Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00073349 (transcript) - C. hemisphaerica

Overview
NameTCONS_00073349
Unique NameTCONS_00073349
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length4819

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00073349 ID=TCONS_00073349|Name=TCONS_00073349|organism=Clytia hemisphaerica|type=transcript|length=4819bp
TTTGTGTCGTGTGTGATTTGGAAACTCAGAGCCTGTCACAATGGATCTCA
TCTCATCGTTTTGCATGCATTCACAAACGAAGCTTCATATGAACAAAATT
GACAAGATGAAGCAGTGTGCTTTTTGTTGTGTTGATCGAGCTGTCAATGT
TTTGAAAATCTTGACAGGTCGAGCTGATGCTGAATAATTTGCAAAACTTG
CTGTTAAAATTAACGAAGTTTAACCAGGCCATTTGAAGTCTATGGACCAA
AATCGCAACAAGTCCAATGGTCCAACTTATGGAAACCCAAGTTATCGATC
TGTATTACCTTCAATGGAAAAACAAGAAGATAAATTTAATCCTCAAAGAC
CTAGCCATCTAGgGTCAACTTTCGTCCCACAAACACAATTCTTGTCCGTC
AATGTTTCACATGCCAATGACAGACCATCAAGTCCTGGACACCAAAGTCC
CTACTCTCTATCTTCAACAAGCAGCCCAGCTGGAAGTGATAAAGGGAAAA
ACCCAAATAATGTCTGTAATCAGTGTGGCAAAATGTTCAGCAGTTCAAGT
GCTTTGGTTAAGCACAAGTTGACACACagtgaagaaagaaaatttgtatG
TCCTATTTGTTCAAGAGGCTTCAAACGACAGGATCATTTAAATGGTCATA
TGATAACGCACAGAGAGAAAAAACCTCACGAATGTCATTTTGCAGATTGT
GGtaaaagttattgtgacatgagATCACTTCGTCGTCACTTGGAAAGTCA
TCACAGCAGCCCTCCTGGTGGAACTACGCCTGGATATTTACCTAAACTTA
TGCTATATCCTGAACTCAGTGCAGAAGAAAGGAAAGAACGAGAAACACAA
ATACAAGAGAATAGACTACATGTTCCAGAAGAGCCACCAAGACCTTCTAG
TGCACCACTTGTTGTCCCACCTGAACCAAAACGAATACAGAGAACAAGGC
GGAGTAGTAGTGGTGAAGAGACTCATATGCAACTTGACCCAGCTATGATT
CGTGAGATTGAACAACGAAAACATGGAAATCCATTCCAAAGAAGAACGAG
AGAGGAGTCAGACGAATATATTAAGCCAAGAGAAGAGACTCCTCCACTAG
GTATCTCACCTCAATCTTCAGGGATAGCATCTTTACCGAGTCATTTACTA
AAAACTGTTGTATCCTCTGCTGCTAATCATCGTTACAGTAATATAGAAAA
TCATAAACGAGAAATGGAAGAGAGACGTGTAGAAtatgggaaacattttc
aaagagATTTCAAACCACCGACGTCAACCAGTCAAACCGGTAAACACGAA
TCTCCTTATAATTATCCACCGGGTTTAACTCCTCGCTCATCTCTTACACC
TCAAGGACACCCTCCGAGACCAACAAACGCTCAAGGAACAATGCCTTATT
TATTGAACATTAGAAACCCATTCNTCGCTCATCTCTTACACCTCAAGGAC
ACCCTCCGAGACCAACAAACGCTCAAGGAACAATGCCTTATTTATTGAAC
ATTAGAAACCCATTCGGTCTTTCACCTCATGGGGCTTACCCTTCTCAACA
GAATgaagaattctcaaaaatatctaaaaGTGAGGCTGAAGCAAGGCATC
AAGCTGTCAGCACTTATCTTCAAATGTGGGCAAGTGGGCAACATAATATG
CCTCCTGAACAGATTTTTAGTATGTTTCCTGGAGGTCGTGGAGGACCACC
CAGGGGTAATCATCGTACAAACCACCCACAGACTCCTACTGATGCTATCG
CGATTGCAGTAGCTGCAGCCAAGGAACCGAATGACAGACATCCTTATGCA
GGCAGAGATGGGATTTATGGGATTCATCCAGCGAATGCTAAATGGCAATC
