Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00073353 (transcript) - C. hemisphaerica

Overview
NameTCONS_00073353
Unique NameTCONS_00073353
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length5503

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00073353 ID=TCONS_00073353|Name=TCONS_00073353|organism=Clytia hemisphaerica|type=transcript|length=5503bp
CATGGTGCATGGAGTTATTTTTATAATCGTGGAAAAAATGAATGCAGACA
AAATTTCAAACCAGGAAATAAAACCGGAAGGgacaaatcaaaatgataac
AGTGGTgatataaatcaaaatttcttgaaCGACGGATCTACAAGATTTTC
AGCTCAGTCTCAAACGCAAAAAGCTTATTCAAGAGGATTGAATAATTCAA
AGCCAAGCCCAGATTCAGGGTGGACATTTCCTAACTTGATGAACTCTCCT
ATGATTCCACAGGGATTAATTCCGCATTCGCAAGCAGACAGGAATTTATC
AAATCTTCACCTACCACTCAATAAACCTGCTGATAATTATAACCCTGCAA
TCTTCACAGATGCGTATCAGCCAAAAATGATCTCCCCACTTGTGGAAATG
AATCTACGAAAACAATTTTTCCTTCAGCAACAGCAACATTATCATCAAAT
GCAAAATGTTCATCATCAAAGCCAATTTTTTAATAACAGTGCCTACAATG
CTTCTCCTGTTACAAACATTGCTTTCAATGGtatttctaaggaaaatggT
TCTCACAATAGGAGTCATCCTGTAATCACTCctaatgttgaaaataagaa
tgGAAGCAGTTTACCATCATTTGCAACCTTGACTTCTGGAATACAGGTTG
CTGAAAGTCCCCAATATTATGCAGCTGTAACAGCACAACAGATGAATACT
TATTTATCCATGCTACAGAAAAGTCAGCCTAAAATACCTTCAAATAATGG
AATAACTTTACCATCGCCATCTAAAAATGCCAgcttagaaatttcaaaaa
cgCAGAGCTGTACTTCTGAAAACATAAccaatgaaacaataaaaagagat
aAAGTTAGTACTAGCAAGCCTGCCTCTTCACAAATTAGACCAAAAAGACC
AACATTGCTTGGCCATTTGAAGTCTATGGACCAAAATCGCAACAAGTCCA
ATGGTCCAACTTATGGAAACCCAAGTTATCGATCTGTATTACCTTCAATG
GAAAAACAAGAAGATAAATTTAATCCTCAAAGACCTAGCCATCTAGgGTC
AACTTTCGTCCCACAAACACAATTCTTGTCCGTCAATGTTTCACATGCCA
ATGACAGACCATCAAGTCCTGGACACCAAAGTCCCTACTCTCTATCTTCA
ACAAGCAGCCCAGCTGGAAGTGATAAAGGGAAAAACCCAAATAATGTCTG
TAATCAGTGTGGCAAAATGTTCAGCAGTTCAAGTGCTTTGGTTAAGCACA
AGTTGACACACagtgaagaaagaaaatttgtatGTCCTATTTGTTCAAGA
GGCTTCAAACGACAGGATCATTTAAATGGTCATATGATAACGCACAGAGA
GAAAAAACCTCACGAATGTCATTTTGCAGATTGTGGtaaaagttattgtg
acatgagATCACTTCGTCGTCACTTGGAAAGTCATCACAGCAGCCCTCCT
GGTGGAACTACGCCTGGATATTTACCTAAACTTATGCTATATCCTGAACT
CAGTGCAGAAGAAAGGAAAGAACGAGAAACACAAATACAAGAGAATAGAC
TACATGTTCCAGAAGAGCCACCAAGACCTTCTAGTGCACCACTTGTTGTC
CCACCTGAACCAAAACGAATACAGAGAACAAGGCGGAGTAGTAGTGGTGA
AGAGACTCATATGCAACTTGACCCAGCTATGATTCGTGAGATTGAACAAC
GAAAACATGGAAATCCATTCCAAAGAAGAACGAGAGAGGAGTCAGACGAA
TATATTAAGCCAAGAGAAGAGACTCCTCCACTAGGTATCTCACCTCAATC
TTCAGGGATAGCATCTTTACCGAGTCATTTACTAAAAACTGTTGTATCCT
CTGCTGCTAATCATCGTTACAGTAATATAGAAAATCATAAACGAGAAATG
GAAGAGAGACGTGTAGAAtatgggaaacattttcaaagagATTTCAAACC
ACCGACGTCAACCAGTCAAACCGGTAAACACGAATCTCCTTATAATTATC
CACCGGGTTTAACTCCTCGCTCATCTCTTACACCTCAAGGACACCCTCCG
AGACCAACAAACGCTCAAGGAACAATGCCTTATTTATTGAACATTAGAAA
CCCATTCNTCGCTCATCTCTTACACCTCAAGGACACCCTCCGAGACCAAC
AAACGCTCAAGGAACAATGCCTTATTTATTGAACATTAGAAACCCATTCG
GTCTTTCACCTCATGGGGCTTACCCTTCTCAACAGAATgaagaattctca
aaaatatctaaaaGTGAGGCTGAAGCAAGGCATCAAGCTGTCAGCACTTA
TCTTCAAATGTGGGCAAGTGGGCAACATAATATGCCTCCTGAACAGATTT
TTAGTATGTTTCCTGGAGGTCGTGGAGGACCACCCAGGGGTAATCATCGT
ACAAACCACCCACAGACTCCTACTGATGCTATCGCGATTGCAGTAGCTGC
AGCCAAGGAACCGAATGACAGACATCCTTATGCAGGCAGAGATGGGATTT
ATGGGATTCATCCAGCGAATGCTAAATGGCAATCTGTTATGCAAGATGAC
TCGATTACAATGGAGAAAGATTCTAAAGTGAATAGCTACTACCATAACAC
ACAAGGCAATGTTCATGACAATTACGCGAAACGCCCCACACCAACCAAAG
AACGAAATATCATCGACGAACCGTTTAAACCCAGTGAAAGTAACCAcaaa
tatcaaaacaataataacaacaataacATTAATCGATTTTTCGATCGTCC
AGCTCCTCATCTGGACCCACTTAAAGGTCGTGAATATGCGCATCCCTCGC
ATGTCTACGAAAATAAACGTCGTGAATTAGACTCGAAAGTCTTCGATACT
TCAAGGCATCCTGCTTTATCGTCAACTAGAGATCATTCACCTCATCGCTA
CGATCCACGATACCCTACATCAAGAGACGAGCTTAATAATAGACTATCGG
AACCACCTCATTTAAGAGTTGAAACTGCGGAAGGATTAGCTAGCGGTTCA
GCTCTTTCTCCAAACAGAAAACGTCCACGACCTGGACCTATTATAATACC
TCCGGCTGTTAACAACCGGTCAATACCAACCACCATCTCTCCTTCTCGTC
ATTTCGCTGCGTTTCCGAAAGGAATTTACACTCCACCTGCCATGTTGAGT
CCGCGAAGTATTTTCTTTAATCCACCCTTCAATGCACCGAGACACCATCC
CAACGCCCCACATACGCCAGGGCGAATGCAGTTATCCAAAAGGCGTTCTT
CGAGTTTCAACGAACCACAACCTCTCAACACATCTCAACAACAACTCCAA
CTAAAACAACTCGAACAACAACAAATTCAACAACAGCAGCAATCTGTTGT
ACAGCAAACGCCGAAACAAACAACACCTGTCTCTGCTGAACCTTCTACTG
TGACACCCACAAACGAAGAGGAAATAAACGTTACAACTGTCGCTTCTGAC
CCAACTGAACCGAAAATCAATGTTGGGCCAGAGTTTCAAGCAGTTCTTCC
TCATGTTTTAAATCGAACGGAAGCACAGAAAGACAGTCACCGTGCATCTC
TGATGTGGTCACCTCTCAAAGAAGATGaacaaaagcaaaaagaagTTGAA
GCTTACTTAGACATGGCTTGTTCTCTCGTCTTATACGGTGGATCGAACAA
TAAAGAATATGCTTTACATATCTTACAAAGGACACGTGGTAATGTCAAGG
AAGCTGTAAGGCTGCTTCTTTCACGGAGACATATTCTACGAGCAGACGAT
CCCAATGCAGATTATCATTACTCCGGATCAGTACGCTGGACGGCCAAAGA
AAGGCTTGCATTCAGGCAAGCTTACAGATCGAAAGGCAAAATCTTCATGG
GTATTCAAAAAGAGGTTGAAACGAAGTCTGTACAACAATGCGTGGAGTTC
