Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00073355 (transcript) - C. hemisphaerica

Overview
NameTCONS_00073355
Unique NameTCONS_00073355
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length3470

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00073355 ID=TCONS_00073355|Name=TCONS_00073355|organism=Clytia hemisphaerica|type=transcript|length=3470bp
tctAGATCAAACGTATTTAAATAATGAGATAAGTATTACATAGAATCtaa
caataaataaaaatggcTTTCGTTGAATTTGCTGATGGTGACTCAAAGCC
ACGGTTCAAGCCAACCCATGTGAGTGACCTGCCACATGATATTATTGAAG
AGATTAGCTGCTGTCTGAATCCCAGACTGTTAAGGAAGGATTATCGTTCA
CTTGCTGGGAAAATGGGGATGACACATCGGCAAGTAAAAAACATTGACTC
AAAACAAAATCCAACAGAGGAACTGATCAACCTCTGGGTAACTGGTCCAG
GATCCAAGACAGTGACTGATCTGATGGGCAAACTTAAAGAAATTGAGCGC
CATGACGCAATAAGGATTCTGCAGGAGCATGAATTCACagtaaTTGAAAG
ACCAACTTCCATATCTTCTGCTGGTTCACTAACCAAGGAACCAATAGAGA
ACGACAGCTTTAGTGataCCAACAGTAGAATTTTGGAGCACTCTTACCAT
AACTCACATTACCCTCCGCCACCATCATCCTACCCTCCCTCTTCGTACCC
ACCGTCTTCGTACCCATCATCTTCATACCCATCATACACCGCTTCAAACC
CTTCAACAACTTCAACATTGCTAGCTGAAGACCCTGATACAGATGAGGAG
ACAAACATGTCTATTGTGTCAGGCTCAATATCCAATCGTACAAGCTCATC
ACTGGATGGAtATCTAGACGGCACAAGTAATCCAAGGAGCCGTGCAAGCA
CCAACGATCATTTAGAATACAACAATCGTTATTCAGGTCATCATTCAATG
ACAAATGACTATCAACACCAGCACCACTATCGTCCACATTCACCACCACC
AAATATGCAAAACATGACTACTGGTGAATTTTTACGTGACTTTCCAAGAG
ATTTCGCGCCCATTCCGCCACCGTCGATCCTGCCACCACCACCATCGTCA
CAAAACAGACCAACTACAAACGACGACTTTTATGAGGATATACTGGCTGA
GAAGTTGAGGAATCAACAAGAACACCAACAACGTCATCAAGGATGTGAAG
TTAACGATGaaAACTGTCATCCGAATTACCAGTTCAGGCTTCGTGAGGGC
TCAGACGCATCCACATCGACAGCAAGCTCAAGAATGGACGCTGGAATCCA
AACGGAAAAAGtGTCACCTACGATGGGAGATCTACCACCGCAAAATTTTG
CAACTACTCCCGGTCCAGAATTAAATTGCAAACCACCATTAGTAGCTTCG
GACAAAATCGCGCTATTAATCGGGAACACAAATTATAAACACTTGGAAGA
ACCCTTGGTGTTTCCTCACAGAGACGTATACGCCCTTGGTCACGCCTTAA
ATGAGCTCGGATTTAAAGTGTTGACTCTTGTTGACTTGACCTTACGGGAA
ATGAGGACCATCATGCTTGCGTATTGTCAACTTCTTGGTCCTGGTGTTTT
CGCTGTTTTTTATTTCGCTGGTCACGGTTTTGAAGAGAATGGCAAGAATT
ATTTGATGCCCATTGATGCGACCAGCACCAAAGGAGACGAATTTATTCAA
GCTCAAGAAATCTTAACCGAAATGAGACTGGCAAACACAGCtctgaattt
atttattattgatGCTTGCCGCGTGAAAGGTATAAATGTATCAAGCACAA
GAGGAACTCTCCAGAAAACTGGCTTTGGAAACACGATCATGGCTTATAGT
TGTTCAAGTTCAATGCCAGCTTTCGAAGCGCACGATCTCAGCCATGGAAT
CTACATGACGCATCTGCTACCACGTATCAAGGAGGACAAAAGAATAGAAC
ACATCTTGATGGAGGTCAATGAGGCGGTACATGGAAACCCATTGGTCGTC
CAACGCCCAGTTTTCGAAAGCGACGCTATTGGTGATTGTAGGCTGACCTG
TAAAATTGACGCTCAGGCAAATTATGAACACTGGTCACAGCGTTTTGACA
AATGGTTTGAGGCTACTCAACCACCAGAGGGGCAAACGATTTCccgtgaa
gaagaaaaacttcGATTGCGACTCGAGTACAAATCAATGTTCTCGAACAT
GTTGCAAATTAATGTTTCAATTTCCAATCAAAACGACGCACCATTCTTTT
TGAGGGATGTCAAACTTCGTAACACATCCCATTTGGAGATCCACGAGAAT
CGTCTCTTACCGGAAGGCTTTTTGCCGCCCTGTTCGGGATTCAAGGACGT
GGTTTCATTCCGTATCCGTGACCTGCAAAAGGTGACTTACGAACTGTTAT
TAGTATTGGAGATcactgcctctttaaaaaacgaACCTTGTAACGTGGAA
GTCAAACTGAACGCCGACTTTCCACTCATTTCAAGCTTtatacaagaatt
tttgtcttGGATCACGGCGGATAAGAGGGCCACTGGTGGGATGAAAAACA
CATGGGTCTGATGCATACTTGTAGGGTGTTTTATATTGACCCTCACTCTT
TTGGTGTGTTGTTCTATGGCAGCAAAAATGCATGGAATTTTGCGACATGA
CTGCATTCTTTTTAGTTCTGACCACACATAGTTTTTCTATGGACCATATA
AGTGATTTAAATAACATAAAATTCTAACTGGCGAGAAGCTGATCTTTTTC
GTGCCAGTATTTTGTTTAGCTAGCTGACGTTGTTATCAAAACATCATTCT
AAAAACATTGTTGTCGTACTGCGATGTTAGCCGGACTGAATTTTATGTAT
TTAAATCGCTTGGCAAGATTCTGTCTATTACTATTCTATCTCTCTCTCTC
TGTATATAGTCTTCTTCCTCTGACAATGTTTAATAGTTCAAAGATGAGGA
ATGAaccaagaaaaaaatgaagaattatTTTAGAggttttttcttcgatt
ttttaaGCAATTTGTATAAAGTATATAAttaaaagacaatttttttgatt
tagttattaaaaacaatttattttgCATCCAACTCTATTAgattcatttt
gtttgtttgtttgatgaagtatatttttattgtttgttattgtttgttAC
CACTTAGTTAGAGTCACGCCCAATTAATTAATCTTCGGGGCAATTATGAC
CATCCTTTTTTTTGACCGTTTTTCTTTCGCCCCAATAAGATTCTTTTGGA
AAGTAAAAGTAATTTGTGAATTCCCAAACTTCAGGCAGGGCCTGTATTTG
GGGAGCAAGTTCACAGTTTTAATATATTTGTATTTTACTTGGTGAGCTAA
AAGTTGTACTAATTTCTTCTTTGACATTAACCTCGctacgttttttgttt
tctctactgattttattttattatttattaatttctggTAGTGCTATTCT
TTTACCAGTTaacataatttttgtttttatcatgtTTGTAAGTGGTGCAT
AAAAATCTTGAGCCTCGTTTTCGAATACTTTTGTCAAGGACGCTCAGCCT
CGTTGGACGCTTTGTTTGAGAACGTgagtgttttcaaaaatttacataAC
AATCTTTTTGGTAATTTCTT
Run BLAST on NCBI

protein sequence of TCONS_00073355-protein

>TCONS_00073355-protein ID=TCONS_00073355-protein|Name=TCONS_00073355-protein|organism=Clytia hemisphaerica|type=polypeptide|length=782bp
MAFVEFADGDSKPRFKPTHVSDLPHDIIEEISCCLNPRLLRKDYRSLAGK
MGMTHRQVKNIDSKQNPTEELINLWVTGPGSKTVTDLMGKLKEIERHDAI
RILQEHEFTVIERPTSISSAGSLTKEPIENDSFSDTNSRILEHSYHNSHY
PPPPSSYPPSSYPPSSYPSSSYPSYTASNPSTTSTLLAEDPDTDEETNMS
IVSGSISNRTSSSLDGYLDGTSNPRSRASTNDHLEYNNRYSGHHSMTNDY
QHQHHYRPHSPPPNMQNMTTGEFLRDFPRDFAPIPPPSILPPPPSSQNRP
TTNDDFYEDILAEKLRNQQEHQQRHQGCEVNDENCHPNYQFRLREGSDAS
TSTASSRMDAGIQTEKVSPTMGDLPPQNFATTPGPELNCKPPLVASDKIA
LLIGNTNYKHLEEPLVFPHRDVYALGHALNELGFKVLTLVDLTLREMRTI
MLAYCQLLGPGVFAVFYFAGHGFEENGKNYLMPIDATSTKGDEFIQAQEI
LTEMRLANTALNLFIIDACRVKGINVSSTRGTLQKTGFGNTIMAYSCSSS
MPAFEAHDLSHGIYMTHLLPRIKEDKRIEHILMEVNEAVHGNPLVVQRPV
FESDAIGDCRLTCKIDAQANYEHWSQRFDKWFEATQPPEGQTISREEEKL
RLRLEYKSMFSNMLQINVSISNQNDAPFFLRDVKLRNTSHLEIHENRLLP
EGFLPPCSGFKDVVSFRIRDLQKVTYELLLVLEITASLKNEPCNVEVKLN
ADFPLISSFIQEFLSWITADKRATGGMKNTWV
Run BLAST on NCBI

transcript from alignment at scaffold_90:84201..96659-

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00073355 ID=TCONS_00073355|Name=TCONS_00073355|organism=Clytia hemisphaerica|type=transcript|length=12459bp|location=Sequence derived from alignment at scaffold_90:84201..96659- (Clytia hemisphaerica)
TCTAGATCAAACGTATTTAAATAATGAGATAAGTATTACATAGAATCTAA CAATAAATAAAAATGGCTTTCGTTGAATTTGCTGATGGTGACTCAAAGCC ACGGTTCAAGCCAACCCATGTGAGGTAAGATGTCTGGCTCATAATACAAT ATTTTATAATTTTCAATCAGCTGAGAAAAATTACTATAAAAATGAAAGAT ATTTGTTCAAAATTTGAATTTTACTGGACCCATTCCTAGAAGAAGTGCCC ATATCATAGGATTAATTTTAAAACTAACTTGCTGCTTTCACGCCTGTTTA TTCAAATGTGTAATCTTTGTTATAATGATACTAAATCGTCAATTTTCAAT TTCAATGTTCTGTTTCAGTGACCTGCCACATGATATTATTGAAGAGATTA GCTGCTGTCTGAATCCCAGACTGTTAAGGAAGGATTATCGTTCACTTGCT GGGAAAATGGGGATGACACATCGGCAAGTAAAAAACATTGACTCAAAACA AAATCCAACAGAGGAACTGATCAACCTCTGGGTAACTGGTCCAGGATCCA AGACAGTGACTGATCTGATGGGCAAACTTAAAGAAATTGAGCGCCATGAC GCAATAAGGATTCTGCAGGAGCATGAATTCACAGGTAAAATTTAGTTTTT GTGTTATTATGCTACACATTTTCCCTTATATTTATAGCAAGCATATGGTT TAAGTGACCGGGTAGCTCAGTCGGTAGAGCATTCGCCTTACAATCTAAAG GTTGTGGGTTCGATCCGCGGTCACCGCCAACTCAGCGGATGAGTAGCTTA GATTGGGTAATCTGATTTAGGCGGTAAGTTACTGGGAGCTGAGATTAGAT GTGGCGCTCCACCTCAGTATTCGATCTCCCAGGTCTAGCGCAAATAGAAA AGGGGATAGACTCCCTCACTCCCGGCTCCGCTGACAGCCACCAGATGAAT ATACTTACTTTACTATATGGTTTTAATATTTCTTGAATGAACAATTTGAA ATGAATTTCTTTTATAAGAGGCAACTCAGATATTATATCCACCCAAAACT GAAGGTGAGATGAAAACTTGAAATTTATTTTTTCTTTTCAGTAATTGAAA GACCAACTTCCATATCTTCTGCTGGTTCACTAACCAAGGAACCAATAGAG AACGACAGCTTTAGTGGTATGTCGTTATGACACTATATCTTATCTGTCAT TCTGTCACAGGTGTAACTTAATTGGTGTACTTATATTTAATAATTTAATA TATAAAAAGAGTTATATAATTTAGTATATAAAAAAGAGTTGTTATTTTTT TACAAAAGCATGTAAATTTTATTAGTAATATCTGTGTTTCATCAATTACT TTTGCTTTCCTAGCTCTCACTACACAAGTATAGTCCTTCCATCTATTTAT TTTGATTGTTGAACATGGTCTATAATTACTGACTTATTTTAAAATAAAAG CAATTGAAATGAAATCTACATTTTCCAATTCACAAATTGTAACCAGGTTT TCCTTTTTTATCTTTTCATTTGCTTTGTTTTTTAATGTTGTAATTAACGA CCTTGTTTAATTAATGACATTCGATTGCTTTTCAAAAACAAAACTCAAAA GAAATCTTCCAGAAAAGAACAGAAACAAAAAAGCATAAAGCAAAACAACA ACATTCAAGAGACATATTGGCATTACAGATACAAGGCAAAAGTATGAGCC AAGCTCTTGTAAATACATAAAAAATTTCCTATCATAAGAACTTTCTATAT CTATATCTAAGGGGGGTGGGTGTGATTCCTTAATAATACTGAAATTCCTT TTTTTTTGGGAAAGTATGCCTGCCTATCTTTGCTTGGAGAATCTCTTGTC AATCATGCCACCCATCTTTTTCAACATAATATTCAATTTTAATTGTGAGA TGGACAGGATGGACATAGGATTTTAGTTAAGCAAACTAATAAAAACTAAT TGAAAAGTTATTATCATGTACATTTAATAATGGGCCATTCCATTTTATAT ATGTACAGGGGGATGGACGAACATTTCCGGGGGATAACCCACAAAGAATT TCCAGGGAGTCTAAATTAGTTTTTTCATTTCTTTTTTGGGGGGGGATAAA AGTTACTTAAACTTTCCAGGGGTATGAGACCAATTTTTAATCCACCCTCA CTTTAAGGCATAAAAGGAATTTTTCCAAGTGGGTTTTTTTTCTTCCAAAT TTTACGTTATTCCAGGGGTATCCACACATTAAAAAAAATGATTTGACTTG AAAGGATTTGTCCGCCCCCTGTATTGGTTTTTTATGGAACAACCCAATAT CATGTCTTATATTATCAAGTGGTACAAAATATTCACCAATTTTCTTTTTA TTTTAGATACCAACAGTAGAATTTTGGAGCACTCTTACCATAACTGTAAG TGTTTTCTCACTTATTCAGGATAAATAGACCTTATTTTTCTAAAAAAGTG ATGCATTGTGGGATTGTTTCGAGTGTATTACAATAGAATTCCCCCGAGGA ATTCCTACGAGAATTCTATTGTAATACACTCGAAACCATCCCAAATTATT CTTGAATTTTAGCACATTACCCTCCGCCACCATCATCCTACCCTCCCTCT TCGTACCCACCGTCTTCGTACCCATCATCTTCATACCCATCATACACCGC TTCAAACCCTTCAACAACTTCAACATTGCTAGCTGAAGACCCTGATACAG GTGTGTGGAAATCCGATTACTTTCAAAAGCTAAGAAAGAGAGAGAGGTGA CTGCCAAGCGCACTCGTCCAGCTGCTCCTTCGCCTCCCAGCCTGAAAGAC CCAACCCTTAGAGCCAATCCAGATATTTGATTTTGAAATTCAGAAATTTT TTTGAAAGTGATAGAAATTCAGCAAAAAGACTTTTTATTAAGTAAGGCTC GTTTACAGAAATTTCAAAATCAAATATCTCAACTTAGGAAATTATCTGTA TCAACAAATTTAAACGTTTTTCTCTGGGTCATATATTTTAAGTATCAATA TCAGATTATCCCTTAAATAATGTATTTTACAAATTTTGTTGTTTAACCTG GTTTAACTCTTCAATGATTGCATTGCATATCTTCAGATTTTGAAAATTAT ACACTGTAGATCAGAAATTAATAAATATACAAAAAGTTAGACTGCTCTGA ACTGAATACTTGAATTTTCTTTCATGTTTTTGAACTACACAATATTTTTA AAAATTGATTCAACAGATGTACCAATGAAGTATAAGCTCGAAGGGCTAGA ATCGAATCTCCTTGGTAGGATTTGAAGCCAACAAATCCTACCAAAGTTGC GCGGTCTTGAGAGGCTCACCTGGTTTTTACACAAATGACAGATTGAAACT AAAATTTACCACCAAATTTTGAAAAAGATATCAATCGTAAACAAAGGAAT TGCTAGATTTAATCTGTCTTCAAAAATACGGCGCATTTTTTAAGGCTTCA CTTTTCCTTGCTTGAGAAACGTTAGAGATTCTACTCTAGCCCTTCGGGCT TTAAACTCAATGAGATGTACAATTTAAGTGACTTTTGAACTTTTGAAGGT GAACTTTTTGTAAGAAAGACTTTTGTAAAATTGAGTTTATCATCTTCCTC TAATCATTTTTAGATGAGGAGACAAACATGTCTATTGTGTCAGGCTCAAT ATCCAATCGTACAAGCTCATCACTGGATGGATGTAAGTTGTGTTTTTTTT CAATTTTTTTCTTCAAGTTTGTCGTCAAATTTAAGCTCTCTGCTTGATTT GAAGGAATGATAGGCTAGGTGTAAGTACGAGTAGAGAAATATTTTTTGCA ACCTACACTTGGAATTCCATGCTGTACAAAGATATGAGTGTTGTTTACCA TTTTCCTCATAGATCTAGACGGCACAAGTAATCCAAGGAGCCGTGCAAGC ACCAACGATCGTAAGACTTTATGCTGTTATTTTTTCTTGAATTACTTGAA ACTTAAAAGAATATGATGAGTTCATTATTCCACTATGGGTAAAATAAATT GTCGAAACGAAAAAGTTCAAAAAGTGTCAACATTTCAAATGCAGTATCTA AGGAGGAGTGACTATAAACTTTGGGCTAACTAAACTTTCAAAGAAAGAGC CATTTGGAAGGTCAGACTTAAATTTGGTAAAAATGAGAGTTTCAGATTAT AATGATCCTTTTCCATTTACAGATTTAGAATACAACAATCGTTATTCAGG TCATCATTCAATGACAAGTAAGTCATTTGTCCAACACGTCTTTATTACTA CATGTATTACAGGTAAATTTCGAATGTTGTGTTTTAAAACCTCTTTGAAA