAAGAGTAAGTAAAGATTTTTTAAC CATTTAAGATATTATTTGCTCGGGGGTTTCCCACATGCTATATCAATTGT TGACGTTTCAACTCAAGCTCTTCTCCAACCACAGGAATCAAGCCAATACG TACTGACGAGTGCCATTATATGATGGTCTATAAAATATGACCTTACGAGA AGAAATGCTGATCATGTTTTAGACTTAGTCGAGCAAAAACTAGATCCAAT AAATTTGAGAAACCATCGCAATTACTTAGAGAAGGTAATTTTGGCGAGTA TGGGCTAATTCGCCAATTTTAGTGCAATGTGGCGAAATTTATTTTGCTTA ATCAAGAAAAATTTTCAAATTTGGCAAGTGACTGAAAAAATCTAAATTCA GATGGAATTACTTTTGGCGAATTTTTAAGGCAATTCGCCAAAATCGTTAA AATTTCTTCTCGCCAAAATGTTTCCCCCTTAAGTTGTGAAATTTTTAGGA TTTGACCTAATTTAACCATCTTCTCCTTATATTTCAGTTACTGAAGCAGC CAACTTCAGATCAACAAAGAGAATTGCTTACTGTGATCAACAAGACGTAC CAAAGCCTCCAAGAAACACTCACTGAACGCACCTCAAGGCTTCAACAATA TGATGACATCACGAAAAACAATTTACACGTGCTTAATTCGGATACTTTTA AACAGTTCCAGGATTCTATTGCAAAAACGCAGACGACGCCAGAGGTCTCG GAACAAGCTACTAGTGTTGACGTCATAAATATGTTAGATAAGTATTCGAA TGTTCTTGTTGACATGATAAGCTCTAAAATCAGGACCAAAGATTCGCTGA CCGAGTGATGAAAAATTTTATACATGTGAATAGTTTATTCATGCCTATGA TTATGGCATTCAAATTAGCTCTAATTTTCGAGAATCTGGTGACGACTTTA TCATACTTGGGATCTGGGATCTAGTGTTTAAACAAAAATTATTTGATGCT GGTTAGCCACCGAATTTAGTAGTTGTACGTTAAAAAATCCACGAAATGAT CATTGTTATGCATTGTACCGTTACTTGAATATGCATGAAGTTGATTGTAG AGATTTTTAATCAATTTTTTGTTGTTTAATTTTTTGTCTTCTTTTTGTTT GTGTTGATTTCAATCATCTTTTGTGAAAAGTTTTTCTAGTCATTTTCAGA TTTTGTCACATTCACATCATTTTCGAGTTTTATAGATCAATATTTACTTG ATGTGTCAGAAAATATTCCCAAAAGTAATAGTAGGGGGAAATTTGTAAAA TCGCTCGAATTTTTTTAGTCAAAGCACTTGTTATACATTTTTGGAAAGCT AAGGGATAGGGGAATCAAAATAACTTGGGTGCCAATTTTTTTTCGGACAC TTTGGTGTGATTTTCGGACAAATACGACGGTCTCAGGCAAAAACCATAGG GTGAAAAATTAATGAAAATTTTGGTTTGAGAAAACGGAGACCTGTTGTAT ATTTTTGGAAAGCTCTCAAAAAATTAAGATTAATGATATATTGTGAGTAT AGGTGATTTCAGTACCTAACTCGAGGTATTGAGCTTCCGAAAGCGCAAAA ACTGGACAAAACATCTGTTTCTGGTTGAAAAACACTGAAAAACACTGTTT TTAAGGATTAATATCTCGAGTTAGGTAAAGAAATCACCTATACTCGCAAT ATATCACTAAGTATAACAAGTGCTTTGACTAAAAAAATCGAGCGACCTCA AAAAAACGAACAAATTCCCCCCTACTATAAACGAGAGGGATTTAAAAATT CCATTGTTAACAACTGAGGTTTGTTTGCTTGTAATTGGCATCCTAAAGGA AGGCTGATTCATCATCTGTGGCTATAATGAGAAAATTAAAAACTTTAGTT TATTTCGCGTTTAGAGATTTTACATATACAAACATATATAAAATTGAGAA AAATATTATGAAAACAGAAAATATTTTTTTGAACGTTATAATTTTTGTAG GAATAGTATTTTTGTCCATCGAAAAAAAAATTGTACCGAAAATTAAGAAA AGAAAATCGGGTTTTATAGAATTATATTTATTTTGAAG

Coding sequence (CDS) from alignment at scaffold_90:124668..137455-

>TCONS_00073356 ID=TCONS_00073356|Name=TCONS_00073356|organism=Clytia hemisphaerica|type=CDS|length=30576bp|location=Sequence derived from alignment at scaffold_90:124668..137455- (Clytia hemisphaerica)
TTACTGAAGCAGCCAACTTCAGATCAACAAAGAGAATTGCTTACTGTGAT
CAACAAGACGTACCAAAGCCTCCAAGAAACACTCACTGAACGCACCTCAA
GGCTTCAACAATATGATGACATCACGAAAAACAATTTACACGTGCTTAAT
TCGGATACTTTTAAACAGTTCCAGGATTCTATTGCAAAAACGCAGACGAC
GCCAGAGGTCTCGGAACAAGCTACTAGTGTTGACGTCATAAATATGTTAG
ATAAGTATTCGAATGTTCTTGTTGACATGATAAGCTCTAAAATCAGGACC
AAAGATTCGCTGACCGAGTGATGACTTTGGAAGAATGTAAACAAAGTATG
GACCGGTTGGTTGAATCGTTTAGAAATGCTTCTGAAATTGAGAAAAGAAA
TTCTTCAAAGATTGAAGAAAAAGATGAAGACACGCACAAAGAAACTGAAA
ACCATCAAGATGAAGATCATTTGCAAAGTGATCATGAACAAGCAACATGT
GATAATGTCGGCAATGGCTCGCAACGTCATCACCAATAACCTAAAGAAAA
CAAAGAACATTAGTAAAAGTTGCGTCAACTTATCTTTCACGCAAGAGCTC
GACGACTTAAGAAACTCTAAAGAGAAATTCAAAAACACGATTCCGAGTAC
CCCGTCGGCAAGTTCAATCAACGATTTATTGACATCTGATCCACGACGTA
GTAGCACACCTATGAACAATCATAATCGCAAGTGGAACAACAGGCGGACG
ACTAATGCATGGTCATCTCAGAAACCACAATCCCCAGTCGGCTCACCGCT
CGCTAATCATCAATCGCAATCGGTGACTGATTTGTTTCGTAACCCGGCTC
CCCTTTCACCTTTATCCAATGAACGAAAGACTTTTCCTGAATCCTCACCC
GTTAGTGTGAGTACAGAAAATGTTGTCCGCCGATCAGGAGCACGAAGAAA
TCGCTCGCGTCCGCGCTCAATGGTAATTGAACCAACCACAGTGCGAGACA
AGCGCAGTGAGATTCGCATCAGCCGCGCGGACTCATTACGCACGCCTTCC
CAATCGCATTCCGATACAGAAATAGAGGAAAGTACAATTGAGAATTCAGT
TTTTAATTCAATCACTAAAACACAATCAGTCGTTACATCACCAACACGCC
CAACACAAATTCCTGAAATGCCCGTTACCGCCCATATTTCTGAAACGACC
GTCGCCGCTCTTATTTCAACGCCCACCAAAGACGGTAAGCGTGAAATTGA
CATCGATGAACAATTACTGAGCGAAAGCGAAGCGGAACGCGTCCGACGTA
TCGCACAACAGATCAACGACAATGTACGACACTTGCAACAACAGAACAGT
TTGAACGGCAGTCGTGAGAATATTGAGGAAGACGAGTTACGAGATACTAA
AGAATTGATACGACTTTATGAGACGGGTTTGATAGGAACACACGGAAAAT
TGATCAGCTGTTCGCCTCCAGAGCGTGACGTACCAAGCTCTACTAGCGAA
CAACAGCTTAAAGCTAAGCTCGGTAACCACCCTTCATCAGCATCACAAAC
AACATCTACTAATACCAACAACATAATTCATGAACGCCCACCGCCCACTC
AAGCCTCTGCACCTAACCTTTCAACCGCCCAACGAGCCGCCAATCGAAAA
GCGTCAATGGATGCTGCAGCGTGTATGTCTCTAAAGAATAAGGTCGAGTA
CAAATTCAACAGGAACAGCAGACGAGCAAAGAAAACGACTTGAAAATAAG
ACGTTGACACAGAAACGGACCCGGAAAAAGAGAGCGATATGGACCGACAA
TCAAGTTCCGATGTTGAAAGTGATAACGATGAAGCTTTCTCACCTCTCAT
GGAACACTTCGAGGAGTTGGCTACACCTGCCAAGATTTTATCCGCGTCAA
GATCTCGCAGTAGTTCTAGTACGGAACCAGTTGAGCCACAGAATGCATTG
CAACAGAAATTTGTACCGGGACACCGTGCGAGTATTTCAGCCAAATTTCT
ATCAAGATCACAAAAATCTTCTTCAACAAGAATGGTGAAACGATTGATTT
AAATGGAACAGGACTTTTTACGTCACTGAATCACGTGGTTCACAATCAGC
CAATAAGACGTTCAATCAAGAAGAAGTCATTTATCCTCCTATCGAAGAAG
ACACTGCAATGATGGATCCTGAAAACACAGTGAAAACCCTATTGATGGCG
AACCGGGTGGACTTGGACCTGTCACTGAGCAAGCTCTGGAAATCCCGCAT
CGAAAGTTTTCTGAAGATTCTATCGCATCCGCGATGGGCAACGGTCAAGA
TGGAAATGGACAGTCTAAAGGTCAATCTCAACCGATGGGCAGATGGGGAC
AGTTACTGAAGCAGCCAACTTCAGATCAACAAAGAGAATTGCTTACTGTG
ATCAACAAGACGTACCAAAGCCTCCAAGAAACACTCACTGAACGCACCTC
AAGGCTTCAACAATATGATGACATCACGAAAAACAATTTACACGTGCTTA
ATTCGGATACTTTTAAACAGTTCCAGGATTCTATTGCAAAAACGCAGACG
ACGCCAGAGGTCTCGGAACAAGCTACTAGTGTTGACGTCATAAATATGTT
AGATAAGTATTCGAATGTTCTTGTTGACATGATAAGCTCTAAAATCAGGA
CCAAAGATTCGCTGACCGAGTGATGACTTTGGAAGAATGTAAACAAAGTA