TATTACCTTTGGAAAGCAATGCATCCTGAGAGCTTTCGAGCTCGCACGCG
AATGGTTGAAGTGGAATCAGAGCAGGACGACGAAGAAGTTCCTCCAACTC
CAACAGCAGCTGTTGCACCGCTATCCACTCTTCGTGAACCTGTATTCGAA
TGTGATTATCCTGAATGTCGGGCACGCTTTGTTTCCAGACAAGCGCTCAA
TGGTCATATTCGAGTTCATGGTGGAAGTTTTACAAAACCATCGGATACGC
GACGAGCAAAAACGAAAGCAGCAGATGGCTCCTCACCTCGTCCTCCCGGT
GATGGCTTACCAAGTCCGCCCAAGAAAAAGAAAGTGGCGGCGCCCGACCC
CTCCATTATCATCACGAACACGAGTGAAGGCCCTCAACAGCAGTTCCAAT
GTAAAGTGTGTGGAAGGGTGTTCAGCAAAGTGAAAAGTCGATCAGCGCAC
ATGAAAACTCACGTTAAGAGGGACGAGAACAATAAACCTATCAAATCAGC
GAAAGCCACTGCAAAGCAAAAGCAAaaacaactacaacaacaacaacgac
agcagcagcagcagcagcagCAACTTCAACAACAATTTGGTGAACATTCA
ATGCCGCCCTACCCGCCGCAACCGACACACCCTGGTCCACCCCAACCACC
CTCAAATCTAAATCCAATGACTGTTTTTGCACATGCGTAAAGTTTATTTG
Ttatctttatttaattttcttttgttttttttaatatccatattaataat
ttttttattataaacatagaaaaaataatttaaattattatatcttatat
ctttataattttttacacCACTCTTTTCATGAAAAGATGCTTTTTATCCA
ACTTTAGTAGTCCCAAGATAAACCAAGCAAATAAATTAAAAcaatgctaa
aattttcaatgaaagaaaattttttaatagaCAATTATTTACAGTagcaa
ataattttaaattatttggaTTTTATTGATCacttttttggttgtttttg
tatattattttgaaatctatttgttttacttttttttggtttttctatcC
ACTTACGACAACtcgtttaatattttaataattattattttaaagggAAA
AAGCTACGTGATATTATATTGTTAATTTTTGTGCTGCGCTTTTATTATTG
TAAATTTTCGTAAATGAATCTATAGGAGTTTTTTTCTCTCAAGCAGCAGT
ATTTGTTTTAACAGTAGTTAGTTTGCAACATTCCTATAAGAGTGAAACCA
AGAAAGTCATTTTTCATACCTCACCAAAGTcactaaaattttcttttcag
tgTTTTACAAGCCGTTTTGTGATAAGTAATTGAGATGAGCAAATTTATTC
GTGACTAACGCTAAACAAACTAAATATTATGTTTTTGGTCTTTGTGAATG
AACCATTCGTCCGGCATCGCGCCTTTAAGGAAACATAAATGCTTAGTTTT
TTGTCAGTGAATGTtatggaaaaaagataatagatACATTTTTCGCGACA
CTTATTGTATTATATAcattattaaaaattattttacgaGTAAAAATATA
GTAATAATTATTAATTAATGACGATACTCTTAAACTGTCATCTTGGTTCA
TCT
Run BLAST on NCBI

transcript from alignment at scaffold_90:58286..81843+

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00073353 ID=TCONS_00073353|Name=TCONS_00073353|organism=Clytia hemisphaerica|type=transcript|length=23558bp|location=Sequence derived from alignment at scaffold_90:58286..81843+ (Clytia hemisphaerica)
CATGGTGCATGGAGTTATTTTTATAATCGTGGAAAAAATGAATGCAGACA AAATTTCAAACCAGGAAATAAAACCGGAAGGgacaaatcaaaatgataac AGTGGTgatataaatcaaaatttcttgaaCGACGGATCTACAAGATTTTC AGCTCAGTCTCAAACGCAAAAAGCTTATTCAAGAGGATTGAATAATTCAA AGCCAAGCCCAGATTCAGGGTGGACATTTCCTAACTTGATGAACTCTCCT ATGATTCCACAGGGATTAATTCCGCATTCGCAAGCAGACAGGAATTTATC AAATCTTCACCTACCACTCAATAAACCTGCTGATAATTATAACCCTGCAA TCTTCACAGATGCGTATCAGCCAAAAATGATCTCCCCACTTGTGGAAATG AATCTACGAAAACAATTTTTCCTTCAGCAACAGCAACATTATCATCAAAT GCAAAATGTTCATCATCAAAGCCAATTTTTTAATAACAGTGCCTACAATG CTTCTCCTGTTACAAACATTGCTTTCAATGGtatttctaaggaaaatggT TCTCACAATAGGAGTCATCCTGTAATCACTCctaatgttgaaaataagaa tgGAAGCAGTTTACCATCATTTGCAACCTTGACTTCTGGAATACAGGTTG CTGAAAGTCCCCAATATTATGCAGCTGTAACAGCACAACAGATGAATACT TATTTATCCATGCTACAGAAAAGTCAGCCTAAAATACCTTCAAATAATGG AATAACTTTACCATCGCCATCTAAAAATGCCAgcttagaaatttcaaaaa cgCAGAGCTGTACTTCTGAAAACATAAccaatgaaacaataaaaagagat aAAGTTAGTACTAGCAAGCCTGCCTCTTCACAAATTAGACCAAAAAGACC AACATTGCTTGGTAAGCTAAGAATCTTTTAATATTAAACTTCAGGCTTTT CAAATACTTATAAGGAGCCAGGATAGCCAGCTTATACATATTAGCCTTTT TTAAGCAATGTTGTTCATGTTACCAGGCCAGATCAGGCATATTAATTCTA GCTATAAGTCATGCATGTAAAGATGATTGGACAAAAACTCTGAGGGGCTA TCTTGCATGTTGCAGATAGGGGTATGACCACATAAAAATGCTTTAGATGA TGTACTTCCATGTTaaaggatttaatttttttctaggaAAGGATATTCTT GTATTTTTCTGTACTTTTGCACTTTCCTAGGGAGATTTTCCAGTTTTAAA ATGCAGTTAAGATATAGAGTGATATGCAATCAAAACATTAGTTATTTCCT AAAAGAATGATAGCCAGAGTGTCAGACGTGAAGTCTATATCCTCCGTTCA ACAAGtcgctaccttaattcaaaaggggcctaagtcctgtgagccttaat tcaaaaggggcctaagtccatttgggtcattttgagaaaattgcaattaa agTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNTTGCTTctgattattttgataaaatagc gcgttcaaaacaaagaaaaaatttgtcatttttattgCCTTGGAATACGA AAAGTCTTTAGCGAAGGCGATCATGTTTTTACCAAGTTTGTTTGCAACTA AGCTAATAGTATACACTTTTTAACATCAAAATTATATACTATTAGCTTAG AACTGTGGCTAAAAGAATGAAAGCCTATATGGATGTTCAGTAAATGTAAA CTGAGTATACTAAAAGTTACCATGTAGTTAGAAACAGTAGAATTTGACTG AAACACTGatcttttcaaacattttaattCAATGTAGACGAAagccaaaa attattttcaacataaaatttggacaaagttattattattataaggaTAA CAGGTTATGCATGGTTTTGTAAACTCTATTGATATAAtttctaactttta tatttATGATTCAGTAAAGTCTGAGAGGTCGCCTTTGATATTAGGCATTC GCTTGATTGGCTGTCTACGCCTTTTATCCTTTTGAAGGTATTCAtagttt tttatcatttttattaaTATAGAGAAGTACAGTTCAGGCACACGAGGGTC TCTAAACGGTTCTtgtacaaaaaactttttaaaatacaatttttcatGAG GGCTTCCTCGTACCCTCCATTTAAAATCGTCATTTCATTTGATCTGGCTT TTTTCATCTTGTCTGCTCTCTTTTTTCACTCTTGATTTGTTCTCTCTCCA TTTTTGTCAAGTCGTCAGTGATACTTAATTTCAAGTACTTCTCGTGTTGT TTCAATTCAGTCAACTTCTTCATGAATCTGTATTTGATATGACTGCCTTT