ATTTGAAAAATTTATTTGAACTCTGTTTGAGTAAGTTCGAATTGTCCGAT TCGCAAATGTTAAAGACTTGTGTTAATCAAGATAGTTATTTGAATTTGAA CCATGTTATTAGATGCTTACTATGTATTTGTTTATATAGATGACTATCAA CACCAGCACCACTATCGTCCACATTCACCACCACCAAATATGCAAAACAT GACTACTGGTAATCCTTACTTACGTCAAGTTTGAACTGATAAGTTCATAG TGCCTTTTGTTCGTATTATAAAGTAGAGGAAAATGTCATGTCGGCTTTCT CAGTAGACAAAACCTATGATGTACTCTATGATTTCTTTGAATTTTGAATT TTTAACAACAGGTGAATTTTTACGTGACTTTCCAAGAGATTTCGCGCCCA TTCCGCCACCGTCGATCCTGCCACCACCACCATCGTCACAAAACAGACCA ACTACAAACGACGGTAAGATAACACATCATGTCTTTTAGCCATTTCAAAA ATTAGGCTTTAATAATTTCCTTTTGATATCTAAACTATACAGTGCTTTAA CGAAGAAGTAAAATCCAAAAGTCCAATCAAATTTGCCATGTTTCTCTGAA TTACTTTTAAGACCACATTTACATGCTATGGTTGCGTTTCACTCCGAAAC GAAATGAGCATGAGGAGAGCCATGTCAGAGTGCATCTAAAAGGAATGACG TCTAATGTTTGAAGTCGCTGCTTTGATTTTCTCCTGGGCATAGAAATTTG ACGTCAATCTTACCTGGTAAACTCTGATCCAGTATCCTCTAGACTAGTAA ACTAGTCGGTTATTACTTATAATAAAACTGTCAATCAAATAATGTAAACA CTAATTAAATATTCAGCGCGCATGAGATAAAAGGAAAATAACCGACTAGA AGCTTCTTCCAACGCCTTTTTTTCTTCACCTAAATTCGTAAGGAGAGACA TACAGATTTCTGTATGTCTGACCCGTGCGGGATTGCATTTATTTTTCTTT CTGTTTATTGTATTTTTGGAAATGCTCATTTATTTATATGTTCCCATATT TAATGTTACTATGAAATATTATTTAGTCAAAAAAGTTGGATGGATTCTCA AAAACCTAAAAAAGGTTGTAAAATTAAACAACGTTTTTTGAGGGAAGAAG CTTCTAGTCGTTGAAATTTAAAAAAGACACGCAACCTGACTTCTTCGATT CTTTTTATTTGGAGCTTGATTTTTTTTGTAGATGGGTCTGTTTTCAACGA CTAGTTTACTAGTCTAAGTATCCTCATGATTAGGTGTATTCCTGATATGC ACTATTTTAATGTCTTCCACAGACCAAACAGNCTGATCCAGTATTCTCAT GATTAGGTGTATTCATGATTATGTATACCAAACAGCTGATTTGTTTAAAG TGACGTAAAATCAGTCGATACGTCACTTTTAACCAATCAGCTGTTGGGTC CGTGGAAGACATTAGCGAGATTATGTTTCGGAGATATTCTACGGCTACGG TTGCGGGGCTGCCCATACGGGTCGTTATCAAAGGCGACATGTTGTTGTCT ACTTTGCTCTGTACGGGAAAAACACCAAAACACCATCTAAGCAAAGTCGA CATGATACCGTACGTCAAATATCGAACTTGCTTTCACCCGCCATTACTTG CCTTACTCGCTAATTCCCTCGCCACTTTAACCGTAGCCGTAGAGAATTCC AGATACATAATCTCGCTATTGCAATGGTGCATATGATGAATTACCAGTAA ACATTCTTTCCTCTTATTCTATTGTCATATTTCTTCTCTTAGACTTTTAT GAGGATATACTGGCTGAGAAGTTGAGGAATCAACAAGAACACCAACAACG TCATCAAGGATGTGAAGTTAACGATGGTATAATGATTATATACATTTCAC ATTACACGTTTTTTTATAAGAACATCCATAATTTTTGGAACCTTTTGATG TTTTTAACTTTTTGACTTTTAAGCCTAACATGTTCTTAACATGTTCTTAA CTTGTTCTTAACATTTTTGCCATCGAAGCCTTATGTTCTTACATAGTTTG TTCTTATAAAAAAAGTGTATTTGAAATAAATTTAAAGTGCATATTTGGAG TTCTCCATCAATTTCATTCTATACATAAGTAATTTATTGACCTTACTAAG TATTCATTGAAGTGCCGAAGGAAGAAATATAGATTCATATACTGGTGTGG GATGTTATCTTCTTTTGTTCGTTTGTGAAACTTTGAAACACAAGTTAAGA AAGCATGTTGTTTTATCATTTTAACACGCACTGATAAGATTATTATTGAC GTATGGCTGATTACTGTTCATGATATGCGCCACTGACTTCTTCGTGGAGT CATTGCAGTGGTGCATATCATGAATACATTTGTAAAAAACAAGTGAAGTA GTAGTTAACTTTCTGATTTTTATTTCTTTAGAAAACTGTCATCCGAATTA CCAGTTCAGGCTTCGTGAGGGCTCAGACGCATCCACATCGACAGGTAACC TTTACTTTGGTTTTCCATTTTTTCACTGCTCATTATTTGTGTTGGTGTTA ATATCAAAATAAAATCATTTCAAATTTTAAATTTAATATCCAGCAAAAGC TTTTCGTTCTTATAAAAACGTCATCAGTGTTGTGACTGATACGAATGATG AGTTTTTGTTGAGCTACATGTTTATGAATTCATGTAAAAATGAAGAAAAT TTCAACATAAGCAAGCGCTTCATTTTTTGTTTCATCAATTTGCTGCTCTT ACTCTTTTAAAGGGATAATCAGATGGTTTGAGATATTTGGCATGTGTAAT CGTCATATCGTCCTGAGCAAAACCTAAATATTTTTACCTAAATATTTTCC AATTTAGTCGAGATATTTAAATTGTAACTTTTAGTAAGAAATTAATAGAA TTTCAACATAAGAACCGTGTGAGAACCCATTTTCAGAAATTTCAAATTGT TATATCTCGACTTTGAAAAATAGTTATTCAAACATATTTGGATGTTTTAC TCAAGCCCACATAAGCTTTCTGCAGGCCAAATATCTCAAACCATCTGATT ATCCCTTTAAGTTTTCTGTGTTGGTTTTATTGATGAATCTAACTTCCTTC TACCCTGCTCTTGAAATATCTTAATCATTTTTTTTCTCGTTATAGCAAGC TCAAGAATGGACGCTGGAATCCAAACGGAAAAAGGTATCACGAATTCCAA GATTTTCAAAAAAATTACAGGACCGAATTATATCAGGATCATGAAATTCT TCCAATTACAATTTCGAGTTGAACATATTTTTGATGTATTTTTAGTGTCA CCTACGATGGGAGATCTACCACCGCAAAATTTTGCAACTACTCCCGGTCC AGAATTAAATTGCAAACCACCATTAGTAGGTAGGTAGGCTACAGACCAGC ACATGATTTAATCTTTAGTCATGTAATTCTTTACAAGAAACTAAATTATA TTATATTTGAATTTTTGGCTATATCGATTTTTTGGGACATCTTTAACGTA TAGCCCTTACCATTTACCATTTTTTTACCATCCTTACCCGGCATTTTTAA ACAAAAGAAAGTATAGCTCCCCTCCCACGCTGCGCTTGTACTTTGTCAGC ATTAGGAGGCGCACTTCGTTTTTATATCATGAAAAATATCTTTAATGGAT ACGGTATGTTTATTTTTTAGCTTCGGACAAAATCGCGCTATTAATCGGGA ACACAAATTATAAACACTTGGAAGAACCCTTGGTGTTTCCTCACAGAGAC GTATACGCCCTTGGTCACGCCTTAAATGAGCTCGGATTTAAAGTGTTGAC TCTTGTTGACTTGACCTTACGGGAAATGAGGACCATCATGCTTGCGTATT GTCAACTTCTTGGTCCTGGTGTTTTCGCTGTTTTTTATTTCGCTGGTCAC GGTTTTGAAGAGAATGGCAAGAATTATTTGATGCCCATTGATGCGACCAG CACCAAAGGAGACGAATTTATTCAAGCTCAAGAAATCTTAACCGTTCGTA TCATCATTTCTTTTTATCATACGCACAACGTTTTTTCAATGTTTTTCTAA CGGCTAGAAATGCTATTATCGTCTTATGGACGTTGAAACAACATTGTCTG ATTCTTGTCTCTAATCTTTTTCTCTCATCCTACAAATATGGAGATGAGAT GGCGATTTTTTGCATTATGGTATGTTTGCCATATTTTCGTAAAAAAATGT AATTCAGAGTTTGACGATACACATGTCAAAGTAGTATCTTGAGATGGAGA TGTCAACTATTAAAAATGTTTTGTATTTTGTACATTATAGGAAATGAGAC TGGCAAACACAGCTCTGAATTTATTTATTATTGATGCTTGCCGCGTGAAA GGGTAAGGATATTAATTACATTGCACTCTCGCAGGTTCGAACTTCTATTA TTCGAATCTTTCTATACTTCGACATAATTTCCATTCCCCGTCAAAAAGAA ACCTGCGTAAAATGCTTTCTACAGATCGAATCCTTCTATAATTCGAACAA ATTAGATGCCCCTTTCGAGTTGAATTGGCGAGTGTCAACTGTATGTTATT ACTTTTTCACCTGAACTATTAGGATTATGCCATCGAAGCTCCATACTGAA TTTTATTTTCGCATTTTCTTTCTGTATAATATTCTCAATCTTTGGCTTAG TCATTTTGACGTTATGTTAGTCCTGGTTAGTTTTTCCAGTTGAGCAACTA GATTTCGAAATTGAATAAATATGACCGGTAACTAACGAATTTTACTTCCT ATTTCTCCTGTTCAGTATAAATGTATCAAGCACAAGAGGAACTCTCCAGA AAACTGGCTTTGGAAACACGATCATGGCTTATAGTTGGTAAGGATTTTTG TTGTGATTTACTTGAGTTATCTCCTCATTAGTTATCTTTGCCCTCGCTCT CACATTTTTCTTTAATAGCCATGCTTGTACCCTTATGTACCCTTACAATA TTGGTACCGGATTTGTCATTTTATTGGATTTGTCTTTTCATGTGTATGTC GGATGGAAATGGTTATTTAGATGTGTGGCATTGCGTCGATGGATGTGTAC TAAGTGGCAGTTTTTACACTAGGTTTGGTTTGGATAGTGGTAGTATTCGA GCATTTGTTTTGAACTATTTCCATCGATGATCTTTACTATTGATTTTGTC TTATATATTTTTCTTTGGATTGATTAGCTAGTTCTGGGTTCGGTTGTTAA ACTTTTTCTTTTGAAAAGGTAGTTTTTGGCCTTCATTAATAGCTCTGTAT TGCTTTCTTCATGTCTATTATTTGTTTTTTTCCTTTCTGGTGTTTGCAAT GTGAGACCTTTGTCCTTCTTTTTAGGTCTGCCGTCTTATTAGTGGTCTAC CATGTGGTTGGTCAATTAAATTCATATTTTTCCATTACAGTAGAGTCTCC GTAACTCGAACGCACATGGGAAAAACAAATATGTCCGATTTCAGGAAGTT TCGAGTTATGGAGTAAGGTTATAAGGCATTGTTAACTGAAGGGACGAGAA AACTTGTTCTAGTTAAAAGAGACTCTACTGTATTTCATAATTTAACAATC ATCTCCGGAGGGGAAATCTTAGAAAGAAAGAGGGTCAAATACTAACAACA TCTCCTGTTTATTATACTCATTAGTTCAAGTTCAATGCCAGCTTTCGAAG CGCACGATCTCAGCCATGGAATCTACATGACGCATCTGCTACCACGTATC AAGGAGGACAAAAGAATAGAACACATCTTGATGGAGGTCAATGAGGCGGT ACATGGAAACCCATTGGTCGTCCAACGCCCAGTTTTCGAAAGCGACGCTA TTGGTGATTGTAGGCTGACCTGTAAAATTGACGCTCAGGCAAATTATGAA CACTGGTCACAGCGTTTTGACAAATGGTTTGAGGCTACTCGTAAGTATTA TCCATTAACACGCTTTGTGCACTAGTAAATTGTTGTTTTACTTACTTTAG TATACTGGATTTCTGAAGTACATAATTGAACCAGCAAATCTTCCAATATT ACTAGATGATATTGCTAGGAGTGTTATACCTGGGTCTATCGAGCTAAGCA AATGAATTTGATATTTAGGTCGATAACGATTTTTTCTTTCGCCAAGATAT TTTATGATTTTCCATCGACTCCTTTTATATTTGTAGAACCACCAGAGGGG CAAACGATTTCCCGTGAAGAAGAAAAACTTCGATTGCGACTCGAGTACAA ATCAATGTTCTCGAACATGTTGCAAATTAATGTTTCAATTTCCAATCAAA ACGACGCACCATTCTTTTTGAGGGATGTCAAACTTCGTAACACATCCGTG AGTTTTCTTTTTCAATAAACAGATCACTTTTGGTCTTTCATACTGAAAAA TGAGGGCTTTTTTTTTGGTTTAATCTATTGAAACGGAATTTACCATAAAC TGCATTGTTGTAAATTTATTCAATTTATTCCAGCAAGAAACACATGTAGC AATTGTCGTTACCTCTTTTTTTTCTGATTTCTTTCGATTTGGTTGAAAAA ATACGTATACTTACCGGGTGTGTCAAAGAAAACGTGCCTGAAATTGAAAT TTTGACGTAGCCTTTCTACTTATGCTAGGCTCATAAAATTTTGCAAATAT GATTTTGAATCTAATATCAAACTCTGCTGAAAGTTTCATTTGTATGGCTT GTTTAGTTTTAAAGATATATAGATTTTACTAAAAGGTATGCAAATCAAAT CGTTTATAGATTTGACGTCAATTTCCCCAGCACTATCTTTGTCATCTTGT GTAAACCTTGCTCAGTGCATTTGATAGTTTGTTTTTGTTGTTCATGTTTT TATTTTTTCTATCCATAGCATTTGGAGATCCACGAGAATCGTCTCTTACC GGAAGGCTTTTTGCCGCCCTGTTCGGGATTCAAGGACGTGGTTTCATTCC GTATCCGTGACCTGCAAAAGGTGACTTACGAACTGTTATTAGTATTGGAG ATCACTGCCTCTTTAAAAAACGAACCTTGTAACGTGGAAGTCAAACTGAA CGCCGACTTTCCACTCATTTCAAGCTTTATACAAGAATTTTTGTCTTGGA TCACGGCGGATAAGAGGGCCACTGGTGGGATGAAAAACACATGGGTCTGA TGCATACTTGTAGGGTGTTTTATATTGACCCTCACTCTTTTGGTGTGTTG TTCTATGGCAGCAAAAATGCATGGAATTTTGCGACATGACTGCATTCTTT TTAGTTCTGACCACACATAGTTTTTCTATGGACCATATAAGTGATTTAAA TAACATAAAATTCTAACTGGCGAGAAGCTGATCTTTTTCGTGCCAGTATT TTGTTTAGCTAGCTGACGTTGTTATCAAAACATCATTCTAAAAACATTGT TGTCGTACTGCGATGTTAGCCGGACTGAATTTTATGTATTTAAATCGCTT GGCAAGATTCTGTCTATTACTATTCTATCTCTCTCTCTCTGTATATAGTC TTCTTCCTCTGACAATGTTTAATAGTTCAAAGATGAGGAATGAACCAAGA AAAAAATGAAGAATTATTTTAGAGGTTTTTTCTTCGATTTTTTAAGCAAT TTGTATAAAGTATATAATTAAAAGACAATTTTTTTGATTTAGTTATTAAA AACAATTTATTTTGCATCCAACTCTATTAGATTCATTTTGTTTGTTTGTT TGATGAAGTATATTTTTATTGTTTGTTATTGTTTGTTACCACTTAGTTAG AGTCACGCCCAATTAATTAATCTTCGGGGCAATTATGACCATCCTTTTTT TTGACCGTTTTTCTTTCGCCCCAATAAGATTCTTTTGGAAAGTAAAAGTA ATTTGTGAATTCCCAAACTTCAGGCAGGGCCTGTATTTGGGGAGCAAGTT CACAGTTTTAATATATTTGTATTTTACTTGGTGAGCTAAAAGTTGTACTA ATTTCTTCTTTGACATTAACCTCGCTACGTTTTTTGTTTTCTCTACTGAT TTTATTTTATTATTTATTAATTTCTGGTAGTGCTATTCTTTTACCAGTTA ACATAATTTTTGTTTTTATCATGTTTGTAAGTGGTGCATAAAAATCTTGA GCCTCGTTTTCGAATACTTTTGTCAAGGACGCTCAGCCTCGTTGGACGCT TTGTTTGAGAACGTGAGTGTTTTCAAAAATTTACATAACAATCTTTTTGG TAATTTCTT

Coding sequence (CDS) from alignment at scaffold_90:84201..96659-

>TCONS_00073355 ID=TCONS_00073355|Name=TCONS_00073355|organism=Clytia hemisphaerica|type=CDS|length=46980bp|location=Sequence derived from alignment at scaffold_90:84201..96659- (Clytia hemisphaerica)
CATTTGGAGATCCACGAGAATCGTCTCTTACCGGAAGGCTTTTTGCCGCC
CTGTTCGGGATTCAAGGACGTGGTTTCATTCCGTATCCGTGACCTGCAAA
AGGTGACTTACGAACTGTTATTAGTATTGGAGATCACTGCCTCTTTAAAA
AACGAACCTTGTAACGTGGAAGTCAAACTGAACGCCGACTTTCCACTCAT
TTCAAGCTTTATACAAGAATTTTTGTCTTGGATCACGGCGGATAAGAGGG
CCACTGGTGGGATGAAAAACACATGGGTCTGAAACCACCAGAGGGGCAAA
CGATTTCCCGTGAAGAAGAAAAACTTCGATTGCGACTCGAGTACAAATCA
ATGTTCTCGAACATGTTGCAAATTAATGTTTCAATTTCCAATCAAAACGA
CGCACCATTCTTTTTGAGGGATGTCAAACTTCGTAACACATCCTTCAAGT
TCAATGCCAGCTTTCGAAGCGCACGATCTCAGCCATGGAATCTACATGAC
GCATCTGCTACCACGTATCAAGGAGGACAAAAGAATAGAACACATCTTGA
TGGAGGTCAATGAGGCGGTACATGGAAACCCATTGGTCGTCCAACGCCCA
GTTTTCGAAAGCGACGCTATTGGTGATTGTAGGCTGACCTGTAAAATTGA
CGCTCAGGCAAATTATGAACACTGGTCACAGCGTTTTGACAAATGGTTTG
AGGCTACTCTATAAATGTATCAAGCACAAGAGGAACTCTCCAGAAAACTG
GCTTTGGAAACACGATCATGGCTTATAGTTGGAAATGAGACTGGCAAACA
CAGCTCTGAATTTATTTATTATTGATGCTTGCCGCGTGAAAGGCTTCGGA
CAAAATCGCGCTATTAATCGGGAACACAAATTATAAACACTTGGAAGAAC
CCTTGGTGTTTCCTCACAGAGACGTATACGCCCTTGGTCACGCCTTAAAT
GAGCTCGGATTTAAAGTGTTGACTCTTGTTGACTTGACCTTACGGGAAAT