TGGACCGGTTGGTTGAATCGTTTAGAAATGCTTCTGAAATTGAGAAAAGA
AATTCTTCAAAGATTGAAGAAAAAGATGAAGACACGCACAAAGAAACTGA
AAACCATCAAGATGAAGATCATTTGCAAAGTGATCATGAACAAGCAACAT
GTGATAATGTCGGCAATGGCTCGCAACGTCATCACCAATAACCTAAAGAA
AACAAAGAACATTAGTAAAAGTTGCGTCAACTTATCTTTCACGCAAGAGC
TCGACGACTTAAGAAACTCTAAAGAGAAATTCAAAAACACGATTCCGAGT
ACCCCGTCGGCAAGTTCAATCAACGATTTATTGACATCTGATCCACGACG
TAGTAGCACACCTATGAACAATCATAATCGCAAGTGGAACAACAGGCGGA
CGACTAATGCATGGTCATCTCAGAAACCACAATCCCCAGTCGGCTCACCG
CTCGCTAATCATCAATCGCAATCGGTGACTGATTTGTTTCGTAACCCGGC
TCCCCTTTCACCTTTATCCAATGAACGAAAGACTTTTCCTGAATCCTCAC
CCGTTAGTGTGAGTACAGAAAATGTTGTCCGCCGATCAGGAGCACGAAGA
AATCGCTCGCGTCCGCGCTCAATGGTAATTGAACCAACCACAGTGCGAGA
CAAGCGCAGTGAGATTCGCATCAGCCGCGCGGACTCATTACGCACGCCTT
CCCAATCGCATTCCGATACAGAAATAGAGGAAAGTACAATTGAGAATTCA
GTTTTTAATTCAATCACTAAAACACAATCAGTCGTTACATCACCAACACG
CCCAACACAAATTCCTGAAATGCCCGTTACCGCCCATATTTCTGAAACGA
CCGTCGCCGCTCTTATTTCAACGCCCACCAAAGACGGTAAGCGTGAAATT
GACATCGATGAACAATTACTGAGCGAAAGCGAAGCGGAACGCGTCCGACG
TATCGCACAACAGATCAACGACAATGTACGACACTTGCAACAACAGAACA
GTTTGAACGGCAGTCGTGAGAATATTGAGGAAGACGAGTTACGAGATACT
AAAGAATTGATACGACTTTATGAGACGGGTTTGATAGGAACACACGGAAA
ATTGATCAGCTGTTCGCCTCCAGAGCGTGACGTACCAAGCTCTACTAGCG
AACAACAGCTTAAAGCTAAGCTCGGTAACCACCCTTCATCAGCATCACAA
ACAACATCTACTAATACCAACAACATAATTCATGAACGCCCACCGCCCAC
TCAAGCCTCTGCACCTAACCTTTCAACCGCCCAACGAGCCGCCAATCGAA
AAGCGTCAATGGATGCTGCAGCGTGTATGTCTCTAAAGAATAAGGTCGAG
TACAAATTCAACAGGAACAGCAGACGAGCAAAGAAAACGACTTGAAAATA
AGACGTTGACACAGAAACGGACCCGGAAAAAGAGAGCGATATGGACCGAC
AATCAAGTTCCGATGTTGAAAGTGATAACGATGAAGCTTTCTCACCTCTC
ATGGAACACTTCGAGGAGTTGGCTACACCTGCCAAGATTTTATCCGCGTC
AAGATCTCGCAGTAGTTCTAGTACGGAACCAGTTGAGCCACAGAATGCAT
TGCAACAGAAATTTGTACCGGGACACCGTGCGAGTATTTCAGCCAAATTT
CTATCAAGATCACAAAAATCTTCTTCAACAAGAATGGTGAAACGATTGAT
TTAAATGGAACAGGACTTTTTACGTCACTGAATCACGTGGTTCACAATCA
GCCAATAAGACGTTCAATCAAGAAGAAGTCATTTATCCTCCTATCGAAGA
AGACACTGCAATGATGGATCCTGAAAACACAGTGAAAACCCTATTGATGG
CGAACCGGGTGGACTTGGACCTGTCACTGAGCAAGCTCTGGAAATCCCGC
ATCGAAAGTTTTCTGAAGATTCTATCGCATCCGCGATGGGCAACGGTCAA
GATGGAAATGGACAGTCTAAAGGTCAATCTCAACCGATGGGCAGATGGGG
ACAGTTACTGAAGCAGCCAACTTCAGATCAACAAAGAGAATTGCTTACTG
TGATCAACAAGACGTACCAAAGCCTCCAAGAAACACTCACTGAACGCACC
TCAAGGCTTCAACAATATGATGACATCACGAAAAACAATTTACACGTGCT
TAATTCGGATACTTTTAAACAGTTCCAGGATTCTATTGCAAAAACGCAGA
CGACGCCAGAGGTCTCGGAACAAGCTACTAGTGTTGACGTCATAAATATG
TTAGATAAGTATTCGAATGTTCTTGTTGACATGATAAGCTCTAAAATCAG
GACCAAAGATTCGCTGACCGAGTGATGACTTTGGAAGAATGTAAACAAAG
TATGGACCGGTTGGTTGAATCGTTTAGAAATGCTTCTGAAATTGAGAAAA
GAAATTCTTCAAAGATTGAAGAAAAAGATGAAGACACGCACAAAGAAACT
GAAAACCATCAAGATGAAGATCATTTGCAAAGTGATCATGAACAAGCAAC
ATGTGATAATGTCGGCAATGGCTCGCAACGTCATCACCAATAACCTAAAG
AAAACAAAGAACATTAGTAAAAGTTGCGTCAACTTATCTTTCACGCAAGA
GCTCGACGACTTAAGAAACTCTAAAGAGAAATTCAAAAACACGATTCCGA
GTACCCCGTCGGCAAGTTCAATCAACGATTTATTGACATCTGATCCACGA
CGTAGTAGCACACCTATGAACAATCATAATCGCAAGTGGAACAACAGGCG
GACGACTAATGCATGGTCATCTCAGAAACCACAATCCCCAGTCGGCTCAC
CGCTCGCTAATCATCAATCGCAATCGGTGACTGATTTGTTTCGTAACCCG
GCTCCCCTTTCACCTTTATCCAATGAACGAAAGACTTTTCCTGAATCCTC
ACCCGTTAGTGTGAGTACAGAAAATGTTGTCCGCCGATCAGGAGCACGAA
GAAATCGCTCGCGTCCGCGCTCAATGGTAATTGAACCAACCACAGTGCGA
GACAAGCGCAGTGAGATTCGCATCAGCCGCGCGGACTCATTACGCACGCC
TTCCCAATCGCATTCCGATACAGAAATAGAGGAAAGTACAATTGAGAATT
CAGTTTTTAATTCAATCACTAAAACACAATCAGTCGTTACATCACCAACA
CGCCCAACACAAATTCCTGAAATGCCCGTTACCGCCCATATTTCTGAAAC
GACCGTCGCCGCTCTTATTTCAACGCCCACCAAAGACGGTAAGCGTGAAA
TTGACATCGATGAACAATTACTGAGCGAAAGCGAAGCGGAACGCGTCCGA
CGTATCGCACAACAGATCAACGACAATGTACGACACTTGCAACAACAGAA
CAGTTTGAACGGCAGTCGTGAGAATATTGAGGAAGACGAGTTACGAGATA
CTAAAGAATTGATACGACTTTATGAGACGGGTTTGATAGGAACACACGGA
AAATTGATCAGCTGTTCGCCTCCAGAGCGTGACGTACCAAGCTCTACTAG
CGAACAACAGCTTAAAGCTAAGCTCGGTAACCACCCTTCATCAGCATCAC
AAACAACATCTACTAATACCAACAACATAATTCATGAACGCCCACCGCCC
ACTCAAGCCTCTGCACCTAACCTTTCAACCGCCCAACGAGCCGCCAATCG
AAAAGCGTCAATGGATGCTGCAGCGTGTATGTCTCTAAAGAATAAGGTCG
AGTACAAATTCAACAGGAACAGCAGACGAGCAAAGAAAACGACTTGAAAA
TAAGACGTTGACACAGAAACGGACCCGGAAAAAGAGAGCGATATGGACCG
ACAATCAAGTTCCGATGTTGAAAGTGATAACGATGAAGCTTTCTCACCTC
TCATGGAACACTTCGAGGAGTTGGCTACACCTGCCAAGATTTTATCCGCG
TCAAGATCTCGCAGTAGTTCTAGTACGGAACCAGTTGAGCCACAGAATGC
ATTGCAACAGAAATTTGTACCGGGACACCGTGCGAGTATTTCAGCCAAAT
TTCTATCAAGATCACAAAAATCTTCTTCAACAAGAATGGTGAAACGATTG
ATTTAAATGGAACAGGACTTTTTACGTCACTGAATCACGTGGTTCACAAT
CAGCCAATAAGACGTTCAATCAAGAAGAAGTCATTTATCCTCCTATCGAA
GAAGACACTGCAATGATGGATCCTGAAAACACAGTGAAAACCCTATTGAT
GGCGAACCGGGTGGACTTGGACCTGTCACTGAGCAAGCTCTGGAAATCCC
GCATCGAAAGTTTTCTGAAGATTCTATCGCATCCGCGATGGGCAACGGTC
AAGATGGAAATGGACAGTCTAAAGGTCAATCTCAACCGATGGGCAGATGG
GGACAGTTACTGAAGCAGCCAACTTCAGATCAACAAAGAGAATTGCTTAC
TGTGATCAACAAGACGTACCAAAGCCTCCAAGAAACACTCACTGAACGCA
CCTCAAGGCTTCAACAATATGATGACATCACGAAAAACAATTTACACGTG
CTTAATTCGGATACTTTTAAACAGTTCCAGGATTCTATTGCAAAAACGCA
GACGACGCCAGAGGTCTCGGAACAAGCTACTAGTGTTGACGTCATAAATA
TGTTAGATAAGTATTCGAATGTTCTTGTTGACATGATAAGCTCTAAAATC
AGGACCAAAGATTCGCTGACCGAGTGATGACTTTGGAAGAATGTAAACAA
AGTATGGACCGGTTGGTTGAATCGTTTAGAAATGCTTCTGAAATTGAGAA
AAGAAATTCTTCAAAGATTGAAGAAAAAGATGAAGACACGCACAAAGAAA
CTGAAAACCATCAAGATGAAGATCATTTGCAAAGTGATCATGAACAAGCA
ACATGTGATAATGTCGGCAATGGCTCGCAACGTCATCACCAATAACCTAA
AGAAAACAAAGAACATTAGTAAAAGTTGCGTCAACTTATCTTTCACGCAA
GAGCTCGACGACTTAAGAAACTCTAAAGAGAAATTCAAAAACACGATTCC