GAATACAACTTTGATTGGGCACTTTAGATTCTTTTCCAACAGGAGAGACA TAGGTTGGTTGAGTTTTTAAATTAACGTCATTCAGAAGCTCGTTAACGAA ATTAATATATCttctttactttcattttcatttacccCATGCAATGGATA ATGATATTTGCGTCTATCAATAACTTTCTTTGCTCTTCAATTGGTTCATC AATTCTCTAACTTCAAAGTAGCTGTTTCATGCTATTTGCGCTTTAATTGA TCAATGTTTTTAGTCGTCtcagcaaaacttttctttcgTTCTGTTCTGTT GTGGTTTGAATTTTTGGAGTCTTGTTATTCATCTTCTCTTCCATCTTGGC TGTTAGTTTTGTTTCTAGCGTGGAAAATTGGCTCTGTATTAGATCAGTAA CTCAATTTTTATCGATGTTGTATTCCTGACATCTTGCCTGTAAATCTTTG ACTATTGTGTTTATTCTTTTTTCGCTCTCACTTTTGACTTTATGCTTTTG CACACTTTAATTTCTTTATAGCTGTGCGTGCAGCTTTTGACTATTGCTTG ATTATGGACTTTTCTACCAAGGTCTTTTGCCAGAGAGCAAAAATGTAGCA TTTGTTGGCATTTTTGACATTGAATTctcattttttcatcatttttatac AATTATGCTCAGTACATTGAGATTGTTGTCACTCCATCTTCATCATGGAT CAGGATCTTATCAGGTGATGTtgtttttggttgaaatttggctgtttttt ccatatttttgaaaagagcGCAACCTTTCTGCTTTACGGTTCCTTGCATT GTTCCTCAACATTCTAACTGTAGATGGATTTTTTAATGCTCAGATCAGGC CCTTGATGatcacacaaaattttgacacaAGTCATACATTTATCTGATTG ATATTTAGTTTTGCTCAAAGAATTAAGtacaataaaagaaatatggcATT GGTGTCAtaaatttttgaggaaaatagAGAGATGAGTTTTTATTTGTCTT GCCTACTGAACCCAGTAAAACTTTGCTTTTCTAAAATTGGGTAAAAATGT ATTGCAAAGAGAGGAATTTTCCATCACTGAAGGTGAAAACCTGTTTTCCC TGGTTTTCCAAATCGAATCTTTTTTTGTAATGATGGTGATGACTCCAACA ATGGGTTTTGTCAAGNTATGGCATTGGTGTCAtaaatttttgaggaaaat agAGAGATGAGTTTTTATTTGTCTTGCCTACTGAACCCAGTAAAACTTTG CTTTTCTAAAATTGGGTAAAAATGTATTGCAAAGAGAGGAATTTTCCATC ACTGAAGGTTGGCTACTTGCAGTGAAAACCTGTTTTCCCTGGTTTTCCAA ATCGAATCTTTTTTTGTAATGATGGTGATGACTCCAACAATGGGTTTTGT CAACATGGAGATCAGGAAgatatattttgattggtttaaaaatctcaaga agcaattttttttgcaatgacTTTTAGGAATTCTCTTTATCTCATTAAAA ACCAAAGGAAGTTTTCatgatgaaaagaaatattttttctacaaaaagtt taatATTGTGTCACATCATAACGTTTTGAGAAGGCAAGTGTAGTAGTATA ATCTAGCTCTCTTGCCAACAGTTTACAGAAAAGACTCAGAGACAGATATT TAGCTATAACTGAAGGTGCCATGATAAAGACTTTGACtaatagtcccgct gctgagatcgaaaaaagtggctagaaaacaacTTTCGTGccacacatctt agaactaactttttttggtagAAACNtttctacaaaaagtttaatATTGT GTCACATCATAACGTTTTGAGAAGGCAAGTGTAGTAGTATAATCTAGCTC TCTTGCCAACAGTTTACAGAAAAGACTCAGAGACAGATATTTAGCTATAA CTGAAGGTGCCATGATAAAGACTTGACtaatagtcccgctgctgagatcg aaaaaagtggctagaaaacaattttcgtgccacacatcttagaactaact ttttttggtagaaagtcacgaattagtatatgtacattccaaaatcaaaa agtttccacgatattatcgtgcaagtaacgagtaattggcaattttttgc gtttccaggcaaaattgcatgatttttggggggtcttcaaNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGT AATTGgcaattttttgcgtttccaggcaaaattgcatgatttttgggggg tcttcaaattaaaaaaatacctatatcacatgatagagctcttcaaacat agcaaaaaatgtattacaccaaagtcccaacttctctagatcaaaagtta tgggcctaatTGTGgccaaaaaggtgtttaattttgcataaattaataca gattgtggggaaattccctgttttccatccgtttttgaccacaaataggc ccataacttttgatctagagaagttgggactttggtgtaATACATTTTTT TGCTCAGTTTGAAGAGCTCTATCATGTGATATATgtctttttttaatttg aagaccccccaaaaagcatgaatttccaggccttgcaattttgcctggaa atgcaaaaaatccccaattactcgttacttgcacgataatatcgtggaaa cttttcgattttggaatctacatatactaattcgtgagtttctaccaaaa aaagttagttctaagatgcgTGTCACGAAATGAAATATTTATCGACCTCA GCAGCAGGACTATAATGTTTTGTAAATGCAGAGGTTTGGACTCAATAGTG CTCAATACAATAACAATTTGCTCTGATATTAACAGACTATGAAACTTGTT ATTGATTAATTGCTTTTTTAAATTGTTACTTTTATATTTTACTTCTAGGC CATTTGAAGTCTATGGACCAAAATCGCAACAAGTCCAATGGTCCAACTTA TGGAAACCCAAGTTATCGATCTGTATTACCTTCAATGGAAAAACAAGAAG ATAAATTTAATCCTCAAAGACCTAGCCATCTAGGTATGAATAAATTTTAT CTTTGGAAAAGAAATTAActcatttttaaaatgaagacCAATGAGCCATA TGTAAAAAATACCAATTTCAAAAGCACTTCTGCTGAAGTTGAGAAAATCC AGTTGTGTGGACAATCCTAGAACTGGGATTAAAGCATGTAAATTTTAGCA ATTGGCCTTATTTTAGATTCTAGGACCAAAAGCTTTGGGATTCTGTTTTC TTCATTATTGTCTATCAATACAAAAGTGaatgcaaaaaaatttcatacta ACAAATTATCTAAAACTCCTAGTTCGGACACCTCCCCCCTTTCTTAAGAC ACCTTATGACACCTtccgaaaaaatgaagaaggggtGAGGGTTAGAAATT TAAATGAAAGCAAAGAAGGGGTCTTACATATATATATTGTAGAatatttt caagcactgttatgaactttggtcttcatgaaaggaagttttctgttaga gaagtctgagtcaaaaagaagaaagaagtttattattttcctctctctct aaagatatttcacattATATTTGTTACCtattttgtccaaaatcctttgG AATAGGCATTTTTAACGtttgggggatgccaagaaagggggatcagaccc ctttccgcactatgaaaCTGTCTGGTTATTAGCCAAAGTGGGGGAAATTG TTTTGTTGCTATTTTTCACatttgtgactccccaagcgatttgaagtata TNTATGAAACTGTCTGGTTATTAGCCAAAGTGGGGGAAATTGTTTTGTTG CTATTTTTCACatttgtgactccccaagcgatttgaagtataTTAAAGTC CAATCGGTAAAAATACCATTCTTCTTTGGCCTCTACTCGCCCGGTCTTTT TACCGTTTGGGTCGCTCGGATATTGAAAAAGGCCGATGCGAGGCCGCTTA TTAAAAGCGGCCACAGTGAAGCGGCGACATAGTAAGTTTTAAGTCGCTAA CAGCGGCCATTAGCGGCTCttagttttgtttttcaatttccttacatttt caagtacatttggaacaaagaaagattttttcagccagggtACCAGGTAC AGACAGCAGGGACGTCTTCTTCCATTTCACAcatgtttgaaaaagaaact tcTTACTTCAAAACTTTCCTTCTAAGCTCGTGATATTTTCAGGAATAAGC CTTCTTTTCCATGGTTGAATTGAAAGATGGGTCTATCTGCAATATGTACT TAccgattttatttatgtttttttgcaaCAATCAGCAGAATTTTCCGGAT