GAGGACCATCATGCTTGCGTATTGTCAACTTCTTGGTCCTGGTGTTTTCG
CTGTTTTTTATTTCGCTGGTCACGGTTTTGAAGAGAATGGCAAGAATTAT
TTGATGCCCATTGATGCGACCAGCACCAAAGGAGACGAATTTATTCAAGC
TCAAGAAATCTTAACCTGTCACCTACGATGGGAGATCTACCACCGCAAAA
TTTTGCAACTACTCCCGGTCCAGAATTAAATTGCAAACCACCATTAGTAG
CAAGCTCAAGAATGGACGCTGGAATCCAAACGGAAAAAGAAAACTGTCAT
CCGAATTACCAGTTCAGGCTTCGTGAGGGCTCAGACGCATCCACATCGAC
AGACTTTTATGAGGATATACTGGCTGAGAAGTTGAGGAATCAACAAGAAC
ACCAACAACGTCATCAAGGATGTGAAGTTAACGATGGTGAATTTTTACGT
GACTTTCCAAGAGATTTCGCGCCCATTCCGCCACCGTCGATCCTGCCACC
ACCACCATCGTCACAAAACAGACCAACTACAAACGACGATGACTATCAAC
ACCAGCACCACTATCGTCCACATTCACCACCACCAAATATGCAAAACATG
ACTACTGATTTAGAATACAACAATCGTTATTCAGGTCATCATTCAATGAC
AAATCTAGACGGCACAAGTAATCCAAGGAGCCGTGCAAGCACCAACGATC
ATGAGGAGACAAACATGTCTATTGTGTCAGGCTCAATATCCAATCGTACA
AGCTCATCACTGGATGGATCACATTACCCTCCGCCACCATCATCCTACCC
TCCCTCTTCGTACCCACCGTCTTCGTACCCATCATCTTCATACCCATCAT
ACACCGCTTCAAACCCTTCAACAACTTCAACATTGCTAGCTGAAGACCCT
GATACAGATACCAACAGTAGAATTTTGGAGCACTCTTACCATAACTTAAT
TGAAAGACCAACTTCCATATCTTCTGCTGGTTCACTAACCAAGGAACCAA
TAGAGAACGACAGCTTTAGTGTGACCTGCCACATGATATTATTGAAGAGA
TTAGCTGCTGTCTGAATCCCAGACTGTTAAGGAAGGATTATCGTTCACTT
GCTGGGAAAATGGGGATGACACATCGGCAAGTAAAAAACATTGACTCAAA
ACAAAATCCAACAGAGGAACTGATCAACCTCTGGGTAACTGGTCCAGGAT
CCAAGACAGTGACTGATCTGATGGGCAAACTTAAAGAAATTGAGCGCCAT
GACGCAATAAGGATTCTGCAGGAGCATGAATTCACAGATGGCTTTCGTTG
AATTTGCTGATGGTGACTCAAAGCCACGGTTCAAGCCAACCCATGTGAGC
ATTTGGAGATCCACGAGAATCGTCTCTTACCGGAAGGCTTTTTGCCGCCC
TGTTCGGGATTCAAGGACGTGGTTTCATTCCGTATCCGTGACCTGCAAAA
GGTGACTTACGAACTGTTATTAGTATTGGAGATCACTGCCTCTTTAAAAA
ACGAACCTTGTAACGTGGAAGTCAAACTGAACGCCGACTTTCCACTCATT
TCAAGCTTTATACAAGAATTTTTGTCTTGGATCACGGCGGATAAGAGGGC
CACTGGTGGGATGAAAAACACATGGGTCTGAAACCACCAGAGGGGCAAAC
GATTTCCCGTGAAGAAGAAAAACTTCGATTGCGACTCGAGTACAAATCAA
TGTTCTCGAACATGTTGCAAATTAATGTTTCAATTTCCAATCAAAACGAC
GCACCATTCTTTTTGAGGGATGTCAAACTTCGTAACACATCCTTCAAGTT
CAATGCCAGCTTTCGAAGCGCACGATCTCAGCCATGGAATCTACATGACG
CATCTGCTACCACGTATCAAGGAGGACAAAAGAATAGAACACATCTTGAT
GGAGGTCAATGAGGCGGTACATGGAAACCCATTGGTCGTCCAACGCCCAG
TTTTCGAAAGCGACGCTATTGGTGATTGTAGGCTGACCTGTAAAATTGAC
GCTCAGGCAAATTATGAACACTGGTCACAGCGTTTTGACAAATGGTTTGA
GGCTACTCTATAAATGTATCAAGCACAAGAGGAACTCTCCAGAAAACTGG
CTTTGGAAACACGATCATGGCTTATAGTTGGAAATGAGACTGGCAAACAC
AGCTCTGAATTTATTTATTATTGATGCTTGCCGCGTGAAAGGCTTCGGAC
AAAATCGCGCTATTAATCGGGAACACAAATTATAAACACTTGGAAGAACC
CTTGGTGTTTCCTCACAGAGACGTATACGCCCTTGGTCACGCCTTAAATG
AGCTCGGATTTAAAGTGTTGACTCTTGTTGACTTGACCTTACGGGAAATG
AGGACCATCATGCTTGCGTATTGTCAACTTCTTGGTCCTGGTGTTTTCGC
TGTTTTTTATTTCGCTGGTCACGGTTTTGAAGAGAATGGCAAGAATTATT
TGATGCCCATTGATGCGACCAGCACCAAAGGAGACGAATTTATTCAAGCT
CAAGAAATCTTAACCTGTCACCTACGATGGGAGATCTACCACCGCAAAAT
TTTGCAACTACTCCCGGTCCAGAATTAAATTGCAAACCACCATTAGTAGC
AAGCTCAAGAATGGACGCTGGAATCCAAACGGAAAAAGAAAACTGTCATC
CGAATTACCAGTTCAGGCTTCGTGAGGGCTCAGACGCATCCACATCGACA
GACTTTTATGAGGATATACTGGCTGAGAAGTTGAGGAATCAACAAGAACA
CCAACAACGTCATCAAGGATGTGAAGTTAACGATGGTGAATTTTTACGTG
ACTTTCCAAGAGATTTCGCGCCCATTCCGCCACCGTCGATCCTGCCACCA
CCACCATCGTCACAAAACAGACCAACTACAAACGACGATGACTATCAACA
CCAGCACCACTATCGTCCACATTCACCACCACCAAATATGCAAAACATGA
CTACTGATTTAGAATACAACAATCGTTATTCAGGTCATCATTCAATGACA
AATCTAGACGGCACAAGTAATCCAAGGAGCCGTGCAAGCACCAACGATCA
TGAGGAGACAAACATGTCTATTGTGTCAGGCTCAATATCCAATCGTACAA
GCTCATCACTGGATGGATCACATTACCCTCCGCCACCATCATCCTACCCT
CCCTCTTCGTACCCACCGTCTTCGTACCCATCATCTTCATACCCATCATA
CACCGCTTCAAACCCTTCAACAACTTCAACATTGCTAGCTGAAGACCCTG
ATACAGATACCAACAGTAGAATTTTGGAGCACTCTTACCATAACTTAATT
GAAAGACCAACTTCCATATCTTCTGCTGGTTCACTAACCAAGGAACCAAT
AGAGAACGACAGCTTTAGTGTGACCTGCCACATGATATTATTGAAGAGAT
TAGCTGCTGTCTGAATCCCAGACTGTTAAGGAAGGATTATCGTTCACTTG
CTGGGAAAATGGGGATGACACATCGGCAAGTAAAAAACATTGACTCAAAA
CAAAATCCAACAGAGGAACTGATCAACCTCTGGGTAACTGGTCCAGGATC
CAAGACAGTGACTGATCTGATGGGCAAACTTAAAGAAATTGAGCGCCATG
ACGCAATAAGGATTCTGCAGGAGCATGAATTCACAGATGGCTTTCGTTGA
ATTTGCTGATGGTGACTCAAAGCCACGGTTCAAGCCAACCCATGTGAGCA
TTTGGAGATCCACGAGAATCGTCTCTTACCGGAAGGCTTTTTGCCGCCCT
GTTCGGGATTCAAGGACGTGGTTTCATTCCGTATCCGTGACCTGCAAAAG
GTGACTTACGAACTGTTATTAGTATTGGAGATCACTGCCTCTTTAAAAAA
CGAACCTTGTAACGTGGAAGTCAAACTGAACGCCGACTTTCCACTCATTT
CAAGCTTTATACAAGAATTTTTGTCTTGGATCACGGCGGATAAGAGGGCC
ACTGGTGGGATGAAAAACACATGGGTCTGAAACCACCAGAGGGGCAAACG
ATTTCCCGTGAAGAAGAAAAACTTCGATTGCGACTCGAGTACAAATCAAT
GTTCTCGAACATGTTGCAAATTAATGTTTCAATTTCCAATCAAAACGACG
CACCATTCTTTTTGAGGGATGTCAAACTTCGTAACACATCCTTCAAGTTC
AATGCCAGCTTTCGAAGCGCACGATCTCAGCCATGGAATCTACATGACGC
ATCTGCTACCACGTATCAAGGAGGACAAAAGAATAGAACACATCTTGATG
GAGGTCAATGAGGCGGTACATGGAAACCCATTGGTCGTCCAACGCCCAGT
TTTCGAAAGCGACGCTATTGGTGATTGTAGGCTGACCTGTAAAATTGACG
CTCAGGCAAATTATGAACACTGGTCACAGCGTTTTGACAAATGGTTTGAG
GCTACTCTATAAATGTATCAAGCACAAGAGGAACTCTCCAGAAAACTGGC
TTTGGAAACACGATCATGGCTTATAGTTGGAAATGAGACTGGCAAACACA
GCTCTGAATTTATTTATTATTGATGCTTGCCGCGTGAAAGGCTTCGGACA
AAATCGCGCTATTAATCGGGAACACAAATTATAAACACTTGGAAGAACCC
TTGGTGTTTCCTCACAGAGACGTATACGCCCTTGGTCACGCCTTAAATGA
GCTCGGATTTAAAGTGTTGACTCTTGTTGACTTGACCTTACGGGAAATGA
GGACCATCATGCTTGCGTATTGTCAACTTCTTGGTCCTGGTGTTTTCGCT
GTTTTTTATTTCGCTGGTCACGGTTTTGAAGAGAATGGCAAGAATTATTT
GATGCCCATTGATGCGACCAGCACCAAAGGAGACGAATTTATTCAAGCTC
AAGAAATCTTAACCTGTCACCTACGATGGGAGATCTACCACCGCAAAATT
TTGCAACTACTCCCGGTCCAGAATTAAATTGCAAACCACCATTAGTAGCA
AGCTCAAGAATGGACGCTGGAATCCAAACGGAAAAAGAAAACTGTCATCC
GAATTACCAGTTCAGGCTTCGTGAGGGCTCAGACGCATCCACATCGACAG
ACTTTTATGAGGATATACTGGCTGAGAAGTTGAGGAATCAACAAGAACAC
CAACAACGTCATCAAGGATGTGAAGTTAACGATGGTGAATTTTTACGTGA
CTTTCCAAGAGATTTCGCGCCCATTCCGCCACCGTCGATCCTGCCACCAC
CACCATCGTCACAAAACAGACCAACTACAAACGACGATGACTATCAACAC
CAGCACCACTATCGTCCACATTCACCACCACCAAATATGCAAAACATGAC
TACTGATTTAGAATACAACAATCGTTATTCAGGTCATCATTCAATGACAA
ATCTAGACGGCACAAGTAATCCAAGGAGCCGTGCAAGCACCAACGATCAT
GAGGAGACAAACATGTCTATTGTGTCAGGCTCAATATCCAATCGTACAAG
CTCATCACTGGATGGATCACATTACCCTCCGCCACCATCATCCTACCCTC
CCTCTTCGTACCCACCGTCTTCGTACCCATCATCTTCATACCCATCATAC
ACCGCTTCAAACCCTTCAACAACTTCAACATTGCTAGCTGAAGACCCTGA
TACAGATACCAACAGTAGAATTTTGGAGCACTCTTACCATAACTTAATTG
AAAGACCAACTTCCATATCTTCTGCTGGTTCACTAACCAAGGAACCAATA
GAGAACGACAGCTTTAGTGTGACCTGCCACATGATATTATTGAAGAGATT
AGCTGCTGTCTGAATCCCAGACTGTTAAGGAAGGATTATCGTTCACTTGC
TGGGAAAATGGGGATGACACATCGGCAAGTAAAAAACATTGACTCAAAAC
AAAATCCAACAGAGGAACTGATCAACCTCTGGGTAACTGGTCCAGGATCC
AAGACAGTGACTGATCTGATGGGCAAACTTAAAGAAATTGAGCGCCATGA
CGCAATAAGGATTCTGCAGGAGCATGAATTCACAGATGGCTTTCGTTGAA
TTTGCTGATGGTGACTCAAAGCCACGGTTCAAGCCAACCCATGTGAGCAT
TTGGAGATCCACGAGAATCGTCTCTTACCGGAAGGCTTTTTGCCGCCCTG
TTCGGGATTCAAGGACGTGGTTTCATTCCGTATCCGTGACCTGCAAAAGG
TGACTTACGAACTGTTATTAGTATTGGAGATCACTGCCTCTTTAAAAAAC
GAACCTTGTAACGTGGAAGTCAAACTGAACGCCGACTTTCCACTCATTTC
AAGCTTTATACAAGAATTTTTGTCTTGGATCACGGCGGATAAGAGGGCCA
CTGGTGGGATGAAAAACACATGGGTCTGAAACCACCAGAGGGGCAAACGA
TTTCCCGTGAAGAAGAAAAACTTCGATTGCGACTCGAGTACAAATCAATG
TTCTCGAACATGTTGCAAATTAATGTTTCAATTTCCAATCAAAACGACGC
ACCATTCTTTTTGAGGGATGTCAAACTTCGTAACACATCCTTCAAGTTCA
ATGCCAGCTTTCGAAGCGCACGATCTCAGCCATGGAATCTACATGACGCA
TCTGCTACCACGTATCAAGGAGGACAAAAGAATAGAACACATCTTGATGG
AGGTCAATGAGGCGGTACATGGAAACCCATTGGTCGTCCAACGCCCAGTT
TTCGAAAGCGACGCTATTGGTGATTGTAGGCTGACCTGTAAAATTGACGC
TCAGGCAAATTATGAACACTGGTCACAGCGTTTTGACAAATGGTTTGAGG
CTACTCTATAAATGTATCAAGCACAAGAGGAACTCTCCAGAAAACTGGCT
TTGGAAACACGATCATGGCTTATAGTTGGAAATGAGACTGGCAAACACAG
CTCTGAATTTATTTATTATTGATGCTTGCCGCGTGAAAGGCTTCGGACAA
AATCGCGCTATTAATCGGGAACACAAATTATAAACACTTGGAAGAACCCT
TGGTGTTTCCTCACAGAGACGTATACGCCCTTGGTCACGCCTTAAATGAG
CTCGGATTTAAAGTGTTGACTCTTGTTGACTTGACCTTACGGGAAATGAG
GACCATCATGCTTGCGTATTGTCAACTTCTTGGTCCTGGTGTTTTCGCTG
TTTTTTATTTCGCTGGTCACGGTTTTGAAGAGAATGGCAAGAATTATTTG
ATGCCCATTGATGCGACCAGCACCAAAGGAGACGAATTTATTCAAGCTCA
AGAAATCTTAACCTGTCACCTACGATGGGAGATCTACCACCGCAAAATTT
TGCAACTACTCCCGGTCCAGAATTAAATTGCAAACCACCATTAGTAGCAA
GCTCAAGAATGGACGCTGGAATCCAAACGGAAAAAGAAAACTGTCATCCG
AATTACCAGTTCAGGCTTCGTGAGGGCTCAGACGCATCCACATCGACAGA
CTTTTATGAGGATATACTGGCTGAGAAGTTGAGGAATCAACAAGAACACC
AACAACGTCATCAAGGATGTGAAGTTAACGATGGTGAATTTTTACGTGAC
TTTCCAAGAGATTTCGCGCCCATTCCGCCACCGTCGATCCTGCCACCACC
ACCATCGTCACAAAACAGACCAACTACAAACGACGATGACTATCAACACC
AGCACCACTATCGTCCACATTCACCACCACCAAATATGCAAAACATGACT
ACTGATTTAGAATACAACAATCGTTATTCAGGTCATCATTCAATGACAAA
TCTAGACGGCACAAGTAATCCAAGGAGCCGTGCAAGCACCAACGATCATG
AGGAGACAAACATGTCTATTGTGTCAGGCTCAATATCCAATCGTACAAGC
TCATCACTGGATGGATCACATTACCCTCCGCCACCATCATCCTACCCTCC
CTCTTCGTACCCACCGTCTTCGTACCCATCATCTTCATACCCATCATACA
CCGCTTCAAACCCTTCAACAACTTCAACATTGCTAGCTGAAGACCCTGAT
ACAGATACCAACAGTAGAATTTTGGAGCACTCTTACCATAACTTAATTGA
AAGACCAACTTCCATATCTTCTGCTGGTTCACTAACCAAGGAACCAATAG
AGAACGACAGCTTTAGTGTGACCTGCCACATGATATTATTGAAGAGATTA
GCTGCTGTCTGAATCCCAGACTGTTAAGGAAGGATTATCGTTCACTTGCT
GGGAAAATGGGGATGACACATCGGCAAGTAAAAAACATTGACTCAAAACA
AAATCCAACAGAGGAACTGATCAACCTCTGGGTAACTGGTCCAGGATCCA
AGACAGTGACTGATCTGATGGGCAAACTTAAAGAAATTGAGCGCCATGAC
GCAATAAGGATTCTGCAGGAGCATGAATTCACAGATGGCTTTCGTTGAAT
TTGCTGATGGTGACTCAAAGCCACGGTTCAAGCCAACCCATGTGAGCATT
TGGAGATCCACGAGAATCGTCTCTTACCGGAAGGCTTTTTGCCGCCCTGT
TCGGGATTCAAGGACGTGGTTTCATTCCGTATCCGTGACCTGCAAAAGGT
GACTTACGAACTGTTATTAGTATTGGAGATCACTGCCTCTTTAAAAAACG
AACCTTGTAACGTGGAAGTCAAACTGAACGCCGACTTTCCACTCATTTCA
AGCTTTATACAAGAATTTTTGTCTTGGATCACGGCGGATAAGAGGGCCAC
TGGTGGGATGAAAAACACATGGGTCTGAAACCACCAGAGGGGCAAACGAT
TTCCCGTGAAGAAGAAAAACTTCGATTGCGACTCGAGTACAAATCAATGT
TCTCGAACATGTTGCAAATTAATGTTTCAATTTCCAATCAAAACGACGCA
CCATTCTTTTTGAGGGATGTCAAACTTCGTAACACATCCTTCAAGTTCAA
TGCCAGCTTTCGAAGCGCACGATCTCAGCCATGGAATCTACATGACGCAT
CTGCTACCACGTATCAAGGAGGACAAAAGAATAGAACACATCTTGATGGA
GGTCAATGAGGCGGTACATGGAAACCCATTGGTCGTCCAACGCCCAGTTT
TCGAAAGCGACGCTATTGGTGATTGTAGGCTGACCTGTAAAATTGACGCT
CAGGCAAATTATGAACACTGGTCACAGCGTTTTGACAAATGGTTTGAGGC
TACTCTATAAATGTATCAAGCACAAGAGGAACTCTCCAGAAAACTGGCTT
TGGAAACACGATCATGGCTTATAGTTGGAAATGAGACTGGCAAACACAGC
TCTGAATTTATTTATTATTGATGCTTGCCGCGTGAAAGGCTTCGGACAAA
ATCGCGCTATTAATCGGGAACACAAATTATAAACACTTGGAAGAACCCTT
GGTGTTTCCTCACAGAGACGTATACGCCCTTGGTCACGCCTTAAATGAGC
TCGGATTTAAAGTGTTGACTCTTGTTGACTTGACCTTACGGGAAATGAGG