GAGTACCCCGTCGGCAAGTTCAATCAACGATTTATTGACATCTGATCCAC
GACGTAGTAGCACACCTATGAACAATCATAATCGCAAGTGGAACAACAGG
CGGACGACTAATGCATGGTCATCTCAGAAACCACAATCCCCAGTCGGCTC
ACCGCTCGCTAATCATCAATCGCAATCGGTGACTGATTTGTTTCGTAACC
CGGCTCCCCTTTCACCTTTATCCAATGAACGAAAGACTTTTCCTGAATCC
TCACCCGTTAGTGTGAGTACAGAAAATGTTGTCCGCCGATCAGGAGCACG
AAGAAATCGCTCGCGTCCGCGCTCAATGGTAATTGAACCAACCACAGTGC
GAGACAAGCGCAGTGAGATTCGCATCAGCCGCGCGGACTCATTACGCACG
CCTTCCCAATCGCATTCCGATACAGAAATAGAGGAAAGTACAATTGAGAA
TTCAGTTTTTAATTCAATCACTAAAACACAATCAGTCGTTACATCACCAA
CACGCCCAACACAAATTCCTGAAATGCCCGTTACCGCCCATATTTCTGAA
ACGACCGTCGCCGCTCTTATTTCAACGCCCACCAAAGACGGTAAGCGTGA
AATTGACATCGATGAACAATTACTGAGCGAAAGCGAAGCGGAACGCGTCC
GACGTATCGCACAACAGATCAACGACAATGTACGACACTTGCAACAACAG
AACAGTTTGAACGGCAGTCGTGAGAATATTGAGGAAGACGAGTTACGAGA
TACTAAAGAATTGATACGACTTTATGAGACGGGTTTGATAGGAACACACG
GAAAATTGATCAGCTGTTCGCCTCCAGAGCGTGACGTACCAAGCTCTACT
AGCGAACAACAGCTTAAAGCTAAGCTCGGTAACCACCCTTCATCAGCATC
ACAAACAACATCTACTAATACCAACAACATAATTCATGAACGCCCACCGC
CCACTCAAGCCTCTGCACCTAACCTTTCAACCGCCCAACGAGCCGCCAAT
CGAAAAGCGTCAATGGATGCTGCAGCGTGTATGTCTCTAAAGAATAAGGT
CGAGTACAAATTCAACAGGAACAGCAGACGAGCAAAGAAAACGACTTGAA
AATAAGACGTTGACACAGAAACGGACCCGGAAAAAGAGAGCGATATGGAC
CGACAATCAAGTTCCGATGTTGAAAGTGATAACGATGAAGCTTTCTCACC
TCTCATGGAACACTTCGAGGAGTTGGCTACACCTGCCAAGATTTTATCCG
CGTCAAGATCTCGCAGTAGTTCTAGTACGGAACCAGTTGAGCCACAGAAT
GCATTGCAACAGAAATTTGTACCGGGACACCGTGCGAGTATTTCAGCCAA
ATTTCTATCAAGATCACAAAAATCTTCTTCAACAAGAATGGTGAAACGAT
TGATTTAAATGGAACAGGACTTTTTACGTCACTGAATCACGTGGTTCACA
ATCAGCCAATAAGACGTTCAATCAAGAAGAAGTCATTTATCCTCCTATCG
AAGAAGACACTGCAATGATGGATCCTGAAAACACAGTGAAAACCCTATTG
ATGGCGAACCGGGTGGACTTGGACCTGTCACTGAGCAAGCTCTGGAAATC
CCGCATCGAAAGTTTTCTGAAGATTCTATCGCATCCGCGATGGGCAACGG
TCAAGATGGAAATGGACAGTCTAAAGGTCAATCTCAACCGATGGGCAGAT
GGGGACAGTTACTGAAGCAGCCAACTTCAGATCAACAAAGAGAATTGCTT
ACTGTGATCAACAAGACGTACCAAAGCCTCCAAGAAACACTCACTGAACG
CACCTCAAGGCTTCAACAATATGATGACATCACGAAAAACAATTTACACG
TGCTTAATTCGGATACTTTTAAACAGTTCCAGGATTCTATTGCAAAAACG
CAGACGACGCCAGAGGTCTCGGAACAAGCTACTAGTGTTGACGTCATAAA
TATGTTAGATAAGTATTCGAATGTTCTTGTTGACATGATAAGCTCTAAAA
TCAGGACCAAAGATTCGCTGACCGAGTGATGACTTTGGAAGAATGTAAAC
AAAGTATGGACCGGTTGGTTGAATCGTTTAGAAATGCTTCTGAAATTGAG
AAAAGAAATTCTTCAAAGATTGAAGAAAAAGATGAAGACACGCACAAAGA
AACTGAAAACCATCAAGATGAAGATCATTTGCAAAGTGATCATGAACAAG
CAACATGTGATAATGTCGGCAATGGCTCGCAACGTCATCACCAATAACCT
AAAGAAAACAAAGAACATTAGTAAAAGTTGCGTCAACTTATCTTTCACGC
AAGAGCTCGACGACTTAAGAAACTCTAAAGAGAAATTCAAAAACACGATT
CCGAGTACCCCGTCGGCAAGTTCAATCAACGATTTATTGACATCTGATCC
ACGACGTAGTAGCACACCTATGAACAATCATAATCGCAAGTGGAACAACA
GGCGGACGACTAATGCATGGTCATCTCAGAAACCACAATCCCCAGTCGGC
TCACCGCTCGCTAATCATCAATCGCAATCGGTGACTGATTTGTTTCGTAA
CCCGGCTCCCCTTTCACCTTTATCCAATGAACGAAAGACTTTTCCTGAAT
CCTCACCCGTTAGTGTGAGTACAGAAAATGTTGTCCGCCGATCAGGAGCA
CGAAGAAATCGCTCGCGTCCGCGCTCAATGGTAATTGAACCAACCACAGT
GCGAGACAAGCGCAGTGAGATTCGCATCAGCCGCGCGGACTCATTACGCA
CGCCTTCCCAATCGCATTCCGATACAGAAATAGAGGAAAGTACAATTGAG
AATTCAGTTTTTAATTCAATCACTAAAACACAATCAGTCGTTACATCACC
AACACGCCCAACACAAATTCCTGAAATGCCCGTTACCGCCCATATTTCTG
AAACGACCGTCGCCGCTCTTATTTCAACGCCCACCAAAGACGGTAAGCGT
GAAATTGACATCGATGAACAATTACTGAGCGAAAGCGAAGCGGAACGCGT
CCGACGTATCGCACAACAGATCAACGACAATGTACGACACTTGCAACAAC
AGAACAGTTTGAACGGCAGTCGTGAGAATATTGAGGAAGACGAGTTACGA
GATACTAAAGAATTGATACGACTTTATGAGACGGGTTTGATAGGAACACA
CGGAAAATTGATCAGCTGTTCGCCTCCAGAGCGTGACGTACCAAGCTCTA
CTAGCGAACAACAGCTTAAAGCTAAGCTCGGTAACCACCCTTCATCAGCA
TCACAAACAACATCTACTAATACCAACAACATAATTCATGAACGCCCACC
GCCCACTCAAGCCTCTGCACCTAACCTTTCAACCGCCCAACGAGCCGCCA
ATCGAAAAGCGTCAATGGATGCTGCAGCGTGTATGTCTCTAAAGAATAAG
GTCGAGTACAAATTCAACAGGAACAGCAGACGAGCAAAGAAAACGACTTG
AAAATAAGACGTTGACACAGAAACGGACCCGGAAAAAGAGAGCGATATGG
ACCGACAATCAAGTTCCGATGTTGAAAGTGATAACGATGAAGCTTTCTCA
CCTCTCATGGAACACTTCGAGGAGTTGGCTACACCTGCCAAGATTTTATC
CGCGTCAAGATCTCGCAGTAGTTCTAGTACGGAACCAGTTGAGCCACAGA
ATGCATTGCAACAGAAATTTGTACCGGGACACCGTGCGAGTATTTCAGCC
AAATTTCTATCAAGATCACAAAAATCTTCTTCAACAAGAATGGTGAAACG
ATTGATTTAAATGGAACAGGACTTTTTACGTCACTGAATCACGTGGTTCA
CAATCAGCCAATAAGACGTTCAATCAAGAAGAAGTCATTTATCCTCCTAT
CGAAGAAGACACTGCAATGATGGATCCTGAAAACACAGTGAAAACCCTAT
TGATGGCGAACCGGGTGGACTTGGACCTGTCACTGAGCAAGCTCTGGAAA
TCCCGCATCGAAAGTTTTCTGAAGATTCTATCGCATCCGCGATGGGCAAC
GGTCAAGATGGAAATGGACAGTCTAAAGGTCAATCTCAACCGATGGGCAG
ATGGGGACAGTTACTGAAGCAGCCAACTTCAGATCAACAAAGAGAATTGC
TTACTGTGATCAACAAGACGTACCAAAGCCTCCAAGAAACACTCACTGAA
CGCACCTCAAGGCTTCAACAATATGATGACATCACGAAAAACAATTTACA
CGTGCTTAATTCGGATACTTTTAAACAGTTCCAGGATTCTATTGCAAAAA
CGCAGACGACGCCAGAGGTCTCGGAACAAGCTACTAGTGTTGACGTCATA
AATATGTTAGATAAGTATTCGAATGTTCTTGTTGACATGATAAGCTCTAA
AATCAGGACCAAAGATTCGCTGACCGAGTGATGACTTTGGAAGAATGTAA
ACAAAGTATGGACCGGTTGGTTGAATCGTTTAGAAATGCTTCTGAAATTG
AGAAAAGAAATTCTTCAAAGATTGAAGAAAAAGATGAAGACACGCACAAA
GAAACTGAAAACCATCAAGATGAAGATCATTTGCAAAGTGATCATGAACA
AGCAACATGTGATAATGTCGGCAATGGCTCGCAACGTCATCACCAATAAC
CTAAAGAAAACAAAGAACATTAGTAAAAGTTGCGTCAACTTATCTTTCAC
GCAAGAGCTCGACGACTTAAGAAACTCTAAAGAGAAATTCAAAAACACGA
TTCCGAGTACCCCGTCGGCAAGTTCAATCAACGATTTATTGACATCTGAT
CCACGACGTAGTAGCACACCTATGAACAATCATAATCGCAAGTGGAACAA
CAGGCGGACGACTAATGCATGGTCATCTCAGAAACCACAATCCCCAGTCG
GCTCACCGCTCGCTAATCATCAATCGCAATCGGTGACTGATTTGTTTCGT
AACCCGGCTCCCCTTTCACCTTTATCCAATGAACGAAAGACTTTTCCTGA
ATCCTCACCCGTTAGTGTGAGTACAGAAAATGTTGTCCGCCGATCAGGAG
CACGAAGAAATCGCTCGCGTCCGCGCTCAATGGTAATTGAACCAACCACA