AAAGATAATTTTAGGAATGAGCCGAATTCTAGATTGCTTCCTTCATTCTT GTGGTTAAATCGTTTTGCAAAATATACTTTTCTGCTTATATTTGTTTTCG TTGGTCACCGGCAAACATTTAAAGCGGCCTTTTAACCACTCAAAGAGAGG CCGCTAATAAGCTGCTGGCCGCTAAATAGGCCACTGGCTGCTTGGCCGGT CTCTCGATCAAGAAAAAGCCTCTAATAGAGGCCTTGAGGCCGTTCTTGGA AAAATTCCATTGGCCGCTTCATGGCCGATCTTCTAAAATGNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNagacccattgaagtcca gcggagggggcagaaccgacaaattttcactaaaatagcttaaaaacgct taaaaagctctatttaagcgtttttaaggcttttttgagcaaaaaacgta aaaacgcaaccttgcaagcaagtgagctacttccaaaggctctaattagc atatttccatggtgctgaagcgattttgagaatttagaacccgctgggaa cagtagttttgccagaaaaccggtttttaggcctccagagccgcctgggc ttacgctgtaagcttacagcgctgtactggagcctNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNTGTGTTTCGATATAATCACCTGATTACAGAG ACTAAAAGTGCGACTCAGttgatttaaaagttgaaattggaaaatttaag ggttatttaaaaaaaaaatcacagctacttattttgtttgtaagattttt gattttgtgttttggttgaccacttttcaatttggccctttagccgatcg gacttttgtgcttggggagtcacattaATTTGGGCCGCAAGTGCCATCAG ATTCcttattgttttttcaaaatgtgtcTAAAAGTGGCAAAAGTGCTTGT TGGCACTTAAATTTTCACTGATCGTTTGTTCCATTCGTGTTCAAAGTGGC AAATTCTCAACCTCCACCaagcaaaaaacaaatttgatttgTTTCGTGTA GTTTGTGTGAAAAGTAGGAAACAAAATGGCAGCTTTCGAATGCATAAATT TGAGCATTTCGCCTGTCTATCAAAGCAACCACTTTTagggtttttttcat ttctaggGCACTAGTTTTAACTAAAATATGACTCCCCAAGGGATTTTAAA TACCCAGTCTAAACCGATTGACCATAAAACTGTAAaataccagcttttta gcagcCAAGATTTCACTTTTACTGGTCCCCTTCTTTCTTTATCGGCTAAG GATCGGCCACTCTCGTTTCACTTTAAAGCAGCTTCTGTCTTTTACGCCCG CAAAAGTTATTAACAACTGTAATAAAAGGACTGACAAAAGAGCCTCTTTA TAAACCATTTATATTTCTGAAGCAAGACTGATCCTTTGCTTCGTGGTCTt catttgggcaaatttgggccaaaaactaccttaaaaagggttttttggac tttgtatgaaattttctcattagttttttctgattttatgcaTAAACGTA AAGGGCAAGGTTTCTATAAACTGACTGGAGGCATTTTTTCTGCAGAAAAT TGTTTTGGCCGGGAAATAatagattttcttatttggggaaattccctttt gtcatttttaggaaAAATGACCATTTCTCTTGATTGCCTtggtaaatttt tctgattttttgacaatgacaaaaaatgctaaaatgtTTGAAATCTGGGG GAACGAGATagtcaaaaaataatattttagccaatttggggccaaaaagt gcctgaaaatttttttttttttgacttatgaattgcttcatttgtttttt tctgatcttttgcaTAAAGGGCAAGTGTCTCTTAAAAGTGGCTGAAGCTG TTTTTTTGGGGGATTTTGATGTAAAATGTTATTGTTTAACATCTGATAGA TCTGGAtagattccagaaaaaaatttggctaatttgggccaaaaactaaa agtgcctaaaaatggggttttttcGACTGTGTGAAATTCCTtctttagtt tttcctgattgaCGGTGATGCAAAATTGTAATCCTTAAAATGTAAGactt gaagatttttaaaaagaaaaggttttagctaaatttgggtcaaattattt tctcaaaaatgtttagttttattatcaggtaggtccataaaagtatagCT TGTTTACATTCaaagtccctctaagggtcaTAGAAATCATAATtccaaat taaataaataaaaccaAAAACTCAACAATATTAATCACTAAAAAGGCTAA GTTTTAGGAAAAAAGTCCTGGTAAGGGTTTCAAAATCcacaaaatttcag ttttttccTTAATTTCAGACCCTAAAAtttcctattttcaaaaatcgggc agCACTCCGTCCCAGACATATCGTAAACATAGTACCTCCTGGGTTTCTGA GTTAAAAACTACTTGAATTAGGACCTCACGCTTTAAAAAACTTGGAAATT CCAGGCCCATTATTCTCAATAGCTCTATGAATGTGGTGTTTCTCAGCATT AATGATTAAAATTTTAGGTGACCCCTTCAACTTGAGACATTAGGGGCTTA GGCAAAGGCGAGTGGTGTTTGTGTGCCAGGTTTTCACATAAGCAAGTCAA AGAAATGTATTATAAAAAAGTACGGAATTTTTCGTCGTCCGgagaatttt cttttcttctaaaggaagaaatttttccaaaaataaagaaagccTCCCTG GGGGTCACCTTCTCAGCAAAATTCAATCAATtgtgttgaattttttttca atcttgaTATAAGTTGCACATTAACTCAAagggaaaaacaaaatttcagt aATATTCAGGGAGAATAAGCATTATTTTGTGCAAAATCTCAGGGAAACCA CTTTTTTTATTCATGTCTGAACCCCGATTGTTGAAATATTGCTACAAATT GTATGATTTTGagtttattcttttctttttaatccTTCAAGATTGTTGTT ACAAATATATTTCTTCTATCCTCTTACATATTTAAAAACTTACAatatat tttctgaataatGAATGCAGGCCTTTTTAATTGGTGTTAATTAGACCTCA AATTCTCCCTCAGAGTTTTAAAGGTTGCTTGCTGCAAGTTTTAAATGCTG ACTAAGAGCAACCCCTGTTTTACAATTTCATTATCTCTACTGTACTTTCG GCTGCACGGATCACTGCATACTCTCTTTGCAAATTTCTTCATACCCTTTA CTTAGCAAGTGTGTTTGTAGAATTTACAACAGTGTTAAACTgtaaacaaa gcaaaaaattcACCTAAGTTGATTAACATTGTTTTATAAAATAACGATTT GAGCTAAGAACTTGTTTAGTACCACCCTAATCAAACTATTCAAAAGTGTC ACTTTCCTActgtgagaaaattaaaaagcaGATGAAAAAATGGTTTTATG TTCATACTGTATCCATACCTTCCAAAAAACTCAATTCAAAAACTAACTTT TCGAAACCCAATCCAGATATATATGAAATTTCATGAGCTCCAGATTTTAA AAACTATGATTCTAACTTTCGTTTATcgttatattatttattttttctct ttttcaggGTCAACTTTCGTCCCACAAACACAATTCTTGTCCGTCAATGT TTCACATGCCAATGACAGACCATCAAGTCCTGGACACCAAAGTCCCTACT CTCTATCTTCAACAAGCAGCCCAGCTGGAAGTGATAAAGGGAAAAACCCA AATAATGTCTGTAATCAGTGTGGCAAAATGTTCAGCAGTTCAAGTGCTTT GGTTAAGCACAAGTTGACACACagtgaagaaagaaaatttgtatGTCCTA TTTGTTCAAGAGGCTTCAAACGACAGGATCATTTGTAAGTCCCCCAATTT TCTACTAAGTGTCTGTAAATGTTTTGGTTAAGATTATAGTTGACGTTCAA AAGGAAATGATAGATATTCACCACTTCTAAGTATATTCAGTTGAAGTCTG CAATGCAAACTTTGGTGGCTAAATAGAGGAGTTGTAATATTTGTAATTTC CTTTGTGGGTCATAACTCAATGAAAGCGGCGTTTCTCGAAGCAATTAAAA AGGATTAATAGCTTCTAACTTCCATACAAATTATATGATGTGCTGTGACG TTTAGATAAGCTTGTCTTTAAACTTGTATTGTTTGCTTTTATATATAGAA GGTATCACACAAAGCTCAAACAAAATTTTACATAACTCGTTGCGAGGACG