ACCATCATGCTTGCGTATTGTCAACTTCTTGGTCCTGGTGTTTTCGCTGT
TTTTTATTTCGCTGGTCACGGTTTTGAAGAGAATGGCAAGAATTATTTGA
TGCCCATTGATGCGACCAGCACCAAAGGAGACGAATTTATTCAAGCTCAA
GAAATCTTAACCTGTCACCTACGATGGGAGATCTACCACCGCAAAATTTT
GCAACTACTCCCGGTCCAGAATTAAATTGCAAACCACCATTAGTAGCAAG
CTCAAGAATGGACGCTGGAATCCAAACGGAAAAAGAAAACTGTCATCCGA
ATTACCAGTTCAGGCTTCGTGAGGGCTCAGACGCATCCACATCGACAGAC
TTTTATGAGGATATACTGGCTGAGAAGTTGAGGAATCAACAAGAACACCA
ACAACGTCATCAAGGATGTGAAGTTAACGATGGTGAATTTTTACGTGACT
TTCCAAGAGATTTCGCGCCCATTCCGCCACCGTCGATCCTGCCACCACCA
CCATCGTCACAAAACAGACCAACTACAAACGACGATGACTATCAACACCA
GCACCACTATCGTCCACATTCACCACCACCAAATATGCAAAACATGACTA
CTGATTTAGAATACAACAATCGTTATTCAGGTCATCATTCAATGACAAAT
CTAGACGGCACAAGTAATCCAAGGAGCCGTGCAAGCACCAACGATCATGA
GGAGACAAACATGTCTATTGTGTCAGGCTCAATATCCAATCGTACAAGCT
CATCACTGGATGGATCACATTACCCTCCGCCACCATCATCCTACCCTCCC
TCTTCGTACCCACCGTCTTCGTACCCATCATCTTCATACCCATCATACAC
CGCTTCAAACCCTTCAACAACTTCAACATTGCTAGCTGAAGACCCTGATA
CAGATACCAACAGTAGAATTTTGGAGCACTCTTACCATAACTTAATTGAA
AGACCAACTTCCATATCTTCTGCTGGTTCACTAACCAAGGAACCAATAGA
GAACGACAGCTTTAGTGTGACCTGCCACATGATATTATTGAAGAGATTAG
CTGCTGTCTGAATCCCAGACTGTTAAGGAAGGATTATCGTTCACTTGCTG
GGAAAATGGGGATGACACATCGGCAAGTAAAAAACATTGACTCAAAACAA
AATCCAACAGAGGAACTGATCAACCTCTGGGTAACTGGTCCAGGATCCAA
GACAGTGACTGATCTGATGGGCAAACTTAAAGAAATTGAGCGCCATGACG
CAATAAGGATTCTGCAGGAGCATGAATTCACAGATGGCTTTCGTTGAATT
TGCTGATGGTGACTCAAAGCCACGGTTCAAGCCAACCCATGTGAGCATTT
GGAGATCCACGAGAATCGTCTCTTACCGGAAGGCTTTTTGCCGCCCTGTT
CGGGATTCAAGGACGTGGTTTCATTCCGTATCCGTGACCTGCAAAAGGTG
ACTTACGAACTGTTATTAGTATTGGAGATCACTGCCTCTTTAAAAAACGA
ACCTTGTAACGTGGAAGTCAAACTGAACGCCGACTTTCCACTCATTTCAA
GCTTTATACAAGAATTTTTGTCTTGGATCACGGCGGATAAGAGGGCCACT
GGTGGGATGAAAAACACATGGGTCTGAAACCACCAGAGGGGCAAACGATT
TCCCGTGAAGAAGAAAAACTTCGATTGCGACTCGAGTACAAATCAATGTT
CTCGAACATGTTGCAAATTAATGTTTCAATTTCCAATCAAAACGACGCAC
CATTCTTTTTGAGGGATGTCAAACTTCGTAACACATCCTTCAAGTTCAAT
GCCAGCTTTCGAAGCGCACGATCTCAGCCATGGAATCTACATGACGCATC
TGCTACCACGTATCAAGGAGGACAAAAGAATAGAACACATCTTGATGGAG
GTCAATGAGGCGGTACATGGAAACCCATTGGTCGTCCAACGCCCAGTTTT
CGAAAGCGACGCTATTGGTGATTGTAGGCTGACCTGTAAAATTGACGCTC
AGGCAAATTATGAACACTGGTCACAGCGTTTTGACAAATGGTTTGAGGCT
ACTCTATAAATGTATCAAGCACAAGAGGAACTCTCCAGAAAACTGGCTTT
GGAAACACGATCATGGCTTATAGTTGGAAATGAGACTGGCAAACACAGCT
CTGAATTTATTTATTATTGATGCTTGCCGCGTGAAAGGCTTCGGACAAAA
TCGCGCTATTAATCGGGAACACAAATTATAAACACTTGGAAGAACCCTTG
GTGTTTCCTCACAGAGACGTATACGCCCTTGGTCACGCCTTAAATGAGCT
CGGATTTAAAGTGTTGACTCTTGTTGACTTGACCTTACGGGAAATGAGGA
CCATCATGCTTGCGTATTGTCAACTTCTTGGTCCTGGTGTTTTCGCTGTT
TTTTATTTCGCTGGTCACGGTTTTGAAGAGAATGGCAAGAATTATTTGAT
GCCCATTGATGCGACCAGCACCAAAGGAGACGAATTTATTCAAGCTCAAG
AAATCTTAACCTGTCACCTACGATGGGAGATCTACCACCGCAAAATTTTG
CAACTACTCCCGGTCCAGAATTAAATTGCAAACCACCATTAGTAGCAAGC
TCAAGAATGGACGCTGGAATCCAAACGGAAAAAGAAAACTGTCATCCGAA
TTACCAGTTCAGGCTTCGTGAGGGCTCAGACGCATCCACATCGACAGACT
TTTATGAGGATATACTGGCTGAGAAGTTGAGGAATCAACAAGAACACCAA
CAACGTCATCAAGGATGTGAAGTTAACGATGGTGAATTTTTACGTGACTT
TCCAAGAGATTTCGCGCCCATTCCGCCACCGTCGATCCTGCCACCACCAC
CATCGTCACAAAACAGACCAACTACAAACGACGATGACTATCAACACCAG
CACCACTATCGTCCACATTCACCACCACCAAATATGCAAAACATGACTAC
TGATTTAGAATACAACAATCGTTATTCAGGTCATCATTCAATGACAAATC
TAGACGGCACAAGTAATCCAAGGAGCCGTGCAAGCACCAACGATCATGAG
GAGACAAACATGTCTATTGTGTCAGGCTCAATATCCAATCGTACAAGCTC
ATCACTGGATGGATCACATTACCCTCCGCCACCATCATCCTACCCTCCCT
CTTCGTACCCACCGTCTTCGTACCCATCATCTTCATACCCATCATACACC
GCTTCAAACCCTTCAACAACTTCAACATTGCTAGCTGAAGACCCTGATAC
AGATACCAACAGTAGAATTTTGGAGCACTCTTACCATAACTTAATTGAAA
GACCAACTTCCATATCTTCTGCTGGTTCACTAACCAAGGAACCAATAGAG
AACGACAGCTTTAGTGTGACCTGCCACATGATATTATTGAAGAGATTAGC
TGCTGTCTGAATCCCAGACTGTTAAGGAAGGATTATCGTTCACTTGCTGG
GAAAATGGGGATGACACATCGGCAAGTAAAAAACATTGACTCAAAACAAA
ATCCAACAGAGGAACTGATCAACCTCTGGGTAACTGGTCCAGGATCCAAG
ACAGTGACTGATCTGATGGGCAAACTTAAAGAAATTGAGCGCCATGACGC
AATAAGGATTCTGCAGGAGCATGAATTCACAGATGGCTTTCGTTGAATTT
GCTGATGGTGACTCAAAGCCACGGTTCAAGCCAACCCATGTGAGCATTTG
GAGATCCACGAGAATCGTCTCTTACCGGAAGGCTTTTTGCCGCCCTGTTC
GGGATTCAAGGACGTGGTTTCATTCCGTATCCGTGACCTGCAAAAGGTGA
CTTACGAACTGTTATTAGTATTGGAGATCACTGCCTCTTTAAAAAACGAA
CCTTGTAACGTGGAAGTCAAACTGAACGCCGACTTTCCACTCATTTCAAG
CTTTATACAAGAATTTTTGTCTTGGATCACGGCGGATAAGAGGGCCACTG
GTGGGATGAAAAACACATGGGTCTGAAACCACCAGAGGGGCAAACGATTT
CCCGTGAAGAAGAAAAACTTCGATTGCGACTCGAGTACAAATCAATGTTC
TCGAACATGTTGCAAATTAATGTTTCAATTTCCAATCAAAACGACGCACC
ATTCTTTTTGAGGGATGTCAAACTTCGTAACACATCCTTCAAGTTCAATG
CCAGCTTTCGAAGCGCACGATCTCAGCCATGGAATCTACATGACGCATCT
GCTACCACGTATCAAGGAGGACAAAAGAATAGAACACATCTTGATGGAGG
TCAATGAGGCGGTACATGGAAACCCATTGGTCGTCCAACGCCCAGTTTTC
GAAAGCGACGCTATTGGTGATTGTAGGCTGACCTGTAAAATTGACGCTCA
GGCAAATTATGAACACTGGTCACAGCGTTTTGACAAATGGTTTGAGGCTA
CTCTATAAATGTATCAAGCACAAGAGGAACTCTCCAGAAAACTGGCTTTG
GAAACACGATCATGGCTTATAGTTGGAAATGAGACTGGCAAACACAGCTC
TGAATTTATTTATTATTGATGCTTGCCGCGTGAAAGGCTTCGGACAAAAT
CGCGCTATTAATCGGGAACACAAATTATAAACACTTGGAAGAACCCTTGG
TGTTTCCTCACAGAGACGTATACGCCCTTGGTCACGCCTTAAATGAGCTC
GGATTTAAAGTGTTGACTCTTGTTGACTTGACCTTACGGGAAATGAGGAC
CATCATGCTTGCGTATTGTCAACTTCTTGGTCCTGGTGTTTTCGCTGTTT
TTTATTTCGCTGGTCACGGTTTTGAAGAGAATGGCAAGAATTATTTGATG
CCCATTGATGCGACCAGCACCAAAGGAGACGAATTTATTCAAGCTCAAGA
AATCTTAACCTGTCACCTACGATGGGAGATCTACCACCGCAAAATTTTGC
AACTACTCCCGGTCCAGAATTAAATTGCAAACCACCATTAGTAGCAAGCT
CAAGAATGGACGCTGGAATCCAAACGGAAAAAGAAAACTGTCATCCGAAT
TACCAGTTCAGGCTTCGTGAGGGCTCAGACGCATCCACATCGACAGACTT
TTATGAGGATATACTGGCTGAGAAGTTGAGGAATCAACAAGAACACCAAC
AACGTCATCAAGGATGTGAAGTTAACGATGGTGAATTTTTACGTGACTTT
CCAAGAGATTTCGCGCCCATTCCGCCACCGTCGATCCTGCCACCACCACC
ATCGTCACAAAACAGACCAACTACAAACGACGATGACTATCAACACCAGC
ACCACTATCGTCCACATTCACCACCACCAAATATGCAAAACATGACTACT
GATTTAGAATACAACAATCGTTATTCAGGTCATCATTCAATGACAAATCT
AGACGGCACAAGTAATCCAAGGAGCCGTGCAAGCACCAACGATCATGAGG
AGACAAACATGTCTATTGTGTCAGGCTCAATATCCAATCGTACAAGCTCA
TCACTGGATGGATCACATTACCCTCCGCCACCATCATCCTACCCTCCCTC
TTCGTACCCACCGTCTTCGTACCCATCATCTTCATACCCATCATACACCG
CTTCAAACCCTTCAACAACTTCAACATTGCTAGCTGAAGACCCTGATACA
GATACCAACAGTAGAATTTTGGAGCACTCTTACCATAACTTAATTGAAAG
ACCAACTTCCATATCTTCTGCTGGTTCACTAACCAAGGAACCAATAGAGA
ACGACAGCTTTAGTGTGACCTGCCACATGATATTATTGAAGAGATTAGCT
GCTGTCTGAATCCCAGACTGTTAAGGAAGGATTATCGTTCACTTGCTGGG
AAAATGGGGATGACACATCGGCAAGTAAAAAACATTGACTCAAAACAAAA
TCCAACAGAGGAACTGATCAACCTCTGGGTAACTGGTCCAGGATCCAAGA
CAGTGACTGATCTGATGGGCAAACTTAAAGAAATTGAGCGCCATGACGCA
ATAAGGATTCTGCAGGAGCATGAATTCACAGATGGCTTTCGTTGAATTTG
CTGATGGTGACTCAAAGCCACGGTTCAAGCCAACCCATGTGAGCATTTGG
AGATCCACGAGAATCGTCTCTTACCGGAAGGCTTTTTGCCGCCCTGTTCG
GGATTCAAGGACGTGGTTTCATTCCGTATCCGTGACCTGCAAAAGGTGAC
TTACGAACTGTTATTAGTATTGGAGATCACTGCCTCTTTAAAAAACGAAC
CTTGTAACGTGGAAGTCAAACTGAACGCCGACTTTCCACTCATTTCAAGC
TTTATACAAGAATTTTTGTCTTGGATCACGGCGGATAAGAGGGCCACTGG
TGGGATGAAAAACACATGGGTCTGAAACCACCAGAGGGGCAAACGATTTC
CCGTGAAGAAGAAAAACTTCGATTGCGACTCGAGTACAAATCAATGTTCT
CGAACATGTTGCAAATTAATGTTTCAATTTCCAATCAAAACGACGCACCA
TTCTTTTTGAGGGATGTCAAACTTCGTAACACATCCTTCAAGTTCAATGC
CAGCTTTCGAAGCGCACGATCTCAGCCATGGAATCTACATGACGCATCTG
CTACCACGTATCAAGGAGGACAAAAGAATAGAACACATCTTGATGGAGGT
CAATGAGGCGGTACATGGAAACCCATTGGTCGTCCAACGCCCAGTTTTCG
AAAGCGACGCTATTGGTGATTGTAGGCTGACCTGTAAAATTGACGCTCAG
GCAAATTATGAACACTGGTCACAGCGTTTTGACAAATGGTTTGAGGCTAC
TCTATAAATGTATCAAGCACAAGAGGAACTCTCCAGAAAACTGGCTTTGG
AAACACGATCATGGCTTATAGTTGGAAATGAGACTGGCAAACACAGCTCT
GAATTTATTTATTATTGATGCTTGCCGCGTGAAAGGCTTCGGACAAAATC
GCGCTATTAATCGGGAACACAAATTATAAACACTTGGAAGAACCCTTGGT
GTTTCCTCACAGAGACGTATACGCCCTTGGTCACGCCTTAAATGAGCTCG
GATTTAAAGTGTTGACTCTTGTTGACTTGACCTTACGGGAAATGAGGACC
ATCATGCTTGCGTATTGTCAACTTCTTGGTCCTGGTGTTTTCGCTGTTTT
TTATTTCGCTGGTCACGGTTTTGAAGAGAATGGCAAGAATTATTTGATGC
CCATTGATGCGACCAGCACCAAAGGAGACGAATTTATTCAAGCTCAAGAA
ATCTTAACCTGTCACCTACGATGGGAGATCTACCACCGCAAAATTTTGCA
ACTACTCCCGGTCCAGAATTAAATTGCAAACCACCATTAGTAGCAAGCTC
AAGAATGGACGCTGGAATCCAAACGGAAAAAGAAAACTGTCATCCGAATT
ACCAGTTCAGGCTTCGTGAGGGCTCAGACGCATCCACATCGACAGACTTT
TATGAGGATATACTGGCTGAGAAGTTGAGGAATCAACAAGAACACCAACA
ACGTCATCAAGGATGTGAAGTTAACGATGGTGAATTTTTACGTGACTTTC
CAAGAGATTTCGCGCCCATTCCGCCACCGTCGATCCTGCCACCACCACCA
TCGTCACAAAACAGACCAACTACAAACGACGATGACTATCAACACCAGCA
CCACTATCGTCCACATTCACCACCACCAAATATGCAAAACATGACTACTG
ATTTAGAATACAACAATCGTTATTCAGGTCATCATTCAATGACAAATCTA
GACGGCACAAGTAATCCAAGGAGCCGTGCAAGCACCAACGATCATGAGGA
GACAAACATGTCTATTGTGTCAGGCTCAATATCCAATCGTACAAGCTCAT
CACTGGATGGATCACATTACCCTCCGCCACCATCATCCTACCCTCCCTCT
TCGTACCCACCGTCTTCGTACCCATCATCTTCATACCCATCATACACCGC
TTCAAACCCTTCAACAACTTCAACATTGCTAGCTGAAGACCCTGATACAG
ATACCAACAGTAGAATTTTGGAGCACTCTTACCATAACTTAATTGAAAGA
CCAACTTCCATATCTTCTGCTGGTTCACTAACCAAGGAACCAATAGAGAA
CGACAGCTTTAGTGTGACCTGCCACATGATATTATTGAAGAGATTAGCTG
CTGTCTGAATCCCAGACTGTTAAGGAAGGATTATCGTTCACTTGCTGGGA
AAATGGGGATGACACATCGGCAAGTAAAAAACATTGACTCAAAACAAAAT
CCAACAGAGGAACTGATCAACCTCTGGGTAACTGGTCCAGGATCCAAGAC
AGTGACTGATCTGATGGGCAAACTTAAAGAAATTGAGCGCCATGACGCAA
TAAGGATTCTGCAGGAGCATGAATTCACAGATGGCTTTCGTTGAATTTGC
TGATGGTGACTCAAAGCCACGGTTCAAGCCAACCCATGTGAGCATTTGGA
GATCCACGAGAATCGTCTCTTACCGGAAGGCTTTTTGCCGCCCTGTTCGG
GATTCAAGGACGTGGTTTCATTCCGTATCCGTGACCTGCAAAAGGTGACT
TACGAACTGTTATTAGTATTGGAGATCACTGCCTCTTTAAAAAACGAACC
TTGTAACGTGGAAGTCAAACTGAACGCCGACTTTCCACTCATTTCAAGCT
TTATACAAGAATTTTTGTCTTGGATCACGGCGGATAAGAGGGCCACTGGT
GGGATGAAAAACACATGGGTCTGAAACCACCAGAGGGGCAAACGATTTCC
CGTGAAGAAGAAAAACTTCGATTGCGACTCGAGTACAAATCAATGTTCTC
GAACATGTTGCAAATTAATGTTTCAATTTCCAATCAAAACGACGCACCAT
TCTTTTTGAGGGATGTCAAACTTCGTAACACATCCTTCAAGTTCAATGCC
AGCTTTCGAAGCGCACGATCTCAGCCATGGAATCTACATGACGCATCTGC
TACCACGTATCAAGGAGGACAAAAGAATAGAACACATCTTGATGGAGGTC
AATGAGGCGGTACATGGAAACCCATTGGTCGTCCAACGCCCAGTTTTCGA
AAGCGACGCTATTGGTGATTGTAGGCTGACCTGTAAAATTGACGCTCAGG
CAAATTATGAACACTGGTCACAGCGTTTTGACAAATGGTTTGAGGCTACT
CTATAAATGTATCAAGCACAAGAGGAACTCTCCAGAAAACTGGCTTTGGA
AACACGATCATGGCTTATAGTTGGAAATGAGACTGGCAAACACAGCTCTG
AATTTATTTATTATTGATGCTTGCCGCGTGAAAGGCTTCGGACAAAATCG
CGCTATTAATCGGGAACACAAATTATAAACACTTGGAAGAACCCTTGGTG
TTTCCTCACAGAGACGTATACGCCCTTGGTCACGCCTTAAATGAGCTCGG
ATTTAAAGTGTTGACTCTTGTTGACTTGACCTTACGGGAAATGAGGACCA
TCATGCTTGCGTATTGTCAACTTCTTGGTCCTGGTGTTTTCGCTGTTTTT