TGTTATGCAAGATGACTCGATTACAATGGAGAAAGATTCTAAAGTGAATA
GCTACTACCATAACACACAAGGCAATGTTCATGACAATTACGCGAAACGC
CCCACACCAACCAAAGAACGAAATATCATCGACGAACCGTTTAAACCCAG
TGAAAGTAACCAcaaatatcaaaacaataataacaacaataacATTAATC
GATTTTTCGATCGTCCAGCTCCTCATCTGGACCCACTTAAAGGTCGTGAA
TATGCGCATCCCTCGCATGTCTACGAAAATAAACGTCGTGAATTAGACTC
GAAAGTCTTCGATACTTCAAGGCATCCTGCTTTATCGTCAACTAGAGATC
ATTCACCTCATCGCTACGATCCACGATACCCTACATCAAGAGACGAGCTT
AATAATAGACTATCGGAACCACCTCATTTAAGAGTTGAAACTGCGGAAGG
ATTAGCTAGCGGTTCAGCTCTTTCTCCAAACAGAAAACGTCCACGACCTG
GACCTATTATAATACCTCCGGCTGTTAACAACCGGTCAATACCAACCACC
ATCTCTCCTTCTCGTCATTTCGCTGCGTTTCCGAAAGGAATTTACACTCC
ACCTGCCATGTTGAGTCCGCGAAGTATTTTCTTTAATCCACCCTTCAATG
CACCGAGACACCATCCCAACGCCCCACATACGCCAGGGCGAATGCAGTTA
TCCAAAAGGCGTTCTTCGAGTTTCAACGAACCACAACCTCTCAACACATC
TCAACAACAACTCCAACTAAAACAACTCGAACAACAACAAATTCAACAAC
AGCAGCAATCTGTTGTACAGCAAACGCCGAAACAAACAACACCTGTCTCT
GCTGAACCTTCTACTGTGACACCCACAAACGAAGAGGAAATAAACGTTAC
AACTGTCGCTTCTGACCCAACTGAACCGAAAATCAATGTTGGGCCAGAGT
TTCAAGCAGTTCTTCCTCATGTTTTAAATCGAACGGAAGCACAGAAAGAC
AGTCACCGTGCATCTCTGATGTGGTCACCTCTCAAAGAAGATGaacaaaa
gcaaaaagaagTTGAAGCTTACTTAGACATGGCTTGTTCTCTCGTCTTAT
ACGGTGGATCGAACAATAAAGAATATGCTTTACATATCTTACAAAGGACA
CGTGGTAATGTCAAGGAAGCTGTAAGGCTGCTTCTTTCACGGAGACATAT
TCTACGAGCAGACGATCCCAATGCAGATTATCATTACTCCGGATCAGTAC
GCTGGACGGCCAAAGAAAGGCTTGCATTCAGGCAAGCTTACAGATCGAAA
GGCAAAATCTTCATGGGTATTCAAAAAGAGGTTGAAACGAAGTCTGTACA
ACAATGCGTGGAGTTCTATTACCTTTGGAAAGCAATGCATCCTGAGAGCT
TTCGAGCTCGCACGCGAATGGTTGAAGTGGAATCAGAGCAGGACGACGAA
GAAGTTCCTCCAACTCCAACAGCAGCTGTTGCACCGCTATCCACTCTTCG
TGAACCTGTATTCGAATGTGATTATCCTGAATGTCGGGCACGCTTTGTTT
CCAGACAAGCGCTCAATGGTCATATTCGAGTTCATGGTGGAAGTTTTACA
AAACCATCGGATACGCGACGAGCAAAAACGAAAGCAGCAGATGGCTCCTC
ACCTCGTCCTCCCGGTGATGGCTTACCAAGTCCGCCCAAGAAAAAGAAAG
TGGCGGCGCCCGACCCCTCCATTATCATCACGAACACGAGTGAAGGCCCT
CAACAGCAGTTCCAATGTAAAGTGTGTGGAAGGGTGTTCAGCAAAGTGAA
AAGTCGATCAGCGCACATGAAAACTCACGTTAAGAGGGACGAGAACAATA
AACCTATCAAATCAGCGAAAGCCACTGCAAAGCAAAAGCAAaaacaacta
caacaacaacaacgacagcagcagcagcagcagcagCAACTTCAACAACA
ATTTGGTGAACATTCAATGCCGCCCTACCCGCCGCAACCGACACACCCTG
GTCCACCCCAACCACCCTCAAATCTAAATCCAATGACTGTTTTTGCACAT
GCGTAAAGTTTATTTGTtatctttatttaattttcttttgttttttttaa
tatccatattaataatttttttattataaacatagaaaaaataatttaaa
ttattatatcttatatctttataattttttacacCACTCTTTTCATGAAA
AGATGCTTTTTATCCAACTTTAGTAGTCCCAAGATAAACCAAGCAAATAA