GTTTTTTATTCTAAGTTGGAAGTAAAGTCCTAAATCAatgtttagttttt tctaaaatgaaacATGTTTGTTTGGTTTTCAATTGATAGTCGTAACCACA CCATAAGTCTTGTTCACTCTTTCTATGNCAATTTTACATAACTCATTGCG AGGACGGTTTTTTATTCTAAGTTGGAAGTAAAGTCCTAAACCAatgttta gttttttctaaaatgaaacATGTTTGTTTGGTTTTCAATTGATAGTCGTA ACCACACCATAAGTCTTGTTCACTCTTTCTATGACTCAAACTTTGTGTGT GTTGTGTACTTTTCCAGATATTAACAAATTATATACTACACTTCAATCGT AATGTATATTACGTTGAAAAATTGATTTGTGAAGGTGTCATCGTTTTTAA GTGTTTATTAATCAGATTATATGAAATTTGTCGAGAGTTATGGTGTTCGA AGAgtgatgttttatgattttttctTGTTGTCGTAATACTTTTGTATTAC GATGTCTGATATAAACGTAAAAGAttccaatcaatttttttgacattACA CTTATGATGGGCTGTCCAAAATGtcgtttctttttttattgtcttGAAAT GACAAACAGAATTATAGTTTGATACACAGAACGCATTAAATATAAAGATA GTGTGCTGTGTGTccgtttaaaaatttttgttctgagtgatttgttttta tttttcatgttcTCAGAAATGGTCATATGATAACGCACAGAGAGAAAAAA CCTCACGAATGTCATTTTGCAGATTGTGGtaaaagttattgtgacatgag ATCACTTCGTCGTCACTTGGAAAGTCATCACAGCAGCCCTCCTGGTGGAA CTACGCCTGGATATTTACCTAAACTTATGCTATATCCTGAACTCAGTGCA GAAGAAAGGAAAGAACGAGAAACACAAATACAAGAGAATAGACTACATGT TCCAGAAGAGCCACCAAGACCTTCTAGTGCACCACTTGTTGTCCCACCTG AACCAAAACGAATACAGAGAACAAGGCGGAGTAGTAGTGGTGAAGAGACT CATATGCAACTTGACCCAGCTATGATTCGTGAGATTGAACAACGAAAACA TGGAAATCCATTCCAAAGAAGAACGAGAGAGGAGTCAGACGAATATATTA AGCCAAGAGAAGAGACTCCTCCACTAGGTATCTCACCTCAATCTTCAGGG ATAGCATCTTTACCGAGTCATTTACTAAAAACTGTTGTATCCTCTGCTGC TAATCATCGTTACAGTAATATAGAAAATCATAAACGAGAAATGGAAGAGA GACGTGTAGAAtatgggaaacattttcaaagagATTTCAAACCACCGACG TCAACCAGTCAAACCGGTAAACACGAATCTCCTTATAATTATCCACCGGG TTTAACTCCTCGCTCATCTCTTACACCTCAAGGACACCCTCCGAGACCAA CAAACGCTCAAGGAACAATGCCTTATTTATTGAACATTAGAAACCCATTC NTCGCTCATCTCTTACACCTCAAGGACACCCTCCGAGACCAACAAACGCT CAAGGAACAATGCCTTATTTATTGAACATTAGAAACCCATTCGGTCTTTC ACCTCATGGGGCTTACCCTTCTCAACAGAATgaagaattctcaaaaatat ctaaaaGTGAGGCTGAAGCAAGGCATCAAGCTGTCAGCACTTATCTTCAA ATGTGGGCAAGTGGGCAACATAATATGCCTCCTGAACAGATTTTTAGTAT GTTTCCTGGAGGTCGTGGAGGACCACCCAGGGGTAATCATCGTACAAACC ACCCACAGACTCCTACTGATGCTATCGCGATTGCAGTAGCTGCAGCCAAG GAACCGAATGACAGACATCCTTATGCAGGCAGAGATGGGATTTATGGGAT TCATCCAGCGAATGCTAAATGGCAATCTGTAAGTATCTCTCTCTATTTGT TTCTTGTCTGTTTAATAATAAAGAGTCCTACATGTCTTTTGGTAAAACGT GCACCCAGATAGTTTTCGATAATTTCTTGGTCCTAAGAAAAACTCCctta gtttttttgaaaaagtgtttTACAAATCTTATAAATatacttattttttg aaatttcgaaatcAAGTTAAATCAAGTATCGCTGCTGGgttaaaaaattt gtttttattcttaGGTTCTTTTCCCCTATTTACAGGAAAAAGCATGTTTG TCTTTTGTTTTGGAAAGGCTGCAGGCTTAAGTTTCGTTGTAGTTGTTATG ATATTTACTTTCTCGTTACTAATTTTATTGACGAAACATTACGTAATTTT TTCGCTTTATTGTTTGCTGCTTAGTTCGGGAATTTCCATGTCATTAAAAA AAGTGCTAGAATTTGGATTCGTGTTGAGACTGGATGTAAAAATAATtgga tacactttttttataagaacaaactataagaacatcaggcttcggtggcc gaaatgttaagaacaagttacgaacattttaaggctttgccgacTCTAAA ACAGCCGATTTCTTTGTAGGTGCTCAAAAGGCTTaacaaaaatggtgaaa acaaTAACACGCTactatgttaagaacattcttaggcttaaaactcaaaa agttaagagcatccgacggcttcaaaaattttggatgctcctataaaaaa cgtgtagtaggCGTATTACTAGTTCGTTCTTTCTTTAGCTTTCCCTATTT GATGGTTTCATTAAAACTTCCTGTTTAGTTAGTATGTAATGAACTTTCGT TGCAGTCAGCAGTTTTTACGGAATCTTAAGCCTTTAGTTATGTGAGCAGC TCCAAAGTCGATTTTTCTAAGAATTCGTGATCACGAGATGAATCGTTTCT CTTTTGCGAAGAGTTGCGAAATCCCATTTGATCTTTCTTGATTTTCTGCA GGTAGCAGTATCGGTCTAAATGCTATTGCAGCTACCTCCTTTGAATCTGC ACAGGGGAATTTTGTCAGACTTAATTGCTTATAAGTGCTTTGGATTTGTT AgtaatttgtcaaaatattgctTTTTTGAGTAATAGCTTTTTAGttgaac aaaagaaattattttggtttcttTGATGTCAATCAAAAAGAGCTATTAAT TAAAAAGCTCTTCCTTGGTCACTGATGGTGACGGTGATGAAGTTATTGAT GAGGGGAGCTTCTtagtaatgtttttgttttgtttttttgatatTGTAAA TAAGAGAGAATAATGTAACAACGTAACGAGTAGGATTTCTTCATAAACAA GAAATGTCTGGAAGCTTATCGAATAAAAACTTTATACTATTCCAAGCTTT GCATAAGGTACTGTAACTTTCAGTTGCGTGTCAATTCTTGCATTTTCAAT GAATTGAGATCTTTGGCAATTTaatacttcatactgtttttaaaatactt tcattAACTTTCTCTCTGTCAGATACTTCTAGTCTTTGTTTAGAATTCCA CTGAAGCTTTTTAACAGTTGAAATTGTCATAGTGTGATGATGAAAACATT TAAGAAGCTTTGCTCCTGGTCGATTTCTTTGGAACTTCCTTAATGTGTTT ATACAGTTCTTGGTTTCTCTTTCTGGAAGCAAAACATGGTTGGAAGTCGT CAGTCAAAACGTTTAAATTTTCTGTACGTTTTAGGTTATGCAAGATGACT CGATTACAATGGAGAAAGATTCTAAAGTGAATAGCTACTACCATAACACA CAAGGCAATGTTCATGACAATTACGCGAAACGCCCCACACCAACCAAAGA ACGAAATATCATCGACGAACCGTTTAAACCCAGTGAAAGTAACCAcaaat atcaaaacaataataacaacaataacATTAATCGATTTTTCGATCGTCCA GCTCCTCATCTGGACCCACTTAAAGGTCGTGAATATGCGCATCCCTCGCA TGTCTACGAAAATAAACGTCGTGAATTAGACTCGAAAGTCTTCGATACTT CAAGGCATCCTGCTTTATCGTCAACTAGAGATCATTCACCTCATCGCTAC GATCCACGATACCCTACATCAAGAGACGAGCTTAATAATAGACTATCGGA ACCACCTCATTTAAGAGTTGAAACTGCGGAAGGATTAGCTAGCGGTTCAG CTCTTTCTCCAAACAGAAAACGTCCACGACCTGGACCTATTATAATACCT CCGGCTGTTAACAACCGGTCAATACCAACCACCATCTCTCCTTCTCGTCA TTTCGCTGCGTTTCCGAAAGGAATTTACACTCCACCTGCCATGTTGAGTC