GTGCGAGACAAGCGCAGTGAGATTCGCATCAGCCGCGCGGACTCATTACG
CACGCCTTCCCAATCGCATTCCGATACAGAAATAGAGGAAAGTACAATTG
AGAATTCAGTTTTTAATTCAATCACTAAAACACAATCAGTCGTTACATCA
CCAACACGCCCAACACAAATTCCTGAAATGCCCGTTACCGCCCATATTTC
TGAAACGACCGTCGCCGCTCTTATTTCAACGCCCACCAAAGACGGTAAGC
GTGAAATTGACATCGATGAACAATTACTGAGCGAAAGCGAAGCGGAACGC
GTCCGACGTATCGCACAACAGATCAACGACAATGTACGACACTTGCAACA
ACAGAACAGTTTGAACGGCAGTCGTGAGAATATTGAGGAAGACGAGTTAC
GAGATACTAAAGAATTGATACGACTTTATGAGACGGGTTTGATAGGAACA
CACGGAAAATTGATCAGCTGTTCGCCTCCAGAGCGTGACGTACCAAGCTC
TACTAGCGAACAACAGCTTAAAGCTAAGCTCGGTAACCACCCTTCATCAG
CATCACAAACAACATCTACTAATACCAACAACATAATTCATGAACGCCCA
CCGCCCACTCAAGCCTCTGCACCTAACCTTTCAACCGCCCAACGAGCCGC
CAATCGAAAAGCGTCAATGGATGCTGCAGCGTGTATGTCTCTAAAGAATA
AGGTCGAGTACAAATTCAACAGGAACAGCAGACGAGCAAAGAAAACGACT
TGAAAATAAGACGTTGACACAGAAACGGACCCGGAAAAAGAGAGCGATAT
GGACCGACAATCAAGTTCCGATGTTGAAAGTGATAACGATGAAGCTTTCT
CACCTCTCATGGAACACTTCGAGGAGTTGGCTACACCTGCCAAGATTTTA
TCCGCGTCAAGATCTCGCAGTAGTTCTAGTACGGAACCAGTTGAGCCACA
GAATGCATTGCAACAGAAATTTGTACCGGGACACCGTGCGAGTATTTCAG
CCAAATTTCTATCAAGATCACAAAAATCTTCTTCAACAAGAATGGTGAAA
CGATTGATTTAAATGGAACAGGACTTTTTACGTCACTGAATCACGTGGTT
CACAATCAGCCAATAAGACGTTCAATCAAGAAGAAGTCATTTATCCTCCT
ATCGAAGAAGACACTGCAATGATGGATCCTGAAAACACAGTGAAAACCCT
ATTGATGGCGAACCGGGTGGACTTGGACCTGTCACTGAGCAAGCTCTGGA
AATCCCGCATCGAAAGTTTTCTGAAGATTCTATCGCATCCGCGATGGGCA
ACGGTCAAGATGGAAATGGACAGTCTAAAGGTCAATCTCAACCGATGGGC
AGATGGGGACAGTTACTGAAGCAGCCAACTTCAGATCAACAAAGAGAATT
GCTTACTGTGATCAACAAGACGTACCAAAGCCTCCAAGAAACACTCACTG
AACGCACCTCAAGGCTTCAACAATATGATGACATCACGAAAAACAATTTA
CACGTGCTTAATTCGGATACTTTTAAACAGTTCCAGGATTCTATTGCAAA
AACGCAGACGACGCCAGAGGTCTCGGAACAAGCTACTAGTGTTGACGTCA
TAAATATGTTAGATAAGTATTCGAATGTTCTTGTTGACATGATAAGCTCT
AAAATCAGGACCAAAGATTCGCTGACCGAGTGATGACTTTGGAAGAATGT
AAACAAAGTATGGACCGGTTGGTTGAATCGTTTAGAAATGCTTCTGAAAT
TGAGAAAAGAAATTCTTCAAAGATTGAAGAAAAAGATGAAGACACGCACA
AAGAAACTGAAAACCATCAAGATGAAGATCATTTGCAAAGTGATCATGAA
CAAGCAACATGTGATAATGTCGGCAATGGCTCGCAACGTCATCACCAATA
ACCTAAAGAAAACAAAGAACATTAGTAAAAGTTGCGTCAACTTATCTTTC
ACGCAAGAGCTCGACGACTTAAGAAACTCTAAAGAGAAATTCAAAAACAC
GATTCCGAGTACCCCGTCGGCAAGTTCAATCAACGATTTATTGACATCTG
ATCCACGACGTAGTAGCACACCTATGAACAATCATAATCGCAAGTGGAAC
AACAGGCGGACGACTAATGCATGGTCATCTCAGAAACCACAATCCCCAGT
CGGCTCACCGCTCGCTAATCATCAATCGCAATCGGTGACTGATTTGTTTC
GTAACCCGGCTCCCCTTTCACCTTTATCCAATGAACGAAAGACTTTTCCT
GAATCCTCACCCGTTAGTGTGAGTACAGAAAATGTTGTCCGCCGATCAGG
AGCACGAAGAAATCGCTCGCGTCCGCGCTCAATGGTAATTGAACCAACCA
CAGTGCGAGACAAGCGCAGTGAGATTCGCATCAGCCGCGCGGACTCATTA
CGCACGCCTTCCCAATCGCATTCCGATACAGAAATAGAGGAAAGTACAAT
TGAGAATTCAGTTTTTAATTCAATCACTAAAACACAATCAGTCGTTACAT
CACCAACACGCCCAACACAAATTCCTGAAATGCCCGTTACCGCCCATATT
TCTGAAACGACCGTCGCCGCTCTTATTTCAACGCCCACCAAAGACGGTAA
GCGTGAAATTGACATCGATGAACAATTACTGAGCGAAAGCGAAGCGGAAC
GCGTCCGACGTATCGCACAACAGATCAACGACAATGTACGACACTTGCAA
CAACAGAACAGTTTGAACGGCAGTCGTGAGAATATTGAGGAAGACGAGTT
ACGAGATACTAAAGAATTGATACGACTTTATGAGACGGGTTTGATAGGAA
CACACGGAAAATTGATCAGCTGTTCGCCTCCAGAGCGTGACGTACCAAGC
TCTACTAGCGAACAACAGCTTAAAGCTAAGCTCGGTAACCACCCTTCATC
AGCATCACAAACAACATCTACTAATACCAACAACATAATTCATGAACGCC
CACCGCCCACTCAAGCCTCTGCACCTAACCTTTCAACCGCCCAACGAGCC
GCCAATCGAAAAGCGTCAATGGATGCTGCAGCGTGTATGTCTCTAAAGAA
TAAGGTCGAGTACAAATTCAACAGGAACAGCAGACGAGCAAAGAAAACGA
CTTGAAAATAAGACGTTGACACAGAAACGGACCCGGAAAAAGAGAGCGAT
ATGGACCGACAATCAAGTTCCGATGTTGAAAGTGATAACGATGAAGCTTT
CTCACCTCTCATGGAACACTTCGAGGAGTTGGCTACACCTGCCAAGATTT
TATCCGCGTCAAGATCTCGCAGTAGTTCTAGTACGGAACCAGTTGAGCCA
CAGAATGCATTGCAACAGAAATTTGTACCGGGACACCGTGCGAGTATTTC
AGCCAAATTTCTATCAAGATCACAAAAATCTTCTTCAACAAGAATGGTGA
AACGATTGATTTAAATGGAACAGGACTTTTTACGTCACTGAATCACGTGG
TTCACAATCAGCCAATAAGACGTTCAATCAAGAAGAAGTCATTTATCCTC
CTATCGAAGAAGACACTGCAATGATGGATCCTGAAAACACAGTGAAAACC
CTATTGATGGCGAACCGGGTGGACTTGGACCTGTCACTGAGCAAGCTCTG
GAAATCCCGCATCGAAAGTTTTCTGAAGATTCTATCGCATCCGCGATGGG
CAACGGTCAAGATGGAAATGGACAGTCTAAAGGTCAATCTCAACCGATGG
GCAGATGGGGACAGTTACTGAAGCAGCCAACTTCAGATCAACAAAGAGAA
TTGCTTACTGTGATCAACAAGACGTACCAAAGCCTCCAAGAAACACTCAC
TGAACGCACCTCAAGGCTTCAACAATATGATGACATCACGAAAAACAATT
TACACGTGCTTAATTCGGATACTTTTAAACAGTTCCAGGATTCTATTGCA
AAAACGCAGACGACGCCAGAGGTCTCGGAACAAGCTACTAGTGTTGACGT
CATAAATATGTTAGATAAGTATTCGAATGTTCTTGTTGACATGATAAGCT
CTAAAATCAGGACCAAAGATTCGCTGACCGAGTGATGACTTTGGAAGAAT
GTAAACAAAGTATGGACCGGTTGGTTGAATCGTTTAGAAATGCTTCTGAA
ATTGAGAAAAGAAATTCTTCAAAGATTGAAGAAAAAGATGAAGACACGCA
CAAAGAAACTGAAAACCATCAAGATGAAGATCATTTGCAAAGTGATCATG
AACAAGCAACATGTGATAATGTCGGCAATGGCTCGCAACGTCATCACCAA
TAACCTAAAGAAAACAAAGAACATTAGTAAAAGTTGCGTCAACTTATCTT
TCACGCAAGAGCTCGACGACTTAAGAAACTCTAAAGAGAAATTCAAAAAC
ACGATTCCGAGTACCCCGTCGGCAAGTTCAATCAACGATTTATTGACATC
TGATCCACGACGTAGTAGCACACCTATGAACAATCATAATCGCAAGTGGA
ACAACAGGCGGACGACTAATGCATGGTCATCTCAGAAACCACAATCCCCA
GTCGGCTCACCGCTCGCTAATCATCAATCGCAATCGGTGACTGATTTGTT
TCGTAACCCGGCTCCCCTTTCACCTTTATCCAATGAACGAAAGACTTTTC
CTGAATCCTCACCCGTTAGTGTGAGTACAGAAAATGTTGTCCGCCGATCA
GGAGCACGAAGAAATCGCTCGCGTCCGCGCTCAATGGTAATTGAACCAAC
CACAGTGCGAGACAAGCGCAGTGAGATTCGCATCAGCCGCGCGGACTCAT
TACGCACGCCTTCCCAATCGCATTCCGATACAGAAATAGAGGAAAGTACA
ATTGAGAATTCAGTTTTTAATTCAATCACTAAAACACAATCAGTCGTTAC
ATCACCAACACGCCCAACACAAATTCCTGAAATGCCCGTTACCGCCCATA
TTTCTGAAACGACCGTCGCCGCTCTTATTTCAACGCCCACCAAAGACGGT
AAGCGTGAAATTGACATCGATGAACAATTACTGAGCGAAAGCGAAGCGGA