TATTTCGCTGGTCACGGTTTTGAAGAGAATGGCAAGAATTATTTGATGCC
CATTGATGCGACCAGCACCAAAGGAGACGAATTTATTCAAGCTCAAGAAA
TCTTAACCTGTCACCTACGATGGGAGATCTACCACCGCAAAATTTTGCAA
CTACTCCCGGTCCAGAATTAAATTGCAAACCACCATTAGTAGCAAGCTCA
AGAATGGACGCTGGAATCCAAACGGAAAAAGAAAACTGTCATCCGAATTA
CCAGTTCAGGCTTCGTGAGGGCTCAGACGCATCCACATCGACAGACTTTT
ATGAGGATATACTGGCTGAGAAGTTGAGGAATCAACAAGAACACCAACAA
CGTCATCAAGGATGTGAAGTTAACGATGGTGAATTTTTACGTGACTTTCC
AAGAGATTTCGCGCCCATTCCGCCACCGTCGATCCTGCCACCACCACCAT
CGTCACAAAACAGACCAACTACAAACGACGATGACTATCAACACCAGCAC
CACTATCGTCCACATTCACCACCACCAAATATGCAAAACATGACTACTGA
TTTAGAATACAACAATCGTTATTCAGGTCATCATTCAATGACAAATCTAG
ACGGCACAAGTAATCCAAGGAGCCGTGCAAGCACCAACGATCATGAGGAG
ACAAACATGTCTATTGTGTCAGGCTCAATATCCAATCGTACAAGCTCATC
ACTGGATGGATCACATTACCCTCCGCCACCATCATCCTACCCTCCCTCTT
CGTACCCACCGTCTTCGTACCCATCATCTTCATACCCATCATACACCGCT
TCAAACCCTTCAACAACTTCAACATTGCTAGCTGAAGACCCTGATACAGA
TACCAACAGTAGAATTTTGGAGCACTCTTACCATAACTTAATTGAAAGAC
CAACTTCCATATCTTCTGCTGGTTCACTAACCAAGGAACCAATAGAGAAC
GACAGCTTTAGTGTGACCTGCCACATGATATTATTGAAGAGATTAGCTGC
TGTCTGAATCCCAGACTGTTAAGGAAGGATTATCGTTCACTTGCTGGGAA
AATGGGGATGACACATCGGCAAGTAAAAAACATTGACTCAAAACAAAATC
CAACAGAGGAACTGATCAACCTCTGGGTAACTGGTCCAGGATCCAAGACA
GTGACTGATCTGATGGGCAAACTTAAAGAAATTGAGCGCCATGACGCAAT
AAGGATTCTGCAGGAGCATGAATTCACAGATGGCTTTCGTTGAATTTGCT
GATGGTGACTCAAAGCCACGGTTCAAGCCAACCCATGTGAGCATTTGGAG
ATCCACGAGAATCGTCTCTTACCGGAAGGCTTTTTGCCGCCCTGTTCGGG
ATTCAAGGACGTGGTTTCATTCCGTATCCGTGACCTGCAAAAGGTGACTT
ACGAACTGTTATTAGTATTGGAGATCACTGCCTCTTTAAAAAACGAACCT
TGTAACGTGGAAGTCAAACTGAACGCCGACTTTCCACTCATTTCAAGCTT
TATACAAGAATTTTTGTCTTGGATCACGGCGGATAAGAGGGCCACTGGTG
GGATGAAAAACACATGGGTCTGAAACCACCAGAGGGGCAAACGATTTCCC
GTGAAGAAGAAAAACTTCGATTGCGACTCGAGTACAAATCAATGTTCTCG
AACATGTTGCAAATTAATGTTTCAATTTCCAATCAAAACGACGCACCATT
CTTTTTGAGGGATGTCAAACTTCGTAACACATCCTTCAAGTTCAATGCCA
GCTTTCGAAGCGCACGATCTCAGCCATGGAATCTACATGACGCATCTGCT
ACCACGTATCAAGGAGGACAAAAGAATAGAACACATCTTGATGGAGGTCA
ATGAGGCGGTACATGGAAACCCATTGGTCGTCCAACGCCCAGTTTTCGAA
AGCGACGCTATTGGTGATTGTAGGCTGACCTGTAAAATTGACGCTCAGGC
AAATTATGAACACTGGTCACAGCGTTTTGACAAATGGTTTGAGGCTACTC
TATAAATGTATCAAGCACAAGAGGAACTCTCCAGAAAACTGGCTTTGGAA
ACACGATCATGGCTTATAGTTGGAAATGAGACTGGCAAACACAGCTCTGA
ATTTATTTATTATTGATGCTTGCCGCGTGAAAGGCTTCGGACAAAATCGC
GCTATTAATCGGGAACACAAATTATAAACACTTGGAAGAACCCTTGGTGT
TTCCTCACAGAGACGTATACGCCCTTGGTCACGCCTTAAATGAGCTCGGA
TTTAAAGTGTTGACTCTTGTTGACTTGACCTTACGGGAAATGAGGACCAT
CATGCTTGCGTATTGTCAACTTCTTGGTCCTGGTGTTTTCGCTGTTTTTT
ATTTCGCTGGTCACGGTTTTGAAGAGAATGGCAAGAATTATTTGATGCCC
ATTGATGCGACCAGCACCAAAGGAGACGAATTTATTCAAGCTCAAGAAAT
CTTAACCTGTCACCTACGATGGGAGATCTACCACCGCAAAATTTTGCAAC
TACTCCCGGTCCAGAATTAAATTGCAAACCACCATTAGTAGCAAGCTCAA
GAATGGACGCTGGAATCCAAACGGAAAAAGAAAACTGTCATCCGAATTAC
CAGTTCAGGCTTCGTGAGGGCTCAGACGCATCCACATCGACAGACTTTTA
TGAGGATATACTGGCTGAGAAGTTGAGGAATCAACAAGAACACCAACAAC
GTCATCAAGGATGTGAAGTTAACGATGGTGAATTTTTACGTGACTTTCCA
AGAGATTTCGCGCCCATTCCGCCACCGTCGATCCTGCCACCACCACCATC
GTCACAAAACAGACCAACTACAAACGACGATGACTATCAACACCAGCACC
ACTATCGTCCACATTCACCACCACCAAATATGCAAAACATGACTACTGAT
TTAGAATACAACAATCGTTATTCAGGTCATCATTCAATGACAAATCTAGA
CGGCACAAGTAATCCAAGGAGCCGTGCAAGCACCAACGATCATGAGGAGA
CAAACATGTCTATTGTGTCAGGCTCAATATCCAATCGTACAAGCTCATCA
CTGGATGGATCACATTACCCTCCGCCACCATCATCCTACCCTCCCTCTTC
GTACCCACCGTCTTCGTACCCATCATCTTCATACCCATCATACACCGCTT
CAAACCCTTCAACAACTTCAACATTGCTAGCTGAAGACCCTGATACAGAT
ACCAACAGTAGAATTTTGGAGCACTCTTACCATAACTTAATTGAAAGACC
AACTTCCATATCTTCTGCTGGTTCACTAACCAAGGAACCAATAGAGAACG
ACAGCTTTAGTGTGACCTGCCACATGATATTATTGAAGAGATTAGCTGCT
GTCTGAATCCCAGACTGTTAAGGAAGGATTATCGTTCACTTGCTGGGAAA
ATGGGGATGACACATCGGCAAGTAAAAAACATTGACTCAAAACAAAATCC
AACAGAGGAACTGATCAACCTCTGGGTAACTGGTCCAGGATCCAAGACAG
TGACTGATCTGATGGGCAAACTTAAAGAAATTGAGCGCCATGACGCAATA
AGGATTCTGCAGGAGCATGAATTCACAGATGGCTTTCGTTGAATTTGCTG
ATGGTGACTCAAAGCCACGGTTCAAGCCAACCCATGTGAGCATTTGGAGA
TCCACGAGAATCGTCTCTTACCGGAAGGCTTTTTGCCGCCCTGTTCGGGA
TTCAAGGACGTGGTTTCATTCCGTATCCGTGACCTGCAAAAGGTGACTTA
CGAACTGTTATTAGTATTGGAGATCACTGCCTCTTTAAAAAACGAACCTT
GTAACGTGGAAGTCAAACTGAACGCCGACTTTCCACTCATTTCAAGCTTT
ATACAAGAATTTTTGTCTTGGATCACGGCGGATAAGAGGGCCACTGGTGG
GATGAAAAACACATGGGTCTGAAACCACCAGAGGGGCAAACGATTTCCCG
TGAAGAAGAAAAACTTCGATTGCGACTCGAGTACAAATCAATGTTCTCGA
ACATGTTGCAAATTAATGTTTCAATTTCCAATCAAAACGACGCACCATTC
TTTTTGAGGGATGTCAAACTTCGTAACACATCCTTCAAGTTCAATGCCAG
CTTTCGAAGCGCACGATCTCAGCCATGGAATCTACATGACGCATCTGCTA
CCACGTATCAAGGAGGACAAAAGAATAGAACACATCTTGATGGAGGTCAA
TGAGGCGGTACATGGAAACCCATTGGTCGTCCAACGCCCAGTTTTCGAAA
GCGACGCTATTGGTGATTGTAGGCTGACCTGTAAAATTGACGCTCAGGCA
AATTATGAACACTGGTCACAGCGTTTTGACAAATGGTTTGAGGCTACTCT
ATAAATGTATCAAGCACAAGAGGAACTCTCCAGAAAACTGGCTTTGGAAA
CACGATCATGGCTTATAGTTGGAAATGAGACTGGCAAACACAGCTCTGAA
TTTATTTATTATTGATGCTTGCCGCGTGAAAGGCTTCGGACAAAATCGCG
CTATTAATCGGGAACACAAATTATAAACACTTGGAAGAACCCTTGGTGTT
TCCTCACAGAGACGTATACGCCCTTGGTCACGCCTTAAATGAGCTCGGAT
TTAAAGTGTTGACTCTTGTTGACTTGACCTTACGGGAAATGAGGACCATC
ATGCTTGCGTATTGTCAACTTCTTGGTCCTGGTGTTTTCGCTGTTTTTTA
TTTCGCTGGTCACGGTTTTGAAGAGAATGGCAAGAATTATTTGATGCCCA
TTGATGCGACCAGCACCAAAGGAGACGAATTTATTCAAGCTCAAGAAATC
TTAACCTGTCACCTACGATGGGAGATCTACCACCGCAAAATTTTGCAACT
ACTCCCGGTCCAGAATTAAATTGCAAACCACCATTAGTAGCAAGCTCAAG
AATGGACGCTGGAATCCAAACGGAAAAAGAAAACTGTCATCCGAATTACC
AGTTCAGGCTTCGTGAGGGCTCAGACGCATCCACATCGACAGACTTTTAT
GAGGATATACTGGCTGAGAAGTTGAGGAATCAACAAGAACACCAACAACG
TCATCAAGGATGTGAAGTTAACGATGGTGAATTTTTACGTGACTTTCCAA
GAGATTTCGCGCCCATTCCGCCACCGTCGATCCTGCCACCACCACCATCG
TCACAAAACAGACCAACTACAAACGACGATGACTATCAACACCAGCACCA
CTATCGTCCACATTCACCACCACCAAATATGCAAAACATGACTACTGATT
TAGAATACAACAATCGTTATTCAGGTCATCATTCAATGACAAATCTAGAC
GGCACAAGTAATCCAAGGAGCCGTGCAAGCACCAACGATCATGAGGAGAC
AAACATGTCTATTGTGTCAGGCTCAATATCCAATCGTACAAGCTCATCAC
TGGATGGATCACATTACCCTCCGCCACCATCATCCTACCCTCCCTCTTCG
TACCCACCGTCTTCGTACCCATCATCTTCATACCCATCATACACCGCTTC
AAACCCTTCAACAACTTCAACATTGCTAGCTGAAGACCCTGATACAGATA
CCAACAGTAGAATTTTGGAGCACTCTTACCATAACTTAATTGAAAGACCA
ACTTCCATATCTTCTGCTGGTTCACTAACCAAGGAACCAATAGAGAACGA
CAGCTTTAGTGTGACCTGCCACATGATATTATTGAAGAGATTAGCTGCTG
TCTGAATCCCAGACTGTTAAGGAAGGATTATCGTTCACTTGCTGGGAAAA
TGGGGATGACACATCGGCAAGTAAAAAACATTGACTCAAAACAAAATCCA
ACAGAGGAACTGATCAACCTCTGGGTAACTGGTCCAGGATCCAAGACAGT
GACTGATCTGATGGGCAAACTTAAAGAAATTGAGCGCCATGACGCAATAA
GGATTCTGCAGGAGCATGAATTCACAGATGGCTTTCGTTGAATTTGCTGA
TGGTGACTCAAAGCCACGGTTCAAGCCAACCCATGTGAGCATTTGGAGAT
CCACGAGAATCGTCTCTTACCGGAAGGCTTTTTGCCGCCCTGTTCGGGAT
TCAAGGACGTGGTTTCATTCCGTATCCGTGACCTGCAAAAGGTGACTTAC
GAACTGTTATTAGTATTGGAGATCACTGCCTCTTTAAAAAACGAACCTTG
TAACGTGGAAGTCAAACTGAACGCCGACTTTCCACTCATTTCAAGCTTTA
TACAAGAATTTTTGTCTTGGATCACGGCGGATAAGAGGGCCACTGGTGGG
ATGAAAAACACATGGGTCTGAAACCACCAGAGGGGCAAACGATTTCCCGT
GAAGAAGAAAAACTTCGATTGCGACTCGAGTACAAATCAATGTTCTCGAA
CATGTTGCAAATTAATGTTTCAATTTCCAATCAAAACGACGCACCATTCT
TTTTGAGGGATGTCAAACTTCGTAACACATCCTTCAAGTTCAATGCCAGC
TTTCGAAGCGCACGATCTCAGCCATGGAATCTACATGACGCATCTGCTAC
CACGTATCAAGGAGGACAAAAGAATAGAACACATCTTGATGGAGGTCAAT
GAGGCGGTACATGGAAACCCATTGGTCGTCCAACGCCCAGTTTTCGAAAG
CGACGCTATTGGTGATTGTAGGCTGACCTGTAAAATTGACGCTCAGGCAA
ATTATGAACACTGGTCACAGCGTTTTGACAAATGGTTTGAGGCTACTCTA
TAAATGTATCAAGCACAAGAGGAACTCTCCAGAAAACTGGCTTTGGAAAC
ACGATCATGGCTTATAGTTGGAAATGAGACTGGCAAACACAGCTCTGAAT
TTATTTATTATTGATGCTTGCCGCGTGAAAGGCTTCGGACAAAATCGCGC
TATTAATCGGGAACACAAATTATAAACACTTGGAAGAACCCTTGGTGTTT
CCTCACAGAGACGTATACGCCCTTGGTCACGCCTTAAATGAGCTCGGATT
TAAAGTGTTGACTCTTGTTGACTTGACCTTACGGGAAATGAGGACCATCA
TGCTTGCGTATTGTCAACTTCTTGGTCCTGGTGTTTTCGCTGTTTTTTAT
TTCGCTGGTCACGGTTTTGAAGAGAATGGCAAGAATTATTTGATGCCCAT
TGATGCGACCAGCACCAAAGGAGACGAATTTATTCAAGCTCAAGAAATCT
TAACCTGTCACCTACGATGGGAGATCTACCACCGCAAAATTTTGCAACTA
CTCCCGGTCCAGAATTAAATTGCAAACCACCATTAGTAGCAAGCTCAAGA
ATGGACGCTGGAATCCAAACGGAAAAAGAAAACTGTCATCCGAATTACCA
GTTCAGGCTTCGTGAGGGCTCAGACGCATCCACATCGACAGACTTTTATG
AGGATATACTGGCTGAGAAGTTGAGGAATCAACAAGAACACCAACAACGT
CATCAAGGATGTGAAGTTAACGATGGTGAATTTTTACGTGACTTTCCAAG
AGATTTCGCGCCCATTCCGCCACCGTCGATCCTGCCACCACCACCATCGT
CACAAAACAGACCAACTACAAACGACGATGACTATCAACACCAGCACCAC
TATCGTCCACATTCACCACCACCAAATATGCAAAACATGACTACTGATTT
AGAATACAACAATCGTTATTCAGGTCATCATTCAATGACAAATCTAGACG
GCACAAGTAATCCAAGGAGCCGTGCAAGCACCAACGATCATGAGGAGACA
AACATGTCTATTGTGTCAGGCTCAATATCCAATCGTACAAGCTCATCACT
GGATGGATCACATTACCCTCCGCCACCATCATCCTACCCTCCCTCTTCGT
ACCCACCGTCTTCGTACCCATCATCTTCATACCCATCATACACCGCTTCA
AACCCTTCAACAACTTCAACATTGCTAGCTGAAGACCCTGATACAGATAC
CAACAGTAGAATTTTGGAGCACTCTTACCATAACTTAATTGAAAGACCAA
CTTCCATATCTTCTGCTGGTTCACTAACCAAGGAACCAATAGAGAACGAC
AGCTTTAGTGTGACCTGCCACATGATATTATTGAAGAGATTAGCTGCTGT
CTGAATCCCAGACTGTTAAGGAAGGATTATCGTTCACTTGCTGGGAAAAT
GGGGATGACACATCGGCAAGTAAAAAACATTGACTCAAAACAAAATCCAA
CAGAGGAACTGATCAACCTCTGGGTAACTGGTCCAGGATCCAAGACAGTG
ACTGATCTGATGGGCAAACTTAAAGAAATTGAGCGCCATGACGCAATAAG
GATTCTGCAGGAGCATGAATTCACAGATGGCTTTCGTTGAATTTGCTGAT
GGTGACTCAAAGCCACGGTTCAAGCCAACCCATGTGAGCATTTGGAGATC
CACGAGAATCGTCTCTTACCGGAAGGCTTTTTGCCGCCCTGTTCGGGATT
CAAGGACGTGGTTTCATTCCGTATCCGTGACCTGCAAAAGGTGACTTACG
AACTGTTATTAGTATTGGAGATCACTGCCTCTTTAAAAAACGAACCTTGT
AACGTGGAAGTCAAACTGAACGCCGACTTTCCACTCATTTCAAGCTTTAT
ACAAGAATTTTTGTCTTGGATCACGGCGGATAAGAGGGCCACTGGTGGGA
TGAAAAACACATGGGTCTGAAACCACCAGAGGGGCAAACGATTTCCCGTG
AAGAAGAAAAACTTCGATTGCGACTCGAGTACAAATCAATGTTCTCGAAC
ATGTTGCAAATTAATGTTTCAATTTCCAATCAAAACGACGCACCATTCTT
TTTGAGGGATGTCAAACTTCGTAACACATCCTTCAAGTTCAATGCCAGCT
TTCGAAGCGCACGATCTCAGCCATGGAATCTACATGACGCATCTGCTACC
ACGTATCAAGGAGGACAAAAGAATAGAACACATCTTGATGGAGGTCAATG
AGGCGGTACATGGAAACCCATTGGTCGTCCAACGCCCAGTTTTCGAAAGC
GACGCTATTGGTGATTGTAGGCTGACCTGTAAAATTGACGCTCAGGCAAA
TTATGAACACTGGTCACAGCGTTTTGACAAATGGTTTGAGGCTACTCTAT
AAATGTATCAAGCACAAGAGGAACTCTCCAGAAAACTGGCTTTGGAAACA
CGATCATGGCTTATAGTTGGAAATGAGACTGGCAAACACAGCTCTGAATT
TATTTATTATTGATGCTTGCCGCGTGAAAGGCTTCGGACAAAATCGCGCT
ATTAATCGGGAACACAAATTATAAACACTTGGAAGAACCCTTGGTGTTTC
CTCACAGAGACGTATACGCCCTTGGTCACGCCTTAAATGAGCTCGGATTT
AAAGTGTTGACTCTTGTTGACTTGACCTTACGGGAAATGAGGACCATCAT
GCTTGCGTATTGTCAACTTCTTGGTCCTGGTGTTTTCGCTGTTTTTTATT