CGCGAAGTATTTTCTTTAATCCACCCTTCAATGCACCGAGACACCATCCC AACGCCCCACATACGCCAGGGCGAATGCAGTTATCCAAAAGGCGTTCTTG TAAGTGTCTGATTACATATTTTTAGTTCCCctttttttcttgcttggaAA CGAAGCTTTTTTCCTTCCCTGGTTGATTGTCGCGTTGCAAAAATTACTCA AACATACGTGCAGGAAATGGACGATTTATACTATGATTATTTAGTCATTT GAGGTCGCCGCTtggattttaaaatctttaaaaggaaCCTCAACTTCCGc ttttgcattttctttttctggcttttctagcatttttttcTTGCATGATC AGCTTACGGATAGAAAATGTTTtgacgaaagtgaaagtgcacGAGTTCCG AGCTCATTAGGATGTAAAAAAGCGTAGAAATATCCTTGCAAACACGGGCC ATTTATTCAAGGCACTCACTTTATTCGGGATTGAATATAGGTGATACATA TTACAACGAGCAATGATTTACTTCATTTTCAGCGAGTTTCAACGAACCAC AACCTCTCAACACATCTCAACAACAACTCCAACTAAAACAACTCGAACAA CAACAAATTCAACAACAGCAGCAATCTGTTGTACAGCAAACGCCGAAACA AACAACACCTGTCTCTGCTGAACCTTCTACTGTGACACCCACAAACGAAG AGGAAATAAACGTTACAACTGTCGCTTCTGACCCAACTGAACCGTAAGTA TCTTACTTTTGTTGGTATCCATGGTATTTGTTGGTATTAatgttttccct tttttccctCTCTGAATAATATGAAAATGATCTCAGGGCTTTATCAAAGT AAATGgtgttaaaacattttttttcgatcgAGAGGTCacgtagactagag tctacttctggctgaactttgctttttgataattttttcatgacgctgag tccagtcaagtagactaggagcatttggcgaggtcgccattttgaaaaaa aaaattaaaaatccaaataacaataaaactacttggagttgaaggatata atcaaaaataagaaacaaacacgattaacagatttgtaatcccttattct caaataaaaatattgcttcatactgtttttaccttccaaaaacaactaaa atctggcggactgttttacagtccgcctaggcaaaagcatattaccatat actaccgggccacttatcagcaccaaaaagtccataaaaaagctctaagt ggaccccgggctagagGTCACGGTGATAAATTCAAATTGGACTTTCGTCT TCTAGTTTAGCCTGTACCACTCCGCCCACGGGCgttatttatattttgaa aaaacttgccgTTATCTTTTCGgtcagcgaagaagagtttggtacaggct actTCTAGTTGTGCCAAGCTAGCTTCATGTAATTTAACACTGTGGAATTT AATATACTATAAGGAGAATTCAATTATATGTATCCTGTGTCAACATGACC TGGATACAAGAATTTCAATAATGTTGTTATTTTGTATGGGGATGGAATTC GTGTATAATATCTTTCACACAGGCCAATAGTCAGGTTAAGTTATTTGTCT CACTTTTCATGATTGGTCTTAATTACTGAACAGTTATGTTATCAAACTAG CTTATGTCGCTTTCTACAGGAAAATCAATGTTGGGCCAGAGTTTCAAGCA GTTCTTCCTCATGTTTGTAAGTATATTGCTAGTTTGCCTGAAATTTCAGT ATTTGATCAAATGATACAACTCCCTCTTTAACTTAAAAGCTCATATATAC TCACATTGGGTAACTAACTTTGATTTAACCTCGCATATCGCAGGCTCCAA AGAAAATAGCTTTTAACTGTCTAAGTGTTGAATGCCCCTTGACTCATAAA AGTCACCATTGGCAATATAGATGACGAGGATGTGATTTTTTGATAGCTAA GAATGACATTATCGTATACCTTTAATCGATTTTCTTGTGTCCTATGTTTA GTAAATCGAACGGAAGCACAGAAAGACAGTCACCGTGCATCTCTGATGTG GTCACCTCTCAAAGAAGATGaacaaaagcaaaaagaagGTAAGATTTCTT TTGGTCAACTTGATGCAGGCTGTTGAACCGATTTATTTcgaccaacgatg taaaaataatagataaccaacttgcttgtggtacctttatcttttgaaaa aaaatccaaaatttgcagtaaataacaattcaaatattctatcaattcag tggatgtcaaaaagtgtgtcaaaatctagctaaaagcattacacgcactg cacacagagctttttaatagagtgctcatttcaataggaaaacaatggtt gttctcttgggagaagtgccttctagaggtagttggttatctattatttt tacatcgttgttTCGACTAAATCTCACTTTGGTTTCGCATAATAATTAGT CAATTTTTCTCCACAAAATACCTGATTTGAAACAAATCTGAAGAAGACCA ATAGACCAAAAATTTGATGGCTGTTAACTTAAAAATGTTTGACCCAAAAT ATCATGCTTGTTTCTTTTCGTTTCAGTTGAAGCTTACTTAGACATGGCTT GTTCTCTCGTCTTATACGGTGGATCGAACAATAAAGAATATGCTTTACAT ATCTTACAAAGGACACGTGGTAATGTCAAGGTAATAATGACATTTTCCAA ACCCCTGAAGGAAGAATGAAACGTATTCCATGAGCTTCTTAGTGTCAGAC TTTTTACTTTctattgaaaaagaagaatggggaaaagcatttttttaata CTTCGGGGTTGTATAATAGTTATAGAAGAATGCGTTaaagtttgagattt ttttcaattttcaaagaaatcttttttgttacACTTGGAAATTcatgtat tttttttattattttaaccCTTAGGAAGCTGTAAGGCTGCTTCTTTCACG GAGACATATTCTACGAGCAGACGATCCCAATGCAGATTATCATTACTCCG GATCAGTACGCTGGACGGCCAAAGAAAGGCTTGCATTCAGGCAAGCTTAC AGATCGAAAGGCAAAATCTTCATGGGTATTCAAAAAGAGGTATGGATGAA CGGCTTTATATCCAGAATATTTACTACTAAATCACGACAGGGTTTTGGTT TTTGAAATTATGACAGTGTTTTCAAGACGAAATATCTAGACACGTGAGCG TTCACTTACcctttctctgattttttattCAGGTTGAAACGAAGTCTGTA CAACAATGCGTGGAGTTCTATTACCTTTGGAAAGCAATGCATCCTGAGAG CTTTCGAGCTCGCACGCGAATGGTTGAAGTGGAATCAGAGCAGGTATTAT TTCCTTTGTAAATTCAAATCGTTTTTTGAAAGCTGTTGTACACAAGACTT GCAAGGGAAGAGTTCTTATTGTTTGGTCtaatttgctttttatatgCAAA TACTTTCAAGAGGTATTTAGGTTTgtctttatctttttctttctcgactg attttatttttttgaggcATCCTAAATGTTTTACCTTTGTATGTTTTGTT GTCTAGGACGACGAAGAAGTTCCTCCAACTCCAACAGCAGCTGTTGCACC GCTATCCACTCTTCGTGAACCTGTATTCGAATGTGATTATCCTGAATGTC GGGCACGCTTTGTTTCCAGACAAGCGCTCAATGGTCATATTCGAGTTCAT GGTGGAAGGTAAGACATAAAATTGACGACagtattataaaaagaaagccA GCTTTATTTCATTGGCATTTTTGCTTGAATTTGAACCATTAGGAGAAATA TGAGTAATTCGCTTAAATCAGAAATTAGACTTGCTTACCTATTTCCCCTT GTACCTTGCGgatttcttttaatttattctTTACTTTTACAGTTTTACAA AACCATCGGATACGCGACGAGCAAAAACGAAAGCAGCAGATGGCTCCTCA CCTCGTCCTCCCGGTGATGGCTTACCAAGTCCGCCCAAGAAAAAGAAAGT GGCGGCGCCCGACCCCTCCATTATCATCACGAACACGAGTGAAGGCCCTC AACAGCAGTTCCAATGTAAAGTGTGTGGAAGGTAAGAATATACTCGAGGA GTATCAAGATTCTCCATGGAGATGATTAATGTTTGTCCTACTTCTTTGAC CAATAAGAAAGCGATTTTTCCTCATCTTAAAAATTAACTTGAATGGGGGA GGTcattttcccgaaaatttttttttgatactcTCAACTACAGTTGAACT AGAATCTGAGattgtctgtctgtctgtccgtCTGTCCGCCAAAAACTTTA