ACGCGTCCGACGTATCGCACAACAGATCAACGACAATGTACGACACTTGC
AACAACAGAACAGTTTGAACGGCAGTCGTGAGAATATTGAGGAAGACGAG
TTACGAGATACTAAAGAATTGATACGACTTTATGAGACGGGTTTGATAGG
AACACACGGAAAATTGATCAGCTGTTCGCCTCCAGAGCGTGACGTACCAA
GCTCTACTAGCGAACAACAGCTTAAAGCTAAGCTCGGTAACCACCCTTCA
TCAGCATCACAAACAACATCTACTAATACCAACAACATAATTCATGAACG
CCCACCGCCCACTCAAGCCTCTGCACCTAACCTTTCAACCGCCCAACGAG
CCGCCAATCGAAAAGCGTCAATGGATGCTGCAGCGTGTATGTCTCTAAAG
AATAAGGTCGAGTACAAATTCAACAGGAACAGCAGACGAGCAAAGAAAAC
GACTTGAAAATAAGACGTTGACACAGAAACGGACCCGGAAAAAGAGAGCG
ATATGGACCGACAATCAAGTTCCGATGTTGAAAGTGATAACGATGAAGCT
TTCTCACCTCTCATGGAACACTTCGAGGAGTTGGCTACACCTGCCAAGAT
TTTATCCGCGTCAAGATCTCGCAGTAGTTCTAGTACGGAACCAGTTGAGC
CACAGAATGCATTGCAACAGAAATTTGTACCGGGACACCGTGCGAGTATT
TCAGCCAAATTTCTATCAAGATCACAAAAATCTTCTTCAACAAGAATGGT
GAAACGATTGATTTAAATGGAACAGGACTTTTTACGTCACTGAATCACGT
GGTTCACAATCAGCCAATAAGACGTTCAATCAAGAAGAAGTCATTTATCC
TCCTATCGAAGAAGACACTGCAATGATGGATCCTGAAAACACAGTGAAAA
CCCTATTGATGGCGAACCGGGTGGACTTGGACCTGTCACTGAGCAAGCTC
TGGAAATCCCGCATCGAAAGTTTTCTGAAGATTCTATCGCATCCGCGATG
GGCAACGGTCAAGATGGAAATGGACAGTCTAAAGGTCAATCTCAACCGAT
GGGCAGATGGGGACAGTTACTGAAGCAGCCAACTTCAGATCAACAAAGAG
AATTGCTTACTGTGATCAACAAGACGTACCAAAGCCTCCAAGAAACACTC
ACTGAACGCACCTCAAGGCTTCAACAATATGATGACATCACGAAAAACAA
TTTACACGTGCTTAATTCGGATACTTTTAAACAGTTCCAGGATTCTATTG
CAAAAACGCAGACGACGCCAGAGGTCTCGGAACAAGCTACTAGTGTTGAC
GTCATAAATATGTTAGATAAGTATTCGAATGTTCTTGTTGACATGATAAG
CTCTAAAATCAGGACCAAAGATTCGCTGACCGAGTGATGACTTTGGAAGA
ATGTAAACAAAGTATGGACCGGTTGGTTGAATCGTTTAGAAATGCTTCTG
AAATTGAGAAAAGAAATTCTTCAAAGATTGAAGAAAAAGATGAAGACACG
CACAAAGAAACTGAAAACCATCAAGATGAAGATCATTTGCAAAGTGATCA
TGAACAAGCAACATGTGATAATGTCGGCAATGGCTCGCAACGTCATCACC
AATAACCTAAAGAAAACAAAGAACATTAGTAAAAGTTGCGTCAACTTATC
TTTCACGCAAGAGCTCGACGACTTAAGAAACTCTAAAGAGAAATTCAAAA
ACACGATTCCGAGTACCCCGTCGGCAAGTTCAATCAACGATTTATTGACA
TCTGATCCACGACGTAGTAGCACACCTATGAACAATCATAATCGCAAGTG
GAACAACAGGCGGACGACTAATGCATGGTCATCTCAGAAACCACAATCCC
CAGTCGGCTCACCGCTCGCTAATCATCAATCGCAATCGGTGACTGATTTG
TTTCGTAACCCGGCTCCCCTTTCACCTTTATCCAATGAACGAAAGACTTT
TCCTGAATCCTCACCCGTTAGTGTGAGTACAGAAAATGTTGTCCGCCGAT
CAGGAGCACGAAGAAATCGCTCGCGTCCGCGCTCAATGGTAATTGAACCA
ACCACAGTGCGAGACAAGCGCAGTGAGATTCGCATCAGCCGCGCGGACTC
ATTACGCACGCCTTCCCAATCGCATTCCGATACAGAAATAGAGGAAAGTA
CAATTGAGAATTCAGTTTTTAATTCAATCACTAAAACACAATCAGTCGTT
ACATCACCAACACGCCCAACACAAATTCCTGAAATGCCCGTTACCGCCCA
TATTTCTGAAACGACCGTCGCCGCTCTTATTTCAACGCCCACCAAAGACG
GTAAGCGTGAAATTGACATCGATGAACAATTACTGAGCGAAAGCGAAGCG
GAACGCGTCCGACGTATCGCACAACAGATCAACGACAATGTACGACACTT
GCAACAACAGAACAGTTTGAACGGCAGTCGTGAGAATATTGAGGAAGACG
AGTTACGAGATACTAAAGAATTGATACGACTTTATGAGACGGGTTTGATA
GGAACACACGGAAAATTGATCAGCTGTTCGCCTCCAGAGCGTGACGTACC
AAGCTCTACTAGCGAACAACAGCTTAAAGCTAAGCTCGGTAACCACCCTT
CATCAGCATCACAAACAACATCTACTAATACCAACAACATAATTCATGAA
CGCCCACCGCCCACTCAAGCCTCTGCACCTAACCTTTCAACCGCCCAACG
AGCCGCCAATCGAAAAGCGTCAATGGATGCTGCAGCGTGTATGTCTCTAA
AGAATAAGGTCGAGTACAAATTCAACAGGAACAGCAGACGAGCAAAGAAA
ACGACTTGAAAATAAGACGTTGACACAGAAACGGACCCGGAAAAAGAGAG
CGATATGGACCGACAATCAAGTTCCGATGTTGAAAGTGATAACGATGAAG
CTTTCTCACCTCTCATGGAACACTTCGAGGAGTTGGCTACACCTGCCAAG
ATTTTATCCGCGTCAAGATCTCGCAGTAGTTCTAGTACGGAACCAGTTGA
GCCACAGAATGCATTGCAACAGAAATTTGTACCGGGACACCGTGCGAGTA
TTTCAGCCAAATTTCTATCAAGATCACAAAAATCTTCTTCAACAAGAATG
GTGAAACGATTGATTTAAATGGAACAGGACTTTTTACGTCACTGAATCAC
GTGGTTCACAATCAGCCAATAAGACGTTCAATCAAGAAGAAGTCATTTAT
CCTCCTATCGAAGAAGACACTGCAATGATGGATCCTGAAAACACAGTGAA
AACCCTATTGATGGCGAACCGGGTGGACTTGGACCTGTCACTGAGCAAGC
TCTGGAAATCCCGCATCGAAAGTTTTCTGAAGATTCTATCGCATCCGCGA
TGGGCAACGGTCAAGATGGAAATGGACAGTCTAAAGGTCAATCTCAACCG
ATGGGCAGATGGGGACAGTTACTGAAGCAGCCAACTTCAGATCAACAAAG
AGAATTGCTTACTGTGATCAACAAGACGTACCAAAGCCTCCAAGAAACAC
TCACTGAACGCACCTCAAGGCTTCAACAATATGATGACATCACGAAAAAC
AATTTACACGTGCTTAATTCGGATACTTTTAAACAGTTCCAGGATTCTAT
TGCAAAAACGCAGACGACGCCAGAGGTCTCGGAACAAGCTACTAGTGTTG
ACGTCATAAATATGTTAGATAAGTATTCGAATGTTCTTGTTGACATGATA
AGCTCTAAAATCAGGACCAAAGATTCGCTGACCGAGTGATGACTTTGGAA
GAATGTAAACAAAGTATGGACCGGTTGGTTGAATCGTTTAGAAATGCTTC
TGAAATTGAGAAAAGAAATTCTTCAAAGATTGAAGAAAAAGATGAAGACA
CGCACAAAGAAACTGAAAACCATCAAGATGAAGATCATTTGCAAAGTGAT
CATGAACAAGCAACATGTGATAATGTCGGCAATGGCTCGCAACGTCATCA
CCAATAACCTAAAGAAAACAAAGAACATTAGTAAAAGTTGCGTCAACTTA
TCTTTCACGCAAGAGCTCGACGACTTAAGAAACTCTAAAGAGAAATTCAA
AAACACGATTCCGAGTACCCCGTCGGCAAGTTCAATCAACGATTTATTGA
CATCTGATCCACGACGTAGTAGCACACCTATGAACAATCATAATCGCAAG
TGGAACAACAGGCGGACGACTAATGCATGGTCATCTCAGAAACCACAATC
CCCAGTCGGCTCACCGCTCGCTAATCATCAATCGCAATCGGTGACTGATT
TGTTTCGTAACCCGGCTCCCCTTTCACCTTTATCCAATGAACGAAAGACT
TTTCCTGAATCCTCACCCGTTAGTGTGAGTACAGAAAATGTTGTCCGCCG
ATCAGGAGCACGAAGAAATCGCTCGCGTCCGCGCTCAATGGTAATTGAAC
CAACCACAGTGCGAGACAAGCGCAGTGAGATTCGCATCAGCCGCGCGGAC
TCATTACGCACGCCTTCCCAATCGCATTCCGATACAGAAATAGAGGAAAG
TACAATTGAGAATTCAGTTTTTAATTCAATCACTAAAACACAATCAGTCG
TTACATCACCAACACGCCCAACACAAATTCCTGAAATGCCCGTTACCGCC
CATATTTCTGAAACGACCGTCGCCGCTCTTATTTCAACGCCCACCAAAGA
CGGTAAGCGTGAAATTGACATCGATGAACAATTACTGAGCGAAAGCGAAG
CGGAACGCGTCCGACGTATCGCACAACAGATCAACGACAATGTACGACAC
TTGCAACAACAGAACAGTTTGAACGGCAGTCGTGAGAATATTGAGGAAGA
CGAGTTACGAGATACTAAAGAATTGATACGACTTTATGAGACGGGTTTGA
TAGGAACACACGGAAAATTGATCAGCTGTTCGCCTCCAGAGCGTGACGTA
CCAAGCTCTACTAGCGAACAACAGCTTAAAGCTAAGCTCGGTAACCACCC
TTCATCAGCATCACAAACAACATCTACTAATACCAACAACATAATTCATG
AACGCCCACCGCCCACTCAAGCCTCTGCACCTAACCTTTCAACCGCCCAA