TCGCTGGTCACGGTTTTGAAGAGAATGGCAAGAATTATTTGATGCCCATT
GATGCGACCAGCACCAAAGGAGACGAATTTATTCAAGCTCAAGAAATCTT
AACCTGTCACCTACGATGGGAGATCTACCACCGCAAAATTTTGCAACTAC
TCCCGGTCCAGAATTAAATTGCAAACCACCATTAGTAGCAAGCTCAAGAA
TGGACGCTGGAATCCAAACGGAAAAAGAAAACTGTCATCCGAATTACCAG
TTCAGGCTTCGTGAGGGCTCAGACGCATCCACATCGACAGACTTTTATGA
GGATATACTGGCTGAGAAGTTGAGGAATCAACAAGAACACCAACAACGTC
ATCAAGGATGTGAAGTTAACGATGGTGAATTTTTACGTGACTTTCCAAGA
GATTTCGCGCCCATTCCGCCACCGTCGATCCTGCCACCACCACCATCGTC
ACAAAACAGACCAACTACAAACGACGATGACTATCAACACCAGCACCACT
ATCGTCCACATTCACCACCACCAAATATGCAAAACATGACTACTGATTTA
GAATACAACAATCGTTATTCAGGTCATCATTCAATGACAAATCTAGACGG
CACAAGTAATCCAAGGAGCCGTGCAAGCACCAACGATCATGAGGAGACAA
ACATGTCTATTGTGTCAGGCTCAATATCCAATCGTACAAGCTCATCACTG
GATGGATCACATTACCCTCCGCCACCATCATCCTACCCTCCCTCTTCGTA
CCCACCGTCTTCGTACCCATCATCTTCATACCCATCATACACCGCTTCAA
ACCCTTCAACAACTTCAACATTGCTAGCTGAAGACCCTGATACAGATACC
AACAGTAGAATTTTGGAGCACTCTTACCATAACTTAATTGAAAGACCAAC
TTCCATATCTTCTGCTGGTTCACTAACCAAGGAACCAATAGAGAACGACA
GCTTTAGTGTGACCTGCCACATGATATTATTGAAGAGATTAGCTGCTGTC
TGAATCCCAGACTGTTAAGGAAGGATTATCGTTCACTTGCTGGGAAAATG
GGGATGACACATCGGCAAGTAAAAAACATTGACTCAAAACAAAATCCAAC
AGAGGAACTGATCAACCTCTGGGTAACTGGTCCAGGATCCAAGACAGTGA
CTGATCTGATGGGCAAACTTAAAGAAATTGAGCGCCATGACGCAATAAGG
ATTCTGCAGGAGCATGAATTCACAGATGGCTTTCGTTGAATTTGCTGATG
GTGACTCAAAGCCACGGTTCAAGCCAACCCATGTGAGCATTTGGAGATCC
ACGAGAATCGTCTCTTACCGGAAGGCTTTTTGCCGCCCTGTTCGGGATTC
AAGGACGTGGTTTCATTCCGTATCCGTGACCTGCAAAAGGTGACTTACGA
ACTGTTATTAGTATTGGAGATCACTGCCTCTTTAAAAAACGAACCTTGTA
ACGTGGAAGTCAAACTGAACGCCGACTTTCCACTCATTTCAAGCTTTATA
CAAGAATTTTTGTCTTGGATCACGGCGGATAAGAGGGCCACTGGTGGGAT
GAAAAACACATGGGTCTGAAACCACCAGAGGGGCAAACGATTTCCCGTGA
AGAAGAAAAACTTCGATTGCGACTCGAGTACAAATCAATGTTCTCGAACA
TGTTGCAAATTAATGTTTCAATTTCCAATCAAAACGACGCACCATTCTTT
TTGAGGGATGTCAAACTTCGTAACACATCCTTCAAGTTCAATGCCAGCTT
TCGAAGCGCACGATCTCAGCCATGGAATCTACATGACGCATCTGCTACCA
CGTATCAAGGAGGACAAAAGAATAGAACACATCTTGATGGAGGTCAATGA
GGCGGTACATGGAAACCCATTGGTCGTCCAACGCCCAGTTTTCGAAAGCG
ACGCTATTGGTGATTGTAGGCTGACCTGTAAAATTGACGCTCAGGCAAAT
TATGAACACTGGTCACAGCGTTTTGACAAATGGTTTGAGGCTACTCTATA
AATGTATCAAGCACAAGAGGAACTCTCCAGAAAACTGGCTTTGGAAACAC
GATCATGGCTTATAGTTGGAAATGAGACTGGCAAACACAGCTCTGAATTT
ATTTATTATTGATGCTTGCCGCGTGAAAGGCTTCGGACAAAATCGCGCTA
TTAATCGGGAACACAAATTATAAACACTTGGAAGAACCCTTGGTGTTTCC
TCACAGAGACGTATACGCCCTTGGTCACGCCTTAAATGAGCTCGGATTTA
AAGTGTTGACTCTTGTTGACTTGACCTTACGGGAAATGAGGACCATCATG
CTTGCGTATTGTCAACTTCTTGGTCCTGGTGTTTTCGCTGTTTTTTATTT
CGCTGGTCACGGTTTTGAAGAGAATGGCAAGAATTATTTGATGCCCATTG
ATGCGACCAGCACCAAAGGAGACGAATTTATTCAAGCTCAAGAAATCTTA
ACCTGTCACCTACGATGGGAGATCTACCACCGCAAAATTTTGCAACTACT
CCCGGTCCAGAATTAAATTGCAAACCACCATTAGTAGCAAGCTCAAGAAT
GGACGCTGGAATCCAAACGGAAAAAGAAAACTGTCATCCGAATTACCAGT
TCAGGCTTCGTGAGGGCTCAGACGCATCCACATCGACAGACTTTTATGAG
GATATACTGGCTGAGAAGTTGAGGAATCAACAAGAACACCAACAACGTCA
TCAAGGATGTGAAGTTAACGATGGTGAATTTTTACGTGACTTTCCAAGAG
ATTTCGCGCCCATTCCGCCACCGTCGATCCTGCCACCACCACCATCGTCA
CAAAACAGACCAACTACAAACGACGATGACTATCAACACCAGCACCACTA
TCGTCCACATTCACCACCACCAAATATGCAAAACATGACTACTGATTTAG
AATACAACAATCGTTATTCAGGTCATCATTCAATGACAAATCTAGACGGC
ACAAGTAATCCAAGGAGCCGTGCAAGCACCAACGATCATGAGGAGACAAA
CATGTCTATTGTGTCAGGCTCAATATCCAATCGTACAAGCTCATCACTGG
ATGGATCACATTACCCTCCGCCACCATCATCCTACCCTCCCTCTTCGTAC
CCACCGTCTTCGTACCCATCATCTTCATACCCATCATACACCGCTTCAAA
CCCTTCAACAACTTCAACATTGCTAGCTGAAGACCCTGATACAGATACCA
ACAGTAGAATTTTGGAGCACTCTTACCATAACTTAATTGAAAGACCAACT
TCCATATCTTCTGCTGGTTCACTAACCAAGGAACCAATAGAGAACGACAG
CTTTAGTGTGACCTGCCACATGATATTATTGAAGAGATTAGCTGCTGTCT
GAATCCCAGACTGTTAAGGAAGGATTATCGTTCACTTGCTGGGAAAATGG
GGATGACACATCGGCAAGTAAAAAACATTGACTCAAAACAAAATCCAACA
GAGGAACTGATCAACCTCTGGGTAACTGGTCCAGGATCCAAGACAGTGAC
TGATCTGATGGGCAAACTTAAAGAAATTGAGCGCCATGACGCAATAAGGA
TTCTGCAGGAGCATGAATTCACAGATGGCTTTCGTTGAATTTGCTGATGG
TGACTCAAAGCCACGGTTCAAGCCAACCCATGTGAGCATTTGGAGATCCA
CGAGAATCGTCTCTTACCGGAAGGCTTTTTGCCGCCCTGTTCGGGATTCA
AGGACGTGGTTTCATTCCGTATCCGTGACCTGCAAAAGGTGACTTACGAA
CTGTTATTAGTATTGGAGATCACTGCCTCTTTAAAAAACGAACCTTGTAA
CGTGGAAGTCAAACTGAACGCCGACTTTCCACTCATTTCAAGCTTTATAC
AAGAATTTTTGTCTTGGATCACGGCGGATAAGAGGGCCACTGGTGGGATG
AAAAACACATGGGTCTGAAACCACCAGAGGGGCAAACGATTTCCCGTGAA
GAAGAAAAACTTCGATTGCGACTCGAGTACAAATCAATGTTCTCGAACAT
GTTGCAAATTAATGTTTCAATTTCCAATCAAAACGACGCACCATTCTTTT
TGAGGGATGTCAAACTTCGTAACACATCCTTCAAGTTCAATGCCAGCTTT
CGAAGCGCACGATCTCAGCCATGGAATCTACATGACGCATCTGCTACCAC
GTATCAAGGAGGACAAAAGAATAGAACACATCTTGATGGAGGTCAATGAG
GCGGTACATGGAAACCCATTGGTCGTCCAACGCCCAGTTTTCGAAAGCGA
CGCTATTGGTGATTGTAGGCTGACCTGTAAAATTGACGCTCAGGCAAATT
ATGAACACTGGTCACAGCGTTTTGACAAATGGTTTGAGGCTACTCTATAA
ATGTATCAAGCACAAGAGGAACTCTCCAGAAAACTGGCTTTGGAAACACG
ATCATGGCTTATAGTTGGAAATGAGACTGGCAAACACAGCTCTGAATTTA
TTTATTATTGATGCTTGCCGCGTGAAAGGCTTCGGACAAAATCGCGCTAT
TAATCGGGAACACAAATTATAAACACTTGGAAGAACCCTTGGTGTTTCCT
CACAGAGACGTATACGCCCTTGGTCACGCCTTAAATGAGCTCGGATTTAA
AGTGTTGACTCTTGTTGACTTGACCTTACGGGAAATGAGGACCATCATGC
TTGCGTATTGTCAACTTCTTGGTCCTGGTGTTTTCGCTGTTTTTTATTTC
GCTGGTCACGGTTTTGAAGAGAATGGCAAGAATTATTTGATGCCCATTGA
TGCGACCAGCACCAAAGGAGACGAATTTATTCAAGCTCAAGAAATCTTAA
CCTGTCACCTACGATGGGAGATCTACCACCGCAAAATTTTGCAACTACTC
CCGGTCCAGAATTAAATTGCAAACCACCATTAGTAGCAAGCTCAAGAATG
GACGCTGGAATCCAAACGGAAAAAGAAAACTGTCATCCGAATTACCAGTT
CAGGCTTCGTGAGGGCTCAGACGCATCCACATCGACAGACTTTTATGAGG
ATATACTGGCTGAGAAGTTGAGGAATCAACAAGAACACCAACAACGTCAT
CAAGGATGTGAAGTTAACGATGGTGAATTTTTACGTGACTTTCCAAGAGA
TTTCGCGCCCATTCCGCCACCGTCGATCCTGCCACCACCACCATCGTCAC
AAAACAGACCAACTACAAACGACGATGACTATCAACACCAGCACCACTAT
CGTCCACATTCACCACCACCAAATATGCAAAACATGACTACTGATTTAGA
ATACAACAATCGTTATTCAGGTCATCATTCAATGACAAATCTAGACGGCA
CAAGTAATCCAAGGAGCCGTGCAAGCACCAACGATCATGAGGAGACAAAC
ATGTCTATTGTGTCAGGCTCAATATCCAATCGTACAAGCTCATCACTGGA
TGGATCACATTACCCTCCGCCACCATCATCCTACCCTCCCTCTTCGTACC
CACCGTCTTCGTACCCATCATCTTCATACCCATCATACACCGCTTCAAAC
CCTTCAACAACTTCAACATTGCTAGCTGAAGACCCTGATACAGATACCAA
CAGTAGAATTTTGGAGCACTCTTACCATAACTTAATTGAAAGACCAACTT
CCATATCTTCTGCTGGTTCACTAACCAAGGAACCAATAGAGAACGACAGC
TTTAGTGTGACCTGCCACATGATATTATTGAAGAGATTAGCTGCTGTCTG
AATCCCAGACTGTTAAGGAAGGATTATCGTTCACTTGCTGGGAAAATGGG
GATGACACATCGGCAAGTAAAAAACATTGACTCAAAACAAAATCCAACAG
AGGAACTGATCAACCTCTGGGTAACTGGTCCAGGATCCAAGACAGTGACT
GATCTGATGGGCAAACTTAAAGAAATTGAGCGCCATGACGCAATAAGGAT
TCTGCAGGAGCATGAATTCACAGATGGCTTTCGTTGAATTTGCTGATGGT
GACTCAAAGCCACGGTTCAAGCCAACCCATGTGAGCATTTGGAGATCCAC
GAGAATCGTCTCTTACCGGAAGGCTTTTTGCCGCCCTGTTCGGGATTCAA
GGACGTGGTTTCATTCCGTATCCGTGACCTGCAAAAGGTGACTTACGAAC
TGTTATTAGTATTGGAGATCACTGCCTCTTTAAAAAACGAACCTTGTAAC
GTGGAAGTCAAACTGAACGCCGACTTTCCACTCATTTCAAGCTTTATACA
AGAATTTTTGTCTTGGATCACGGCGGATAAGAGGGCCACTGGTGGGATGA
AAAACACATGGGTCTGAAACCACCAGAGGGGCAAACGATTTCCCGTGAAG
AAGAAAAACTTCGATTGCGACTCGAGTACAAATCAATGTTCTCGAACATG
TTGCAAATTAATGTTTCAATTTCCAATCAAAACGACGCACCATTCTTTTT
GAGGGATGTCAAACTTCGTAACACATCCTTCAAGTTCAATGCCAGCTTTC
GAAGCGCACGATCTCAGCCATGGAATCTACATGACGCATCTGCTACCACG
TATCAAGGAGGACAAAAGAATAGAACACATCTTGATGGAGGTCAATGAGG
CGGTACATGGAAACCCATTGGTCGTCCAACGCCCAGTTTTCGAAAGCGAC
GCTATTGGTGATTGTAGGCTGACCTGTAAAATTGACGCTCAGGCAAATTA
TGAACACTGGTCACAGCGTTTTGACAAATGGTTTGAGGCTACTCTATAAA
TGTATCAAGCACAAGAGGAACTCTCCAGAAAACTGGCTTTGGAAACACGA
TCATGGCTTATAGTTGGAAATGAGACTGGCAAACACAGCTCTGAATTTAT
TTATTATTGATGCTTGCCGCGTGAAAGGCTTCGGACAAAATCGCGCTATT
AATCGGGAACACAAATTATAAACACTTGGAAGAACCCTTGGTGTTTCCTC
ACAGAGACGTATACGCCCTTGGTCACGCCTTAAATGAGCTCGGATTTAAA
GTGTTGACTCTTGTTGACTTGACCTTACGGGAAATGAGGACCATCATGCT
TGCGTATTGTCAACTTCTTGGTCCTGGTGTTTTCGCTGTTTTTTATTTCG
CTGGTCACGGTTTTGAAGAGAATGGCAAGAATTATTTGATGCCCATTGAT
GCGACCAGCACCAAAGGAGACGAATTTATTCAAGCTCAAGAAATCTTAAC
CTGTCACCTACGATGGGAGATCTACCACCGCAAAATTTTGCAACTACTCC
CGGTCCAGAATTAAATTGCAAACCACCATTAGTAGCAAGCTCAAGAATGG
ACGCTGGAATCCAAACGGAAAAAGAAAACTGTCATCCGAATTACCAGTTC
AGGCTTCGTGAGGGCTCAGACGCATCCACATCGACAGACTTTTATGAGGA
TATACTGGCTGAGAAGTTGAGGAATCAACAAGAACACCAACAACGTCATC
AAGGATGTGAAGTTAACGATGGTGAATTTTTACGTGACTTTCCAAGAGAT
TTCGCGCCCATTCCGCCACCGTCGATCCTGCCACCACCACCATCGTCACA
AAACAGACCAACTACAAACGACGATGACTATCAACACCAGCACCACTATC
GTCCACATTCACCACCACCAAATATGCAAAACATGACTACTGATTTAGAA
TACAACAATCGTTATTCAGGTCATCATTCAATGACAAATCTAGACGGCAC
AAGTAATCCAAGGAGCCGTGCAAGCACCAACGATCATGAGGAGACAAACA
TGTCTATTGTGTCAGGCTCAATATCCAATCGTACAAGCTCATCACTGGAT
GGATCACATTACCCTCCGCCACCATCATCCTACCCTCCCTCTTCGTACCC
ACCGTCTTCGTACCCATCATCTTCATACCCATCATACACCGCTTCAAACC
CTTCAACAACTTCAACATTGCTAGCTGAAGACCCTGATACAGATACCAAC
AGTAGAATTTTGGAGCACTCTTACCATAACTTAATTGAAAGACCAACTTC
CATATCTTCTGCTGGTTCACTAACCAAGGAACCAATAGAGAACGACAGCT
TTAGTGTGACCTGCCACATGATATTATTGAAGAGATTAGCTGCTGTCTGA
ATCCCAGACTGTTAAGGAAGGATTATCGTTCACTTGCTGGGAAAATGGGG
ATGACACATCGGCAAGTAAAAAACATTGACTCAAAACAAAATCCAACAGA
GGAACTGATCAACCTCTGGGTAACTGGTCCAGGATCCAAGACAGTGACTG
ATCTGATGGGCAAACTTAAAGAAATTGAGCGCCATGACGCAATAAGGATT
CTGCAGGAGCATGAATTCACAGATGGCTTTCGTTGAATTTGCTGATGGTG
ACTCAAAGCCACGGTTCAAGCCAACCCATGTGAGCATTTGGAGATCCACG
AGAATCGTCTCTTACCGGAAGGCTTTTTGCCGCCCTGTTCGGGATTCAAG
GACGTGGTTTCATTCCGTATCCGTGACCTGCAAAAGGTGACTTACGAACT
GTTATTAGTATTGGAGATCACTGCCTCTTTAAAAAACGAACCTTGTAACG
TGGAAGTCAAACTGAACGCCGACTTTCCACTCATTTCAAGCTTTATACAA
GAATTTTTGTCTTGGATCACGGCGGATAAGAGGGCCACTGGTGGGATGAA
AAACACATGGGTCTGAAACCACCAGAGGGGCAAACGATTTCCCGTGAAGA
AGAAAAACTTCGATTGCGACTCGAGTACAAATCAATGTTCTCGAACATGT
TGCAAATTAATGTTTCAATTTCCAATCAAAACGACGCACCATTCTTTTTG
AGGGATGTCAAACTTCGTAACACATCCTTCAAGTTCAATGCCAGCTTTCG
AAGCGCACGATCTCAGCCATGGAATCTACATGACGCATCTGCTACCACGT
ATCAAGGAGGACAAAAGAATAGAACACATCTTGATGGAGGTCAATGAGGC
GGTACATGGAAACCCATTGGTCGTCCAACGCCCAGTTTTCGAAAGCGACG
CTATTGGTGATTGTAGGCTGACCTGTAAAATTGACGCTCAGGCAAATTAT
GAACACTGGTCACAGCGTTTTGACAAATGGTTTGAGGCTACTCTATAAAT
GTATCAAGCACAAGAGGAACTCTCCAGAAAACTGGCTTTGGAAACACGAT
CATGGCTTATAGTTGGAAATGAGACTGGCAAACACAGCTCTGAATTTATT
TATTATTGATGCTTGCCGCGTGAAAGGCTTCGGACAAAATCGCGCTATTA
ATCGGGAACACAAATTATAAACACTTGGAAGAACCCTTGGTGTTTCCTCA
CAGAGACGTATACGCCCTTGGTCACGCCTTAAATGAGCTCGGATTTAAAG
TGTTGACTCTTGTTGACTTGACCTTACGGGAAATGAGGACCATCATGCTT
GCGTATTGTCAACTTCTTGGTCCTGGTGTTTTCGCTGTTTTTTATTTCGC
TGGTCACGGTTTTGAAGAGAATGGCAAGAATTATTTGATGCCCATTGATG