AGGTGACAGCCTGGAGTCTTctaaaatggtcggatttggctgaaatttgg cacacttaagtgaatatctgggggtattattttttatttttcaaaatttt ggctgGGCACTAatcttttggtttgttttgctaCACTTGGgtctatgaat aatttgaagctactgaagttgagccgTTTGACTATGTGATATTTAaccaa tttctttcttttctttatcaGGGTGTTCAGCAAAGTGAAAAGTCGATCAG CGCACATGAAAACTCACGTTAAGAGGGACGAGAACAATAAACCTATCAAA TCAGCGAAAGCCACTGCAAAGCAAAAGCAAaaacaactacaacaacaaca acgacagcagcagcagcagcagcagCAACTTCAACAACAATTTGGTGAAC ATTCAATGCCGCCCTACCCGCCGCAACCGACACACCCTGGTCCACCCCAA CCACCCTCAAATCTAAATCCAATGACTGTTTTTGCACATGCGTAAAGTTT ATTTGTtatctttatttaattttcttttgttttttttaatatccatatta ataatttttttattataaacatagaaaaaataatttaaattattatatct tatatctttataattttttacacCACTCTTTTCATGAAAAGATGCTTTTT ATCCAACTTTAGTAGTCCCAAGATAAACCAAGCAAATAAATTAAAAcaat gctaaaattttcaatgaaagaaaattttttaatagaCAATTATTTACAGT agcaaataattttaaattatttggaTTTTATTGATCacttttttggttgt ttttgtatattattttgaaatctatttgttttacttttttttggtttttc tatcCACTTACGACAACtcgtttaatattttaataattattattttaaag ggAAAAAGCTACGTGATATTATATTGTTAATTTTTGTGCTGCGCTTTTAT TATTGTAAATTTTCGTAAATGAATCTATAGGAGTTTTTTTCTCTCAAGCA GCAGTATTTGTTTTAACAGTAGTTAGTTTGCAACATTCCTATAAGAGTGA AACCAAGAAAGTCATTTTTCATACCTCACCAAAGTcactaaaattttctt ttcagtgTTTTACAAGCCGTTTTGTGATAAGTAATTGAGATGAGCAAATT TATTCGTGACTAACGCTAAACAAACTAAATATTATGTTTTTGGTCTTTGT GAATGAACCATTCGTCCGGCATCGCGCCTTTAAGGAAACATAAATGCTTA GTTTTTTGTCAGTGAATGTtatggaaaaaagataatagatACATTTTTCG CGACACTTATTGTATTATATAcattattaaaaattattttacgaGTAAAA ATATAGTAATAATTATTAATTAATGACGATACTCTTAAACTGTCATCTTG GTTCATCT
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_045513XLOC_045513Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073353-exon-scaffold_90-1491911889:58286..59196TCONS_00073353-exon-scaffold_90-1491911889:58286..59196Clytia hemisphaericaexon
TCONS_00073353-exon-scaffold_90-1510915933:58286..59196TCONS_00073353-exon-scaffold_90-1510915933:58286..59196Clytia hemisphaericaexon
TCONS_00073353-exon-scaffold_90-1575043694:58286..59196TCONS_00073353-exon-scaffold_90-1575043694:58286..59196Clytia hemisphaericaexon
TCONS_00073353-exon-scaffold_90-1491911889:64784..64918TCONS_00073353-exon-scaffold_90-1491911889:64784..64918Clytia hemisphaericaexon
TCONS_00073353-exon-scaffold_90-1510915933:64784..64918TCONS_00073353-exon-scaffold_90-1510915933:64784..64918Clytia hemisphaericaexon
TCONS_00073353-exon-scaffold_90-1575043694:64784..64918TCONS_00073353-exon-scaffold_90-1575043694:64784..64918Clytia hemisphaericaexon
TCONS_00073353-exon-scaffold_90-1491911889:71243..71519TCONS_00073353-exon-scaffold_90-1491911889:71243..71519Clytia hemisphaericaexon
TCONS_00073353-exon-scaffold_90-1510915933:71243..71519TCONS_00073353-exon-scaffold_90-1510915933:71243..71519Clytia hemisphaericaexon
TCONS_00073353-exon-scaffold_90-1575043694:71243..71519TCONS_00073353-exon-scaffold_90-1575043694:71243..71519Clytia hemisphaericaexon
TCONS_00073353-exon-scaffold_90-1491911889:72602..73813TCONS_00073353-exon-scaffold_90-1491911889:72602..73813Clytia hemisphaericaexon
TCONS_00073353-exon-scaffold_90-1510915933:72602..73813TCONS_00073353-exon-scaffold_90-1510915933:72602..73813Clytia hemisphaericaexon
TCONS_00073353-exon-scaffold_90-1575043694:72602..73813TCONS_00073353-exon-scaffold_90-1575043694:72602..73813Clytia hemisphaericaexon
TCONS_00073353-exon-scaffold_90-1491911889:75520..76234TCONS_00073353-exon-scaffold_90-1491911889:75520..76234Clytia hemisphaericaexon
TCONS_00073353-exon-scaffold_90-1510915933:75520..76234TCONS_00073353-exon-scaffold_90-1510915933:75520..76234Clytia hemisphaericaexon
TCONS_00073353-exon-scaffold_90-1575043694:75520..76234TCONS_00073353-exon-scaffold_90-1575043694:75520..76234Clytia hemisphaericaexon
TCONS_00073353-exon-scaffold_90-1491911889:76668..76878TCONS_00073353-exon-scaffold_90-1491911889:76668..76878Clytia hemisphaericaexon
TCONS_00073353-exon-scaffold_90-1510915933:76668..76878TCONS_00073353-exon-scaffold_90-1510915933:76668..76878Clytia hemisphaericaexon
TCONS_00073353-exon-scaffold_90-1575043694:76668..76878TCONS_00073353-exon-scaffold_90-1575043694:76668..76878Clytia hemisphaericaexon
TCONS_00073353-exon-scaffold_90-1491911889:77805..77851TCONS_00073353-exon-scaffold_90-1491911889:77805..77851Clytia hemisphaericaexon
TCONS_00073353-exon-scaffold_90-1510915933:77805..77851TCONS_00073353-exon-scaffold_90-1510915933:77805..77851Clytia hemisphaericaexon
TCONS_00073353-exon-scaffold_90-1575043694:77805..77851TCONS_00073353-exon-scaffold_90-1575043694:77805..77851Clytia hemisphaericaexon