CGAGCCGCCAATCGAAAAGCGTCAATGGATGCTGCAGCGTGTATGTCTCT
AAAGAATAAGGTCGAGTACAAATTCAACAGGAACAGCAGACGAGCAAAGA
AAACGACTTGAAAATAAGACGTTGACACAGAAACGGACCCGGAAAAAGAG
AGCGATATGGACCGACAATCAAGTTCCGATGTTGAAAGTGATAACGATGA
AGCTTTCTCACCTCTCATGGAACACTTCGAGGAGTTGGCTACACCTGCCA
AGATTTTATCCGCGTCAAGATCTCGCAGTAGTTCTAGTACGGAACCAGTT
GAGCCACAGAATGCATTGCAACAGAAATTTGTACCGGGACACCGTGCGAG
TATTTCAGCCAAATTTCTATCAAGATCACAAAAATCTTCTTCAACAAGAA
TGGTGAAACGATTGATTTAAATGGAACAGGACTTTTTACGTCACTGAATC
ACGTGGTTCACAATCAGCCAATAAGACGTTCAATCAAGAAGAAGTCATTT
ATCCTCCTATCGAAGAAGACACTGCAATGATGGATCCTGAAAACACAGTG
AAAACCCTATTGATGGCGAACCGGGTGGACTTGGACCTGTCACTGAGCAA
GCTCTGGAAATCCCGCATCGAAAGTTTTCTGAAGATTCTATCGCATCCGC
GATGGGCAACGGTCAAGATGGAAATGGACAGTCTAAAGGTCAATCTCAAC
CGATGGGCAGATGGGGACAGTTACTGAAGCAGCCAACTTCAGATCAACAA
AGAGAATTGCTTACTGTGATCAACAAGACGTACCAAAGCCTCCAAGAAAC
ACTCACTGAACGCACCTCAAGGCTTCAACAATATGATGACATCACGAAAA
ACAATTTACACGTGCTTAATTCGGATACTTTTAAACAGTTCCAGGATTCT
ATTGCAAAAACGCAGACGACGCCAGAGGTCTCGGAACAAGCTACTAGTGT
TGACGTCATAAATATGTTAGATAAGTATTCGAATGTTCTTGTTGACATGA
TAAGCTCTAAAATCAGGACCAAAGATTCGCTGACCGAGTGATGACTTTGG
AAGAATGTAAACAAAGTATGGACCGGTTGGTTGAATCGTTTAGAAATGCT
TCTGAAATTGAGAAAAGAAATTCTTCAAAGATTGAAGAAAAAGATGAAGA
CACGCACAAAGAAACTGAAAACCATCAAGATGAAGATCATTTGCAAAGTG
ATCATGAACAAGCAACATGTGATAATGTCGGCAATGGCTCGCAACGTCAT
CACCAATAACCTAAAGAAAACAAAGAACATTAGTAAAAGTTGCGTCAACT
TATCTTTCACGCAAGAGCTCGACGACTTAAGAAACTCTAAAGAGAAATTC
AAAAACACGATTCCGAGTACCCCGTCGGCAAGTTCAATCAACGATTTATT
GACATCTGATCCACGACGTAGTAGCACACCTATGAACAATCATAATCGCA
AGTGGAACAACAGGCGGACGACTAATGCATGGTCATCTCAGAAACCACAA
TCCCCAGTCGGCTCACCGCTCGCTAATCATCAATCGCAATCGGTGACTGA
TTTGTTTCGTAACCCGGCTCCCCTTTCACCTTTATCCAATGAACGAAAGA
CTTTTCCTGAATCCTCACCCGTTAGTGTGAGTACAGAAAATGTTGTCCGC
CGATCAGGAGCACGAAGAAATCGCTCGCGTCCGCGCTCAATGGTAATTGA
ACCAACCACAGTGCGAGACAAGCGCAGTGAGATTCGCATCAGCCGCGCGG
ACTCATTACGCACGCCTTCCCAATCGCATTCCGATACAGAAATAGAGGAA
AGTACAATTGAGAATTCAGTTTTTAATTCAATCACTAAAACACAATCAGT
CGTTACATCACCAACACGCCCAACACAAATTCCTGAAATGCCCGTTACCG
CCCATATTTCTGAAACGACCGTCGCCGCTCTTATTTCAACGCCCACCAAA
GACGGTAAGCGTGAAATTGACATCGATGAACAATTACTGAGCGAAAGCGA
AGCGGAACGCGTCCGACGTATCGCACAACAGATCAACGACAATGTACGAC
ACTTGCAACAACAGAACAGTTTGAACGGCAGTCGTGAGAATATTGAGGAA
GACGAGTTACGAGATACTAAAGAATTGATACGACTTTATGAGACGGGTTT
GATAGGAACACACGGAAAATTGATCAGCTGTTCGCCTCCAGAGCGTGACG
TACCAAGCTCTACTAGCGAACAACAGCTTAAAGCTAAGCTCGGTAACCAC
CCTTCATCAGCATCACAAACAACATCTACTAATACCAACAACATAATTCA
TGAACGCCCACCGCCCACTCAAGCCTCTGCACCTAACCTTTCAACCGCCC
AACGAGCCGCCAATCGAAAAGCGTCAATGGATGCTGCAGCGTGTATGTCT
CTAAAGAATAAGGTCGAGTACAAATTCAACAGGAACAGCAGACGAGCAAA
GAAAACGACTTGAAAATAAGACGTTGACACAGAAACGGACCCGGAAAAAG
AGAGCGATATGGACCGACAATCAAGTTCCGATGTTGAAAGTGATAACGAT
GAAGCTTTCTCACCTCTCATGGAACACTTCGAGGAGTTGGCTACACCTGC
CAAGATTTTATCCGCGTCAAGATCTCGCAGTAGTTCTAGTACGGAACCAG
TTGAGCCACAGAATGCATTGCAACAGAAATTTGTACCGGGACACCGTGCG
AGTATTTCAGCCAAATTTCTATCAAGATCACAAAAATCTTCTTCAACAAG
AATGGTGAAACGATTGATTTAAATGGAACAGGACTTTTTACGTCACTGAA
TCACGTGGTTCACAATCAGCCAATAAGACGTTCAATCAAGAAGAAGTCAT
TTATCCTCCTATCGAAGAAGACACTGCAATGATGGATCCTGAAAACACAG
TGAAAACCCTATTGATGGCGAACCGGGTGGACTTGGACCTGTCACTGAGC
AAGCTCTGGAAATCCCGCATCGAAAGTTTTCTGAAGATTCTATCGCATCC
GCGATGGGCAACGGTCAAGATGGAAATGGACAGTCTAAAGGTCAATCTCA
ACCGATGGGCAGATGGGGACAGTTACTGAAGCAGCCAACTTCAGATCAAC
AAAGAGAATTGCTTACTGTGATCAACAAGACGTACCAAAGCCTCCAAGAA
ACACTCACTGAACGCACCTCAAGGCTTCAACAATATGATGACATCACGAA
AAACAATTTACACGTGCTTAATTCGGATACTTTTAAACAGTTCCAGGATT
CTATTGCAAAAACGCAGACGACGCCAGAGGTCTCGGAACAAGCTACTAGT
GTTGACGTCATAAATATGTTAGATAAGTATTCGAATGTTCTTGTTGACAT
GATAAGCTCTAAAATCAGGACCAAAGATTCGCTGACCGAGTGATGACTTT
GGAAGAATGTAAACAAAGTATGGACCGGTTGGTTGAATCGTTTAGAAATG
CTTCTGAAATTGAGAAAAGAAATTCTTCAAAGATTGAAGAAAAAGATGAA
GACACGCACAAAGAAACTGAAAACCATCAAGATGAAGATCATTTGCAAAG
TGATCATGAACAAGCAACATGTGATAATGTCGGCAATGGCTCGCAACGTC
ATCACCAATAACCTAAAGAAAACAAAGAACATTAGTAAAAGTTGCGTCAA
CTTATCTTTCACGCAAGAGCTCGACGACTTAAGAAACTCTAAAGAGAAAT
TCAAAAACACGATTCCGAGTACCCCGTCGGCAAGTTCAATCAACGATTTA
TTGACATCTGATCCACGACGTAGTAGCACACCTATGAACAATCATAATCG
CAAGTGGAACAACAGGCGGACGACTAATGCATGGTCATCTCAGAAACCAC
AATCCCCAGTCGGCTCACCGCTCGCTAATCATCAATCGCAATCGGTGACT
GATTTGTTTCGTAACCCGGCTCCCCTTTCACCTTTATCCAATGAACGAAA
GACTTTTCCTGAATCCTCACCCGTTAGTGTGAGTACAGAAAATGTTGTCC
GCCGATCAGGAGCACGAAGAAATCGCTCGCGTCCGCGCTCAATGGTAATT
GAACCAACCACAGTGCGAGACAAGCGCAGTGAGATTCGCATCAGCCGCGC
GGACTCATTACGCACGCCTTCCCAATCGCATTCCGATACAGAAATAGAGG
AAAGTACAATTGAGAATTCAGTTTTTAATTCAATCACTAAAACACAATCA
GTCGTTACATCACCAACACGCCCAACACAAATTCCTGAAATGCCCGTTAC
CGCCCATATTTCTGAAACGACCGTCGCCGCTCTTATTTCAACGCCCACCA
AAGACGGTAAGCGTGAAATTGACATCGATGAACAATTACTGAGCGAAAGC
GAAGCGGAACGCGTCCGACGTATCGCACAACAGATCAACGACAATGTACG
ACACTTGCAACAACAGAACAGTTTGAACGGCAGTCGTGAGAATATTGAGG
AAGACGAGTTACGAGATACTAAAGAATTGATACGACTTTATGAGACGGGT
TTGATAGGAACACACGGAAAATTGATCAGCTGTTCGCCTCCAGAGCGTGA
CGTACCAAGCTCTACTAGCGAACAACAGCTTAAAGCTAAGCTCGGTAACC
ACCCTTCATCAGCATCACAAACAACATCTACTAATACCAACAACATAATT
CATGAACGCCCACCGCCCACTCAAGCCTCTGCACCTAACCTTTCAACCGC
CCAACGAGCCGCCAATCGAAAAGCGTCAATGGATGCTGCAGCGTGTATGT
CTCTAAAGAATAAGGTCGAGTACAAATTCAACAGGAACAGCAGACGAGCA
AAGAAAACGACTTGAAAATAAGACGTTGACACAGAAACGGACCCGGAAAA
AGAGAGCGATATGGACCGACAATCAAGTTCCGATGTTGAAAGTGATAACG
ATGAAGCTTTCTCACCTCTCATGGAACACTTCGAGGAGTTGGCTACACCT
GCCAAGATTTTATCCGCGTCAAGATCTCGCAGTAGTTCTAGTACGGAACC