CGACCAGCACCAAAGGAGACGAATTTATTCAAGCTCAAGAAATCTTAACC
TGTCACCTACGATGGGAGATCTACCACCGCAAAATTTTGCAACTACTCCC
GGTCCAGAATTAAATTGCAAACCACCATTAGTAGCAAGCTCAAGAATGGA
CGCTGGAATCCAAACGGAAAAAGAAAACTGTCATCCGAATTACCAGTTCA
GGCTTCGTGAGGGCTCAGACGCATCCACATCGACAGACTTTTATGAGGAT
ATACTGGCTGAGAAGTTGAGGAATCAACAAGAACACCAACAACGTCATCA
AGGATGTGAAGTTAACGATGGTGAATTTTTACGTGACTTTCCAAGAGATT
TCGCGCCCATTCCGCCACCGTCGATCCTGCCACCACCACCATCGTCACAA
AACAGACCAACTACAAACGACGATGACTATCAACACCAGCACCACTATCG
TCCACATTCACCACCACCAAATATGCAAAACATGACTACTGATTTAGAAT
ACAACAATCGTTATTCAGGTCATCATTCAATGACAAATCTAGACGGCACA
AGTAATCCAAGGAGCCGTGCAAGCACCAACGATCATGAGGAGACAAACAT
GTCTATTGTGTCAGGCTCAATATCCAATCGTACAAGCTCATCACTGGATG
GATCACATTACCCTCCGCCACCATCATCCTACCCTCCCTCTTCGTACCCA
CCGTCTTCGTACCCATCATCTTCATACCCATCATACACCGCTTCAAACCC
TTCAACAACTTCAACATTGCTAGCTGAAGACCCTGATACAGATACCAACA
GTAGAATTTTGGAGCACTCTTACCATAACTTAATTGAAAGACCAACTTCC
ATATCTTCTGCTGGTTCACTAACCAAGGAACCAATAGAGAACGACAGCTT
TAGTGTGACCTGCCACATGATATTATTGAAGAGATTAGCTGCTGTCTGAA
TCCCAGACTGTTAAGGAAGGATTATCGTTCACTTGCTGGGAAAATGGGGA
TGACACATCGGCAAGTAAAAAACATTGACTCAAAACAAAATCCAACAGAG
GAACTGATCAACCTCTGGGTAACTGGTCCAGGATCCAAGACAGTGACTGA
TCTGATGGGCAAACTTAAAGAAATTGAGCGCCATGACGCAATAAGGATTC
TGCAGGAGCATGAATTCACAGATGGCTTTCGTTGAATTTGCTGATGGTGA
CTCAAAGCCACGGTTCAAGCCAACCCATGTGAGCATTTGGAGATCCACGA
GAATCGTCTCTTACCGGAAGGCTTTTTGCCGCCCTGTTCGGGATTCAAGG
ACGTGGTTTCATTCCGTATCCGTGACCTGCAAAAGGTGACTTACGAACTG
TTATTAGTATTGGAGATCACTGCCTCTTTAAAAAACGAACCTTGTAACGT
GGAAGTCAAACTGAACGCCGACTTTCCACTCATTTCAAGCTTTATACAAG
AATTTTTGTCTTGGATCACGGCGGATAAGAGGGCCACTGGTGGGATGAAA
AACACATGGGTCTGAAACCACCAGAGGGGCAAACGATTTCCCGTGAAGAA
GAAAAACTTCGATTGCGACTCGAGTACAAATCAATGTTCTCGAACATGTT
GCAAATTAATGTTTCAATTTCCAATCAAAACGACGCACCATTCTTTTTGA
GGGATGTCAAACTTCGTAACACATCCTTCAAGTTCAATGCCAGCTTTCGA
AGCGCACGATCTCAGCCATGGAATCTACATGACGCATCTGCTACCACGTA
TCAAGGAGGACAAAAGAATAGAACACATCTTGATGGAGGTCAATGAGGCG
GTACATGGAAACCCATTGGTCGTCCAACGCCCAGTTTTCGAAAGCGACGC
TATTGGTGATTGTAGGCTGACCTGTAAAATTGACGCTCAGGCAAATTATG
AACACTGGTCACAGCGTTTTGACAAATGGTTTGAGGCTACTCTATAAATG
TATCAAGCACAAGAGGAACTCTCCAGAAAACTGGCTTTGGAAACACGATC
ATGGCTTATAGTTGGAAATGAGACTGGCAAACACAGCTCTGAATTTATTT
ATTATTGATGCTTGCCGCGTGAAAGGCTTCGGACAAAATCGCGCTATTAA
TCGGGAACACAAATTATAAACACTTGGAAGAACCCTTGGTGTTTCCTCAC
AGAGACGTATACGCCCTTGGTCACGCCTTAAATGAGCTCGGATTTAAAGT
GTTGACTCTTGTTGACTTGACCTTACGGGAAATGAGGACCATCATGCTTG
CGTATTGTCAACTTCTTGGTCCTGGTGTTTTCGCTGTTTTTTATTTCGCT
GGTCACGGTTTTGAAGAGAATGGCAAGAATTATTTGATGCCCATTGATGC
GACCAGCACCAAAGGAGACGAATTTATTCAAGCTCAAGAAATCTTAACCT
GTCACCTACGATGGGAGATCTACCACCGCAAAATTTTGCAACTACTCCCG
GTCCAGAATTAAATTGCAAACCACCATTAGTAGCAAGCTCAAGAATGGAC
GCTGGAATCCAAACGGAAAAAGAAAACTGTCATCCGAATTACCAGTTCAG
GCTTCGTGAGGGCTCAGACGCATCCACATCGACAGACTTTTATGAGGATA
TACTGGCTGAGAAGTTGAGGAATCAACAAGAACACCAACAACGTCATCAA
GGATGTGAAGTTAACGATGGTGAATTTTTACGTGACTTTCCAAGAGATTT
CGCGCCCATTCCGCCACCGTCGATCCTGCCACCACCACCATCGTCACAAA
ACAGACCAACTACAAACGACGATGACTATCAACACCAGCACCACTATCGT
CCACATTCACCACCACCAAATATGCAAAACATGACTACTGATTTAGAATA
CAACAATCGTTATTCAGGTCATCATTCAATGACAAATCTAGACGGCACAA
GTAATCCAAGGAGCCGTGCAAGCACCAACGATCATGAGGAGACAAACATG
TCTATTGTGTCAGGCTCAATATCCAATCGTACAAGCTCATCACTGGATGG
ATCACATTACCCTCCGCCACCATCATCCTACCCTCCCTCTTCGTACCCAC
CGTCTTCGTACCCATCATCTTCATACCCATCATACACCGCTTCAAACCCT
TCAACAACTTCAACATTGCTAGCTGAAGACCCTGATACAGATACCAACAG
TAGAATTTTGGAGCACTCTTACCATAACTTAATTGAAAGACCAACTTCCA
TATCTTCTGCTGGTTCACTAACCAAGGAACCAATAGAGAACGACAGCTTT
AGTGTGACCTGCCACATGATATTATTGAAGAGATTAGCTGCTGTCTGAAT
CCCAGACTGTTAAGGAAGGATTATCGTTCACTTGCTGGGAAAATGGGGAT
GACACATCGGCAAGTAAAAAACATTGACTCAAAACAAAATCCAACAGAGG
AACTGATCAACCTCTGGGTAACTGGTCCAGGATCCAAGACAGTGACTGAT
CTGATGGGCAAACTTAAAGAAATTGAGCGCCATGACGCAATAAGGATTCT
GCAGGAGCATGAATTCACAGATGGCTTTCGTTGAATTTGCTGATGGTGAC
TCAAAGCCACGGTTCAAGCCAACCCATGTGAGCATTTGGAGATCCACGAG
AATCGTCTCTTACCGGAAGGCTTTTTGCCGCCCTGTTCGGGATTCAAGGA
CGTGGTTTCATTCCGTATCCGTGACCTGCAAAAGGTGACTTACGAACTGT
TATTAGTATTGGAGATCACTGCCTCTTTAAAAAACGAACCTTGTAACGTG
GAAGTCAAACTGAACGCCGACTTTCCACTCATTTCAAGCTTTATACAAGA
ATTTTTGTCTTGGATCACGGCGGATAAGAGGGCCACTGGTGGGATGAAAA
ACACATGGGTCTGAAACCACCAGAGGGGCAAACGATTTCCCGTGAAGAAG
AAAAACTTCGATTGCGACTCGAGTACAAATCAATGTTCTCGAACATGTTG
CAAATTAATGTTTCAATTTCCAATCAAAACGACGCACCATTCTTTTTGAG
GGATGTCAAACTTCGTAACACATCCTTCAAGTTCAATGCCAGCTTTCGAA
GCGCACGATCTCAGCCATGGAATCTACATGACGCATCTGCTACCACGTAT
CAAGGAGGACAAAAGAATAGAACACATCTTGATGGAGGTCAATGAGGCGG
TACATGGAAACCCATTGGTCGTCCAACGCCCAGTTTTCGAAAGCGACGCT
ATTGGTGATTGTAGGCTGACCTGTAAAATTGACGCTCAGGCAAATTATGA
ACACTGGTCACAGCGTTTTGACAAATGGTTTGAGGCTACTCTATAAATGT
ATCAAGCACAAGAGGAACTCTCCAGAAAACTGGCTTTGGAAACACGATCA
TGGCTTATAGTTGGAAATGAGACTGGCAAACACAGCTCTGAATTTATTTA
TTATTGATGCTTGCCGCGTGAAAGGCTTCGGACAAAATCGCGCTATTAAT
CGGGAACACAAATTATAAACACTTGGAAGAACCCTTGGTGTTTCCTCACA
GAGACGTATACGCCCTTGGTCACGCCTTAAATGAGCTCGGATTTAAAGTG
TTGACTCTTGTTGACTTGACCTTACGGGAAATGAGGACCATCATGCTTGC
GTATTGTCAACTTCTTGGTCCTGGTGTTTTCGCTGTTTTTTATTTCGCTG
GTCACGGTTTTGAAGAGAATGGCAAGAATTATTTGATGCCCATTGATGCG
ACCAGCACCAAAGGAGACGAATTTATTCAAGCTCAAGAAATCTTAACCTG
TCACCTACGATGGGAGATCTACCACCGCAAAATTTTGCAACTACTCCCGG
TCCAGAATTAAATTGCAAACCACCATTAGTAGCAAGCTCAAGAATGGACG
CTGGAATCCAAACGGAAAAAGAAAACTGTCATCCGAATTACCAGTTCAGG
CTTCGTGAGGGCTCAGACGCATCCACATCGACAGACTTTTATGAGGATAT
ACTGGCTGAGAAGTTGAGGAATCAACAAGAACACCAACAACGTCATCAAG
GATGTGAAGTTAACGATGGTGAATTTTTACGTGACTTTCCAAGAGATTTC
GCGCCCATTCCGCCACCGTCGATCCTGCCACCACCACCATCGTCACAAAA
CAGACCAACTACAAACGACGATGACTATCAACACCAGCACCACTATCGTC
CACATTCACCACCACCAAATATGCAAAACATGACTACTGATTTAGAATAC
AACAATCGTTATTCAGGTCATCATTCAATGACAAATCTAGACGGCACAAG
TAATCCAAGGAGCCGTGCAAGCACCAACGATCATGAGGAGACAAACATGT
CTATTGTGTCAGGCTCAATATCCAATCGTACAAGCTCATCACTGGATGGA
TCACATTACCCTCCGCCACCATCATCCTACCCTCCCTCTTCGTACCCACC
GTCTTCGTACCCATCATCTTCATACCCATCATACACCGCTTCAAACCCTT
CAACAACTTCAACATTGCTAGCTGAAGACCCTGATACAGATACCAACAGT
AGAATTTTGGAGCACTCTTACCATAACTTAATTGAAAGACCAACTTCCAT
ATCTTCTGCTGGTTCACTAACCAAGGAACCAATAGAGAACGACAGCTTTA
GTGTGACCTGCCACATGATATTATTGAAGAGATTAGCTGCTGTCTGAATC
CCAGACTGTTAAGGAAGGATTATCGTTCACTTGCTGGGAAAATGGGGATG
ACACATCGGCAAGTAAAAAACATTGACTCAAAACAAAATCCAACAGAGGA
ACTGATCAACCTCTGGGTAACTGGTCCAGGATCCAAGACAGTGACTGATC
TGATGGGCAAACTTAAAGAAATTGAGCGCCATGACGCAATAAGGATTCTG
CAGGAGCATGAATTCACAGATGGCTTTCGTTGAATTTGCTGATGGTGACT
CAAAGCCACGGTTCAAGCCAACCCATGTGAGCATTTGGAGATCCACGAGA
ATCGTCTCTTACCGGAAGGCTTTTTGCCGCCCTGTTCGGGATTCAAGGAC
GTGGTTTCATTCCGTATCCGTGACCTGCAAAAGGTGACTTACGAACTGTT
ATTAGTATTGGAGATCACTGCCTCTTTAAAAAACGAACCTTGTAACGTGG
AAGTCAAACTGAACGCCGACTTTCCACTCATTTCAAGCTTTATACAAGAA
TTTTTGTCTTGGATCACGGCGGATAAGAGGGCCACTGGTGGGATGAAAAA
CACATGGGTCTGAAACCACCAGAGGGGCAAACGATTTCCCGTGAAGAAGA
AAAACTTCGATTGCGACTCGAGTACAAATCAATGTTCTCGAACATGTTGC
AAATTAATGTTTCAATTTCCAATCAAAACGACGCACCATTCTTTTTGAGG
GATGTCAAACTTCGTAACACATCCTTCAAGTTCAATGCCAGCTTTCGAAG
CGCACGATCTCAGCCATGGAATCTACATGACGCATCTGCTACCACGTATC
AAGGAGGACAAAAGAATAGAACACATCTTGATGGAGGTCAATGAGGCGGT
ACATGGAAACCCATTGGTCGTCCAACGCCCAGTTTTCGAAAGCGACGCTA
TTGGTGATTGTAGGCTGACCTGTAAAATTGACGCTCAGGCAAATTATGAA
CACTGGTCACAGCGTTTTGACAAATGGTTTGAGGCTACTCTATAAATGTA
TCAAGCACAAGAGGAACTCTCCAGAAAACTGGCTTTGGAAACACGATCAT
GGCTTATAGTTGGAAATGAGACTGGCAAACACAGCTCTGAATTTATTTAT
TATTGATGCTTGCCGCGTGAAAGGCTTCGGACAAAATCGCGCTATTAATC
GGGAACACAAATTATAAACACTTGGAAGAACCCTTGGTGTTTCCTCACAG
AGACGTATACGCCCTTGGTCACGCCTTAAATGAGCTCGGATTTAAAGTGT
TGACTCTTGTTGACTTGACCTTACGGGAAATGAGGACCATCATGCTTGCG
TATTGTCAACTTCTTGGTCCTGGTGTTTTCGCTGTTTTTTATTTCGCTGG
TCACGGTTTTGAAGAGAATGGCAAGAATTATTTGATGCCCATTGATGCGA
CCAGCACCAAAGGAGACGAATTTATTCAAGCTCAAGAAATCTTAACCTGT
CACCTACGATGGGAGATCTACCACCGCAAAATTTTGCAACTACTCCCGGT
CCAGAATTAAATTGCAAACCACCATTAGTAGCAAGCTCAAGAATGGACGC
TGGAATCCAAACGGAAAAAGAAAACTGTCATCCGAATTACCAGTTCAGGC
TTCGTGAGGGCTCAGACGCATCCACATCGACAGACTTTTATGAGGATATA
CTGGCTGAGAAGTTGAGGAATCAACAAGAACACCAACAACGTCATCAAGG
ATGTGAAGTTAACGATGGTGAATTTTTACGTGACTTTCCAAGAGATTTCG
CGCCCATTCCGCCACCGTCGATCCTGCCACCACCACCATCGTCACAAAAC
AGACCAACTACAAACGACGATGACTATCAACACCAGCACCACTATCGTCC
ACATTCACCACCACCAAATATGCAAAACATGACTACTGATTTAGAATACA
ACAATCGTTATTCAGGTCATCATTCAATGACAAATCTAGACGGCACAAGT
AATCCAAGGAGCCGTGCAAGCACCAACGATCATGAGGAGACAAACATGTC
TATTGTGTCAGGCTCAATATCCAATCGTACAAGCTCATCACTGGATGGAT
CACATTACCCTCCGCCACCATCATCCTACCCTCCCTCTTCGTACCCACCG
TCTTCGTACCCATCATCTTCATACCCATCATACACCGCTTCAAACCCTTC
AACAACTTCAACATTGCTAGCTGAAGACCCTGATACAGATACCAACAGTA
GAATTTTGGAGCACTCTTACCATAACTTAATTGAAAGACCAACTTCCATA
TCTTCTGCTGGTTCACTAACCAAGGAACCAATAGAGAACGACAGCTTTAG
TGTGACCTGCCACATGATATTATTGAAGAGATTAGCTGCTGTCTGAATCC
CAGACTGTTAAGGAAGGATTATCGTTCACTTGCTGGGAAAATGGGGATGA
CACATCGGCAAGTAAAAAACATTGACTCAAAACAAAATCCAACAGAGGAA
CTGATCAACCTCTGGGTAACTGGTCCAGGATCCAAGACAGTGACTGATCT
GATGGGCAAACTTAAAGAAATTGAGCGCCATGACGCAATAAGGATTCTGC
AGGAGCATGAATTCACAGATGGCTTTCGTTGAATTTGCTGATGGTGACTC
AAAGCCACGGTTCAAGCCAACCCATGTGAG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_045514XLOC_045514Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073355-exon-scaffold_90-1575043694:96536..96659TCONS_00073355-exon-scaffold_90-1575043694:96536..96659Clytia hemisphaericaexon
TCONS_00073355-exon-scaffold_90-1575043694:96026..96291TCONS_00073355-exon-scaffold_90-1575043694:96026..96291Clytia hemisphaericaexon
TCONS_00073355-exon-scaffold_90-1575043694:95494..95568TCONS_00073355-exon-scaffold_90-1575043694:95494..95568Clytia hemisphaericaexon
TCONS_00073355-exon-scaffold_90-1575043694:94265..94303TCONS_00073355-exon-scaffold_90-1575043694:94265..94303Clytia hemisphaericaexon
TCONS_00073355-exon-scaffold_90-1575043694:93960..94097TCONS_00073355-exon-scaffold_90-1575043694:93960..94097Clytia hemisphaericaexon
TCONS_00073355-exon-scaffold_90-1575043694:92978..93046TCONS_00073355-exon-scaffold_90-1575043694:92978..93046Clytia hemisphaericaexon
TCONS_00073355-exon-scaffold_90-1575043694:92750..92797TCONS_00073355-exon-scaffold_90-1575043694:92750..92797Clytia hemisphaericaexon
TCONS_00073355-exon-scaffold_90-1575043694:92443..92487TCONS_00073355-exon-scaffold_90-1575043694:92443..92487Clytia hemisphaericaexon