TCONS_00073353-exon-scaffold_90-1491911889:78137..78223TCONS_00073353-exon-scaffold_90-1491911889:78137..78223Clytia hemisphaericaexon
TCONS_00073353-exon-scaffold_90-1510915933:78137..78223TCONS_00073353-exon-scaffold_90-1510915933:78137..78223Clytia hemisphaericaexon
TCONS_00073353-exon-scaffold_90-1575043694:78137..78223TCONS_00073353-exon-scaffold_90-1575043694:78137..78223Clytia hemisphaericaexon
TCONS_00073353-exon-scaffold_90-1491911889:78712..78815TCONS_00073353-exon-scaffold_90-1491911889:78712..78815Clytia hemisphaericaexon
TCONS_00073353-exon-scaffold_90-1510915933:78712..78815TCONS_00073353-exon-scaffold_90-1510915933:78712..78815Clytia hemisphaericaexon
TCONS_00073353-exon-scaffold_90-1575043694:78712..78815TCONS_00073353-exon-scaffold_90-1575043694:78712..78815Clytia hemisphaericaexon
TCONS_00073353-exon-scaffold_90-1491911889:79060..79224TCONS_00073353-exon-scaffold_90-1491911889:79060..79224Clytia hemisphaericaexon
TCONS_00073353-exon-scaffold_90-1510915933:79060..79224TCONS_00073353-exon-scaffold_90-1510915933:79060..79224Clytia hemisphaericaexon
TCONS_00073353-exon-scaffold_90-1575043694:79060..79224TCONS_00073353-exon-scaffold_90-1575043694:79060..79224Clytia hemisphaericaexon
TCONS_00073353-exon-scaffold_90-1491911889:79368..79478TCONS_00073353-exon-scaffold_90-1491911889:79368..79478Clytia hemisphaericaexon
TCONS_00073353-exon-scaffold_90-1510915933:79368..79478TCONS_00073353-exon-scaffold_90-1510915933:79368..79478Clytia hemisphaericaexon
TCONS_00073353-exon-scaffold_90-1575043694:79368..79478TCONS_00073353-exon-scaffold_90-1575043694:79368..79478Clytia hemisphaericaexon
TCONS_00073353-exon-scaffold_90-1491911889:79692..79843TCONS_00073353-exon-scaffold_90-1491911889:79692..79843Clytia hemisphaericaexon
TCONS_00073353-exon-scaffold_90-1510915933:79692..79843TCONS_00073353-exon-scaffold_90-1510915933:79692..79843Clytia hemisphaericaexon
TCONS_00073353-exon-scaffold_90-1575043694:79692..79843TCONS_00073353-exon-scaffold_90-1575043694:79692..79843Clytia hemisphaericaexon
TCONS_00073353-exon-scaffold_90-1491911889:80028..80216TCONS_00073353-exon-scaffold_90-1491911889:80028..80216Clytia hemisphaericaexon
TCONS_00073353-exon-scaffold_90-1510915933:80028..80216TCONS_00073353-exon-scaffold_90-1510915933:80028..80216Clytia hemisphaericaexon
TCONS_00073353-exon-scaffold_90-1575043694:80028..80216TCONS_00073353-exon-scaffold_90-1575043694:80028..80216Clytia hemisphaericaexon
TCONS_00073353-exon-scaffold_90-1491911889:80657..81843TCONS_00073353-exon-scaffold_90-1491911889:80657..81843Clytia hemisphaericaexon
TCONS_00073353-exon-scaffold_90-1510915933:80657..81843TCONS_00073353-exon-scaffold_90-1510915933:80657..81843Clytia hemisphaericaexon
TCONS_00073353-exon-scaffold_90-1575043694:80657..81843TCONS_00073353-exon-scaffold_90-1575043694:80657..81843Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_90supercontigscaffold_90:58286..81843 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0.23356 0.164658 0.879576 0.617536 5.35446 3.74303 3.97627 3.8578 0.599427 0.679531 2.00442 1.26502 1.6928 1.36957 1.94986 4.56929 1.54972 1.58876 0 0.0485797 1.27849 0.595903 0.700013 0.226163 1.02949 1.4825 0.118365 0.0631601 0 0.0492317
Blast
BLAST of TCONS_00073353 vs. Swiss-Prot (Human)
Match: TREF1 (Transcriptional-regulating factor 1 OS=Homo sapiens GN=TRERF1 PE=1 SV=1)

HSP 1 Score: 143.665 bits (361), Expect = 4.309e-34
Identity = 75/189 (39.68%), Postives = 114/189 (60.32%), Query Frame = 1
Query: 3397 TVTPT-NEEEINVTTVASDPTEPKINVGPEFQAVLPHVLNRTEAQKDSHRASLMWSPLKEDEQK--QKEVEAYLDMACSLVLYGGSNNKEYALHILQRTRGNVKEAVRLLLSRRHILRADDPNADYHYSGSVRWTAKERLAFRQAYRSKGKIFMGIQKEVETKSVQQCVEFYYLWKAMHPESFRARTRM 3954
            TVTP   E+ ++V        EP+IN+G  FQA +P + + +   +D+H+A+L+W P  E E    Q+ VE  L++ CS  L GG  N E+ALH L   +G+V  A+ +LL R+ +     P A+YHY+GS +WT+ ER  F +A  +  K F+ +QK V++K+V QCVE+YY WK +     + RTR+
Sbjct:  765 TVTPGPGEQTVDV--------EPRINIGLRFQAEIPELQDISALAQDTHKATLVWKPWPELENHDLQQRVENLLNLCCSSALPGGGTNSEFALHSLFEAKGDVMVALEMLLLRKPVRLKCHPLANYHYAGSDKWTSLERKLFNKALATYSKDFIFVQKMVKSKTVAQCVEYYYTWKKIMRLGRKHRTRL 945          
The following BLAST results are available for this feature:
BLAST of TCONS_00073353 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
TREF14.309e-3439.68Transcriptional-regulating factor 1 OS=Homo sapien... [more]
back to top