AGTTGAGCCACAGAATGCATTGCAACAGAAATTTGTACCGGGACACCGTG
CGAGTATTTCAGCCAAATTTCTATCAAGATCACAAAAATCTTCTTCAACA
AGAATGGTGAAACGATTGATTTAAATGGAACAGGACTTTTTACGTCACTG
AATCACGTGGTTCACAATCAGCCAATAAGACGTTCAATCAAGAAGAAGTC
ATTTATCCTCCTATCGAAGAAGACACTGCAATGATGGATCCTGAAAACAC
AGTGAAAACCCTATTGATGGCGAACCGGGTGGACTTGGACCTGTCACTGA
GCAAGCTCTGGAAATCCCGCATCGAAAGTTTTCTGAAGATTCTATCGCAT
CCGCGATGGGCAACGGTCAAGATGGAAATGGACAGTCTAAAGGTCAATCT
CAACCGATGGGCAGATGGGGACAGTTACTGAAGCAGCCAACTTCAGATCA
ACAAAGAGAATTGCTTACTGTGATCAACAAGACGTACCAAAGCCTCCAAG
AAACACTCACTGAACGCACCTCAAGGCTTCAACAATATGATGACATCACG
AAAAACAATTTACACGTGCTTAATTCGGATACTTTTAAACAGTTCCAGGA
TTCTATTGCAAAAACGCAGACGACGCCAGAGGTCTCGGAACAAGCTACTA
GTGTTGACGTCATAAATATGTTAGATAAGTATTCGAATGTTCTTGTTGAC
ATGATAAGCTCTAAAATCAGGACCAAAGATTCGCTGACCGAGTGATGACT
TTGGAAGAATGTAAACAAAGTATGGACCGGTTGGTTGAATCGTTTAGAAA
TGCTTCTGAAATTGAGAAAAGAAATTCTTCAAAGATTGAAGAAAAAGATG
AAGACACGCACAAAGAAACTGAAAACCATCAAGATGAAGATCATTTGCAA
AGTGATCATGAACAAGCAACATGTGATAATGTCGGCAATGGCTCGCAACG
TCATCACCAATAACCTAAAGAAAACAAAGAACATTAGTAAAAGTTGCGTC
AACTTATCTTTCACGCAAGAGCTCGACGACTTAAGAAACTCTAAAGAGAA
ATTCAAAAACACGATTCCGAGTACCCCGTCGGCAAGTTCAATCAACGATT
TATTGACATCTGATCCACGACGTAGTAGCACACCTATGAACAATCATAAT
CGCAAGTGGAACAACAGGCGGACGACTAATGCATGGTCATCTCAGAAACC
ACAATCCCCAGTCGGCTCACCGCTCGCTAATCATCAATCGCAATCGGTGA
CTGATTTGTTTCGTAACCCGGCTCCCCTTTCACCTTTATCCAATGAACGA
AAGACTTTTCCTGAATCCTCACCCGTTAGTGTGAGTACAGAAAATGTTGT
CCGCCGATCAGGAGCACGAAGAAATCGCTCGCGTCCGCGCTCAATGGTAA
TTGAACCAACCACAGTGCGAGACAAGCGCAGTGAGATTCGCATCAGCCGC
GCGGACTCATTACGCACGCCTTCCCAATCGCATTCCGATACAGAAATAGA
GGAAAGTACAATTGAGAATTCAGTTTTTAATTCAATCACTAAAACACAAT
CAGTCGTTACATCACCAACACGCCCAACACAAATTCCTGAAATGCCCGTT
ACCGCCCATATTTCTGAAACGACCGTCGCCGCTCTTATTTCAACGCCCAC
CAAAGACGGTAAGCGTGAAATTGACATCGATGAACAATTACTGAGCGAAA
GCGAAGCGGAACGCGTCCGACGTATCGCACAACAGATCAACGACAATGTA
CGACACTTGCAACAACAGAACAGTTTGAACGGCAGTCGTGAGAATATTGA
GGAAGACGAGTTACGAGATACTAAAGAATTGATACGACTTTATGAGACGG
GTTTGATAGGAACACACGGAAAATTGATCAGCTGTTCGCCTCCAGAGCGT
GACGTACCAAGCTCTACTAGCGAACAACAGCTTAAAGCTAAGCTCGGTAA
CCACCCTTCATCAGCATCACAAACAACATCTACTAATACCAACAACATAA
TTCATGAACGCCCACCGCCCACTCAAGCCTCTGCACCTAACCTTTCAACC
GCCCAACGAGCCGCCAATCGAAAAGCGTCAATGGATGCTGCAGCGTGTAT
GTCTCTAAAGAATAAGGTCGAGTACAAATTCAACAGGAACAGCAGACGAG
CAAAGAAAACGACTTGAAAATAAGACGTTGACACAGAAACGGACCCGGAA
AAAGAGAGCGATATGGACCGACAATCAAGTTCCGATGTTGAAAGTGATAA
CGATGAAGCTTTCTCACCTCTCATGGAACACTTCGAGGAGTTGGCTACAC
CTGCCAAGATTTTATCCGCGTCAAGATCTCGCAGTAGTTCTAGTACGGAA
CCAGTTGAGCCACAGAATGCATTGCAACAGAAATTTGTACCGGGACACCG
TGCGAGTATTTCAGCCAAATTTCTATCAAGATCACAAAAATCTTCTTCAA
CAAGAATGGTGAAACGATTGATTTAAATGGAACAGGACTTTTTACGTCAC
TGAATCACGTGGTTCACAATCAGCCAATAAGACGTTCAATCAAGAAGAAG
TCATTTATCCTCCTATCGAAGAAGACACTGCAATGATGGATCCTGAAAAC
ACAGTGAAAACCCTATTGATGGCGAACCGGGTGGACTTGGACCTGTCACT
GAGCAAGCTCTGGAAATCCCGCATCGAAAGTTTTCTGAAGATTCTATCGC
ATCCGCGATGGGCAACGGTCAAGATGGAAATGGACAGTCTAAAGGTCAAT
CTCAACCGATGGGCAGATGGGGACAG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_045515XLOC_045515Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
Putative cnidarian restricted proteinTCONS_00073356-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073356-exon-scaffold_90-1575043694:137054..137455TCONS_00073356-exon-scaffold_90-1575043694:137054..137455Clytia hemisphaericaexon
TCONS_00073356-exon-scaffold_90-1575043694:136520..136593TCONS_00073356-exon-scaffold_90-1575043694:136520..136593Clytia hemisphaericaexon
TCONS_00073356-exon-scaffold_90-1575043694:135638..135711TCONS_00073356-exon-scaffold_90-1575043694:135638..135711Clytia hemisphaericaexon
TCONS_00073356-exon-scaffold_90-1575043694:135391..135459TCONS_00073356-exon-scaffold_90-1575043694:135391..135459Clytia hemisphaericaexon
TCONS_00073356-exon-scaffold_90-1575043694:134227..134304TCONS_00073356-exon-scaffold_90-1575043694:134227..134304Clytia hemisphaericaexon
TCONS_00073356-exon-scaffold_90-1575043694:133966..133995TCONS_00073356-exon-scaffold_90-1575043694:133966..133995Clytia hemisphaericaexon
TCONS_00073356-exon-scaffold_90-1575043694:133630..133685TCONS_00073356-exon-scaffold_90-1575043694:133630..133685Clytia hemisphaericaexon
TCONS_00073356-exon-scaffold_90-1575043694:132914..132971TCONS_00073356-exon-scaffold_90-1575043694:132914..132971Clytia hemisphaericaexon
TCONS_00073356-exon-scaffold_90-1575043694:132613..132643TCONS_00073356-exon-scaffold_90-1575043694:132613..132643Clytia hemisphaericaexon
TCONS_00073356-exon-scaffold_90-1575043694:131962..132244TCONS_00073356-exon-scaffold_90-1575043694:131962..132244Clytia hemisphaericaexon
TCONS_00073356-exon-scaffold_90-1575043694:129958..130012TCONS_00073356-exon-scaffold_90-1575043694:129958..130012Clytia hemisphaericaexon
TCONS_00073356-exon-scaffold_90-1575043694:129297..129482TCONS_00073356-exon-scaffold_90-1575043694:129297..129482Clytia hemisphaericaexon
TCONS_00073356-exon-scaffold_90-1575043694:127689..128678TCONS_00073356-exon-scaffold_90-1575043694:127689..128678Clytia hemisphaericaexon
TCONS_00073356-exon-scaffold_90-1575043694:127238..127355TCONS_00073356-exon-scaffold_90-1575043694:127238..127355Clytia hemisphaericaexon
TCONS_00073356-exon-scaffold_90-1575043694:126726..126802TCONS_00073356-exon-scaffold_90-1575043694:126726..126802Clytia hemisphaericaexon