ATTAAAAcaatgctaaaattttcaatgaaagaaaattttttaatagaCAA
TTATTTACAGTagcaaataattttaaattatttggaTTTTATTGATCact
tttttggttgtttttgtatattattttgaaatctatttgttttacttttt
tttggtttttctatcCACTTACGACAACtcgtttaatattttaataatta
ttattttaaagggAAAAAGCTACGTGATATTATATTGTTAATTTTTGTGC
TGCGCTTTTATTATTGTAAATTTTCGTAAATGAATCTATAGGAGTTTTTT
TCTCTCAAGCAGCAGTATTTGTTTTAACAGTAGTTAGTTTGCAACATTCC
TATAAGAGTGAAACCAAGAAAGTCATTTTTCATACCTCACCAAAGTcact
aaaattttcttttcagtgTTTTACAAGCCGTTTTGTGATAAGTAATTGAG
ATGAGCAAATTTATTCGTGACTAACGCTAAACAAACTAAATATTATGTTT
TTGGTCTTTGTGAATGAACCATTCGTCCGGCATCGCGCCTTTAAGGAAAC
ATAAATGCTTAGTTTTTTGTCAGTGAATGTtatggaaaaaagataataga
tACATTTTTCGCGACACTTATTGTATTATATAcattattaaaaattattt
tacgaGTAAAAATATAGTAATAATTATTAATTAATGACGATACTCTTAAA
CTGTCATCTTGGTTCATCT
Run BLAST on NCBI

protein sequence of TCONS_00073349-protein

>TCONS_00073349-protein ID=TCONS_00073349-protein|Name=TCONS_00073349-protein|organism=Clytia hemisphaerica|type=polypeptide|length=807bp
MPYLLNIRNPFGLSPHGAYPSQQNEEFSKISKSEAEARHQAVSTYLQMWA
SGQHNMPPEQIFSMFPGGRGGPPRGNHRTNHPQTPTDAIAIAVAAAKEPN
DRHPYAGRDGIYGIHPANAKWQSVMQDDSITMEKDSKVNSYYHNTQGNVH
DNYAKRPTPTKERNIIDEPFKPSESNHKYQNNNNNNNINRFFDRPAPHLD
PLKGREYAHPSHVYENKRRELDSKVFDTSRHPALSSTRDHSPHRYDPRYP
TSRDELNNRLSEPPHLRVETAEGLASGSALSPNRKRPRPGPIIIPPAVNN
RSIPTTISPSRHFAAFPKGIYTPPAMLSPRSIFFNPPFNAPRHHPNAPHT
PGRMQLSKRRSSSFNEPQPLNTSQQQLQLKQLEQQQIQQQQQSVVQQTPK
QTTPVSAEPSTVTPTNEEEINVTTVASDPTEPKINVGPEFQAVLPHVLNR
TEAQKDSHRASLMWSPLKEDEQKQKEVEAYLDMACSLVLYGGSNNKEYAL
HILQRTRGNVKEAVRLLLSRRHILRADDPNADYHYSGSVRWTAKERLAFR
QAYRSKGKIFMGIQKEVETKSVQQCVEFYYLWKAMHPESFRARTRMVEVE
SEQDDEEVPPTPTAAVAPLSTLREPVFECDYPECRARFVSRQALNGHIRV
HGGSFTKPSDTRRAKTKAADGSSPRPPGDGLPSPPKKKKVAAPDPSIIIT
NTSEGPQQQFQCKVCGRVFSKVKSRSAHMKTHVKRDENNKPIKSAKATAK
QKQKQLQQQQRQQQQQQQQLQQQFGEHSMPPYPPQPTHPGPPQPPSNLNP
MTVFAHA
Run BLAST on NCBI

transcript from alignment at scaffold_90:54729..81843+

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00073349 ID=TCONS_00073349|Name=TCONS_00073349|organism=Clytia hemisphaerica|type=transcript|length=27115bp|location=Sequence derived from alignment at scaffold_90:54729..81843+ (Clytia hemisphaerica)