TCONS_00073355-exon-scaffold_90-1575043694:92152..92220TCONS_00073355-exon-scaffold_90-1575043694:92152..92220Clytia hemisphaericaexon
TCONS_00073355-exon-scaffold_90-1575043694:91897..91998TCONS_00073355-exon-scaffold_90-1575043694:91897..91998Clytia hemisphaericaexon
TCONS_00073355-exon-scaffold_90-1575043694:90484..90567TCONS_00073355-exon-scaffold_90-1575043694:90484..90567Clytia hemisphaericaexon
TCONS_00073355-exon-scaffold_90-1575043694:89866..89928TCONS_00073355-exon-scaffold_90-1575043694:89866..89928Clytia hemisphaericaexon
TCONS_00073355-exon-scaffold_90-1575043694:89176..89214TCONS_00073355-exon-scaffold_90-1575043694:89176..89214Clytia hemisphaericaexon
TCONS_00073355-exon-scaffold_90-1575043694:88981..89064TCONS_00073355-exon-scaffold_90-1575043694:88981..89064Clytia hemisphaericaexon
TCONS_00073355-exon-scaffold_90-1575043694:88367..88689TCONS_00073355-exon-scaffold_90-1575043694:88367..88689Clytia hemisphaericaexon
TCONS_00073355-exon-scaffold_90-1575043694:88008..88069TCONS_00073355-exon-scaffold_90-1575043694:88008..88069Clytia hemisphaericaexon
TCONS_00073355-exon-scaffold_90-1575043694:87523..87594TCONS_00073355-exon-scaffold_90-1575043694:87523..87594Clytia hemisphaericaexon
TCONS_00073355-exon-scaffold_90-1575043694:86470..86735TCONS_00073355-exon-scaffold_90-1575043694:86470..86735Clytia hemisphaericaexon
TCONS_00073355-exon-scaffold_90-1575043694:86063..86223TCONS_00073355-exon-scaffold_90-1575043694:86063..86223Clytia hemisphaericaexon
TCONS_00073355-exon-scaffold_90-1575043694:84201..85541TCONS_00073355-exon-scaffold_90-1575043694:84201..85541Clytia hemisphaericaexon
TCONS_00073355-exon-scaffold_90-1510915933:96536..96659TCONS_00073355-exon-scaffold_90-1510915933:96536..96659Clytia hemisphaericaexon
TCONS_00073355-exon-scaffold_90-1510915933:96026..96291TCONS_00073355-exon-scaffold_90-1510915933:96026..96291Clytia hemisphaericaexon
TCONS_00073355-exon-scaffold_90-1510915933:95494..95568TCONS_00073355-exon-scaffold_90-1510915933:95494..95568Clytia hemisphaericaexon
TCONS_00073355-exon-scaffold_90-1510915933:94265..94303TCONS_00073355-exon-scaffold_90-1510915933:94265..94303Clytia hemisphaericaexon
TCONS_00073355-exon-scaffold_90-1510915933:93960..94097TCONS_00073355-exon-scaffold_90-1510915933:93960..94097Clytia hemisphaericaexon
TCONS_00073355-exon-scaffold_90-1510915933:92978..93046TCONS_00073355-exon-scaffold_90-1510915933:92978..93046Clytia hemisphaericaexon
TCONS_00073355-exon-scaffold_90-1510915933:92750..92797TCONS_00073355-exon-scaffold_90-1510915933:92750..92797Clytia hemisphaericaexon
TCONS_00073355-exon-scaffold_90-1510915933:92443..92487TCONS_00073355-exon-scaffold_90-1510915933:92443..92487Clytia hemisphaericaexon
TCONS_00073355-exon-scaffold_90-1510915933:92152..92220TCONS_00073355-exon-scaffold_90-1510915933:92152..92220Clytia hemisphaericaexon
TCONS_00073355-exon-scaffold_90-1510915933:91897..91998TCONS_00073355-exon-scaffold_90-1510915933:91897..91998Clytia hemisphaericaexon
TCONS_00073355-exon-scaffold_90-1510915933:90484..90567TCONS_00073355-exon-scaffold_90-1510915933:90484..90567Clytia hemisphaericaexon
TCONS_00073355-exon-scaffold_90-1510915933:89866..89928TCONS_00073355-exon-scaffold_90-1510915933:89866..89928Clytia hemisphaericaexon
TCONS_00073355-exon-scaffold_90-1510915933:89176..89214TCONS_00073355-exon-scaffold_90-1510915933:89176..89214Clytia hemisphaericaexon
TCONS_00073355-exon-scaffold_90-1510915933:88981..89064TCONS_00073355-exon-scaffold_90-1510915933:88981..89064Clytia hemisphaericaexon
TCONS_00073355-exon-scaffold_90-1510915933:88367..88689TCONS_00073355-exon-scaffold_90-1510915933:88367..88689Clytia hemisphaericaexon
TCONS_00073355-exon-scaffold_90-1510915933:88008..88069TCONS_00073355-exon-scaffold_90-1510915933:88008..88069Clytia hemisphaericaexon
TCONS_00073355-exon-scaffold_90-1510915933:87523..87594TCONS_00073355-exon-scaffold_90-1510915933:87523..87594Clytia hemisphaericaexon
TCONS_00073355-exon-scaffold_90-1510915933:86470..86735TCONS_00073355-exon-scaffold_90-1510915933:86470..86735Clytia hemisphaericaexon
TCONS_00073355-exon-scaffold_90-1510915933:86063..86223TCONS_00073355-exon-scaffold_90-1510915933:86063..86223Clytia hemisphaericaexon
TCONS_00073355-exon-scaffold_90-1510915933:84201..85541TCONS_00073355-exon-scaffold_90-1510915933:84201..85541Clytia hemisphaericaexon
TCONS_00073355-exon-scaffold_90-1491911889:96536..96659TCONS_00073355-exon-scaffold_90-1491911889:96536..96659Clytia hemisphaericaexon
TCONS_00073355-exon-scaffold_90-1491911889:96026..96291TCONS_00073355-exon-scaffold_90-1491911889:96026..96291Clytia hemisphaericaexon
TCONS_00073355-exon-scaffold_90-1491911889:95494..95568TCONS_00073355-exon-scaffold_90-1491911889:95494..95568Clytia hemisphaericaexon
TCONS_00073355-exon-scaffold_90-1491911889:94265..94303TCONS_00073355-exon-scaffold_90-1491911889:94265..94303Clytia hemisphaericaexon
TCONS_00073355-exon-scaffold_90-1491911889:93960..94097TCONS_00073355-exon-scaffold_90-1491911889:93960..94097Clytia hemisphaericaexon
TCONS_00073355-exon-scaffold_90-1491911889:92978..93046TCONS_00073355-exon-scaffold_90-1491911889:92978..93046Clytia hemisphaericaexon
TCONS_00073355-exon-scaffold_90-1491911889:92750..92797TCONS_00073355-exon-scaffold_90-1491911889:92750..92797Clytia hemisphaericaexon
TCONS_00073355-exon-scaffold_90-1491911889:92443..92487TCONS_00073355-exon-scaffold_90-1491911889:92443..92487Clytia hemisphaericaexon
TCONS_00073355-exon-scaffold_90-1491911889:92152..92220TCONS_00073355-exon-scaffold_90-1491911889:92152..92220Clytia hemisphaericaexon
TCONS_00073355-exon-scaffold_90-1491911889:91897..91998TCONS_00073355-exon-scaffold_90-1491911889:91897..91998Clytia hemisphaericaexon
TCONS_00073355-exon-scaffold_90-1491911889:90484..90567TCONS_00073355-exon-scaffold_90-1491911889:90484..90567Clytia hemisphaericaexon
TCONS_00073355-exon-scaffold_90-1491911889:89866..89928TCONS_00073355-exon-scaffold_90-1491911889:89866..89928Clytia hemisphaericaexon
TCONS_00073355-exon-scaffold_90-1491911889:89176..89214TCONS_00073355-exon-scaffold_90-1491911889:89176..89214Clytia hemisphaericaexon
TCONS_00073355-exon-scaffold_90-1491911889:88981..89064TCONS_00073355-exon-scaffold_90-1491911889:88981..89064Clytia hemisphaericaexon
TCONS_00073355-exon-scaffold_90-1491911889:88367..88689TCONS_00073355-exon-scaffold_90-1491911889:88367..88689Clytia hemisphaericaexon
TCONS_00073355-exon-scaffold_90-1491911889:88008..88069TCONS_00073355-exon-scaffold_90-1491911889:88008..88069Clytia hemisphaericaexon
TCONS_00073355-exon-scaffold_90-1491911889:87523..87594TCONS_00073355-exon-scaffold_90-1491911889:87523..87594Clytia hemisphaericaexon
TCONS_00073355-exon-scaffold_90-1491911889:86470..86735TCONS_00073355-exon-scaffold_90-1491911889:86470..86735Clytia hemisphaericaexon
TCONS_00073355-exon-scaffold_90-1491911889:86063..86223TCONS_00073355-exon-scaffold_90-1491911889:86063..86223Clytia hemisphaericaexon
TCONS_00073355-exon-scaffold_90-1491911889:84201..85541TCONS_00073355-exon-scaffold_90-1491911889:84201..85541Clytia hemisphaericaexon
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073355-proteinTCONS_00073355-proteinClytia hemisphaericapolypeptide
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_90supercontigscaffold_90:84201..96659 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
10.6292 9.8665 4.76715 3.37441 28.6241 21.3438 15.9454 18.3718 8.06772 16.0345 13.9652 7.34706 7.21384 8.50606 6.94372 9.93115 9.40853 8.62218 7.73702 8.72554 8.25728 8.29637 11.7506 12.2027 11.2369 12.124 13.1575 11.4947 21.8201 24.8394
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR000488Death_domain
IPR001309Pept_C14_p20
IPR011029DEATH-like_dom
IPR029030Caspase-like_dom
Vocabulary: Biological Process
TermDefinition
GO:0007165signal transduction
GO:0006508proteolysis
Vocabulary: Molecular Function
TermDefinition
GO:0005515protein binding
GO:0004197cysteine-type endopeptidase activity
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0006508 proteolysis
biological_process GO:0007165 signal transduction
molecular_function GO:0004197 cysteine-type endopeptidase activity
molecular_function GO:0005515 protein binding
Blast
BLAST of TCONS_00073355 vs. Swiss-Prot (Human)
Match: MALT1 (Mucosa-associated lymphoid tissue lymphoma translocation protein 1 OS=Homo sapiens GN=MALT1 PE=1 SV=1)

HSP 1 Score: 126.331 bits (316), Expect = 2.478e-29
Identity = 95/286 (33.22%), Postives = 151/286 (52.80%), Query Frame = 3
Query: 1242 VASDKIALLIGNTNYKH---LEEPLVFPHRDVYALGHALNELGFKVLTLVDLTLREMRTIMLAYCQLLGPGVFAVFYFAGHGFEENGKNYLMPIDATST-KGDEFIQAQEILTEMRLANTALNLFIIDACRVKGINVSSTRGTLQKTGF-GNTIMAYSCSSSMPAFEAH--DLSHGIYMTHLLPRIKEDKRIEHILMEVNEAVHGNPLVVQRPVFE-SDAIGDCR-LTCKIDAQANYEHWSQRFDKWFEATQPPEGQTISXXXXXXXXXXXYKSMFSNMLQINVSI 2072
            +A DK+ALLIGN NY+    L+ PLV    DVY L + L +L FKV++L+DLT  EMR  +  +  LL  GV+ + Y+AGHG+E  G ++++P+DA +  + +  +  Q IL  M+   T LN+F++D CR +  +   T   L       N +  Y+      AFE     L++GI+M  L  R+ EDK+I  +L EV E +    L   +   E   ++ + R LT  I           R  +W +A + PE   +   +  ++++L + + FSN++ I  SI
Sbjct:  339 LAKDKVALLIGNMNYREHPKLKAPLV----DVYELTNLLRQLDFKVVSLLDLTEYEMRNAVDEFLLLLDKGVYGLLYYAGHGYENFGNSFMVPVDAPNPYRSENCLCVQNILKLMQEKETGLNVFLLDMCRKRN-DYDDTIPILDALKVTANIVFGYATCQGAEAFEIQHSGLANGIFMKFLKDRLLEDKKITVLLDEVAEDMGKCHLTKGKQALEIRSSLSEKRALTDPIQGTEYSAESLVRNLQWAKAHELPESMCLK-FDCGVQIQLGFAAEFSNVMIIYTSI 618          
The following BLAST results are available for this feature:
BLAST of TCONS_00073355 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
MALT12.478e-2933.22Mucosa-associated lymphoid tissue lymphoma translo... [more]
back to top