TCONS_00073356-exon-scaffold_90-1575043694:124668..126218TCONS_00073356-exon-scaffold_90-1575043694:124668..126218Clytia hemisphaericaexon
TCONS_00073356-exon-scaffold_90-1510915933:137054..137455TCONS_00073356-exon-scaffold_90-1510915933:137054..137455Clytia hemisphaericaexon
TCONS_00073356-exon-scaffold_90-1510915933:136520..136593TCONS_00073356-exon-scaffold_90-1510915933:136520..136593Clytia hemisphaericaexon
TCONS_00073356-exon-scaffold_90-1510915933:135638..135711TCONS_00073356-exon-scaffold_90-1510915933:135638..135711Clytia hemisphaericaexon
TCONS_00073356-exon-scaffold_90-1510915933:135391..135459TCONS_00073356-exon-scaffold_90-1510915933:135391..135459Clytia hemisphaericaexon
TCONS_00073356-exon-scaffold_90-1510915933:134227..134304TCONS_00073356-exon-scaffold_90-1510915933:134227..134304Clytia hemisphaericaexon
TCONS_00073356-exon-scaffold_90-1510915933:133966..133995TCONS_00073356-exon-scaffold_90-1510915933:133966..133995Clytia hemisphaericaexon
TCONS_00073356-exon-scaffold_90-1510915933:133630..133685TCONS_00073356-exon-scaffold_90-1510915933:133630..133685Clytia hemisphaericaexon
TCONS_00073356-exon-scaffold_90-1510915933:132914..132971TCONS_00073356-exon-scaffold_90-1510915933:132914..132971Clytia hemisphaericaexon
TCONS_00073356-exon-scaffold_90-1510915933:132613..132643TCONS_00073356-exon-scaffold_90-1510915933:132613..132643Clytia hemisphaericaexon
TCONS_00073356-exon-scaffold_90-1510915933:131962..132244TCONS_00073356-exon-scaffold_90-1510915933:131962..132244Clytia hemisphaericaexon
TCONS_00073356-exon-scaffold_90-1510915933:129958..130012TCONS_00073356-exon-scaffold_90-1510915933:129958..130012Clytia hemisphaericaexon
TCONS_00073356-exon-scaffold_90-1510915933:129297..129482TCONS_00073356-exon-scaffold_90-1510915933:129297..129482Clytia hemisphaericaexon
TCONS_00073356-exon-scaffold_90-1510915933:127689..128678TCONS_00073356-exon-scaffold_90-1510915933:127689..128678Clytia hemisphaericaexon
TCONS_00073356-exon-scaffold_90-1510915933:127238..127355TCONS_00073356-exon-scaffold_90-1510915933:127238..127355Clytia hemisphaericaexon
TCONS_00073356-exon-scaffold_90-1510915933:126726..126802TCONS_00073356-exon-scaffold_90-1510915933:126726..126802Clytia hemisphaericaexon
TCONS_00073356-exon-scaffold_90-1510915933:124668..126218TCONS_00073356-exon-scaffold_90-1510915933:124668..126218Clytia hemisphaericaexon
TCONS_00073356-exon-scaffold_90-1491911889:137054..137455TCONS_00073356-exon-scaffold_90-1491911889:137054..137455Clytia hemisphaericaexon
TCONS_00073356-exon-scaffold_90-1491911889:136520..136593TCONS_00073356-exon-scaffold_90-1491911889:136520..136593Clytia hemisphaericaexon
TCONS_00073356-exon-scaffold_90-1491911889:135638..135711TCONS_00073356-exon-scaffold_90-1491911889:135638..135711Clytia hemisphaericaexon
TCONS_00073356-exon-scaffold_90-1491911889:135391..135459TCONS_00073356-exon-scaffold_90-1491911889:135391..135459Clytia hemisphaericaexon
TCONS_00073356-exon-scaffold_90-1491911889:134227..134304TCONS_00073356-exon-scaffold_90-1491911889:134227..134304Clytia hemisphaericaexon
TCONS_00073356-exon-scaffold_90-1491911889:133966..133995TCONS_00073356-exon-scaffold_90-1491911889:133966..133995Clytia hemisphaericaexon
TCONS_00073356-exon-scaffold_90-1491911889:133630..133685TCONS_00073356-exon-scaffold_90-1491911889:133630..133685Clytia hemisphaericaexon
TCONS_00073356-exon-scaffold_90-1491911889:132914..132971TCONS_00073356-exon-scaffold_90-1491911889:132914..132971Clytia hemisphaericaexon
TCONS_00073356-exon-scaffold_90-1491911889:132613..132643TCONS_00073356-exon-scaffold_90-1491911889:132613..132643Clytia hemisphaericaexon
TCONS_00073356-exon-scaffold_90-1491911889:131962..132244TCONS_00073356-exon-scaffold_90-1491911889:131962..132244Clytia hemisphaericaexon
TCONS_00073356-exon-scaffold_90-1491911889:129958..130012TCONS_00073356-exon-scaffold_90-1491911889:129958..130012Clytia hemisphaericaexon
TCONS_00073356-exon-scaffold_90-1491911889:129297..129482TCONS_00073356-exon-scaffold_90-1491911889:129297..129482Clytia hemisphaericaexon
TCONS_00073356-exon-scaffold_90-1491911889:127689..128678TCONS_00073356-exon-scaffold_90-1491911889:127689..128678Clytia hemisphaericaexon
TCONS_00073356-exon-scaffold_90-1491911889:127238..127355TCONS_00073356-exon-scaffold_90-1491911889:127238..127355Clytia hemisphaericaexon
TCONS_00073356-exon-scaffold_90-1491911889:126726..126802TCONS_00073356-exon-scaffold_90-1491911889:126726..126802Clytia hemisphaericaexon
TCONS_00073356-exon-scaffold_90-1491911889:124668..126218TCONS_00073356-exon-scaffold_90-1491911889:124668..126218Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_90supercontigscaffold_90:124668..137455 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
6.92625 6.35296 3.46718 3.95149 19.5912 14.915 15.6199 17.9623 7.77844 10.3328 9.69681 7.21211 9.95906 10.9657 8.91097 10.8461 10.88 10.5668 10.5159 9.5338 13.7521 12.1347 8.41072 9.9005 17.2825 16.6442 6.7102 6.33911 10.8939 9.98658
Blast
The following BLAST results are available for this feature:
BLAST of TCONS_00073356 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 0
Match NameE-valueIdentityDescription
back to top