TTTGTGTCGTGTGTGATTTGGAAACTCAGAGCCTGTCACAATGGATCTCA TCTCATCGTTTTGCATGCATTCACAAACGAAGCTTCATATGAACAAAATT GACAAGATGAAGCAGTGTGCTTTTTGTTGTGTTGATCGAGCTGTCAATGT TTTGTAAGTTTTTGCTTTTCTTGATTAACAGTACAggcttttgcttttgt tttgggAACGAAAAATGTGTTTGACTTTCTTTCGTAGTGTGGTGAAGAGC TGGAATAAAAAAGCAATATTTTCGAGTGCTTTTAAACCTACGGGGGCAAA ACATTCAGGGcttaaaatgaaaactttcgagataatttttgacttttttt gttaAGATGCGGTaatagtttttgctgcctttttttggacatattttata ggtgaaattctgcttttatttttattttttcgccgaccaaCCGACGTTCT TTTTGGGGTAGCTTGATCCGTAAAATGAATTAAATTGGCCTGGTATATAC GTTTTTAAACAAACGTCAAAACGCTTTACACTCCTTAGCTaatttgggtt ttaagccttaTTCTTATACAAAGGCAAGGCGGCAAGGATACCTGGTAAAT AAATAAGGTCTTGGATTTTCAACCAAATGATGAATCACTCCGGAAAAGTC CGAGAGCCTCGTCGTAAGGGTCCATTTTTTCAACTAGCGGCACACCCAGT GGGAGTCCTGAGAGTCTCCCCAAATATAATTCAGAATTCCGCTCGCAAAA ATACCGTCAGCGCCCTTCtcatacaaaaaatatttttacaagaatatACT CTATAATTAAGAACATCTATGATAAGAATATGCTTAGAAGATCATCACTG TATGGGTGCTATCAAATGGTGCATGGGTCACTGCgctcagtggcgttgtg gcaggggggggcGGTGGGCAAtggccccccagcggagcttttttgaaggg gcgccaaaagagatttttttaaacgccccaatctcAAAAATCATTCTTAA TGCGCCTcaaattgcgcccaggaccaattttactgaaatTATTTTTAAAA AATTGCAATTTTTTTCGCTCGCttcgctcgcttcgctcgcaatacagtta attggtaactgttttgcaatctagctaatttacaagtttttttgtgtaca atatagcattattaaatgaaaatctaacagtgccccaagaccaatttgct gacaacaatattgaaatcataaaacaaatatttttatctagtgatcttgg cagtcgatttttaaaaattttctagtcggaTATATCTATTcttctccact aaatatttTCTTCCTCATTATGCCCGATTATGCCNatcttggcagtcgat ttttaaaaattttctagtcggaTATATCTATTcttctccactaaatattt tcttcctcattatgcccgattatgcctaggcaaatgaattagtaaaagtt tagaaactagTGGCTGGggcaccactttggaaaattggggggggggcgcc actttaaaaaaattgactttggccccccCAGAAAAaatttcccacaacgc cactgactGCGCTCCTAACGGCGGTAtcctaggcttctgctcatcctcta gcgaaaaaagtttcttacgTATAataagtatatctatagaggtcttgGAT TCAGAATTAGCGTTATCCAGTCAAAAACGAGCGTGACACTTATCTTACCC CTTCCTCTGGAATGGTAGGCTTCTGCCCATCCTCTAGCGAAAGAAGTatt atagaggtctgcgatccAAACTACTTGAACGGCCTTTTTGAAACCATAGA TCCAGCGTACTGTCAATCACATCACTTATGCAAACCAAGCTGAGGCCCCT TAGAGTCCTTAGAGGTATCAGGACACCTTTATAAGGTTAAGGTTAACTTT TGAATGCATTGGTCAATTCTATTTGATTCTAAACCGGAAAGGATCAATTA ACTGTTATCGTATTAATTTAAATGAAAATGGACGGAATGAGGCACTTTCC GGTTCGCCATGGGCCAATCCCATTTGAATACACTTTCAGAAATGTCTAGA CATTTTTAGCATATGTACTCGCGCTTTGTTTGCAAAAGAATGTAAAATGA TTTTCTCAGCTCTCCCACGGCAACAAACTTGCGCAGGGGGGTCGTGTTTG TCCAAATGAATGAACGATTCTGTGACACGTCTCGCAAAGACAAGATTtaa tatttctttaattttttctgagaaatttttttcctaGGTGAATCGAAATC AAAATTCATTGAACAAATCATTCAATATGAATCAAATTAAATAATTATGA GGTCACTGTTCAACTACCCCCGTCCATTCACGAAATATCTATGCAAAATA AGTGATTATTAGAAACACAAtatgaatcgaaaaaaaaattgatgtgtTTT GCAAAATAATTCAGCTAACTAGATTTTATATTTGTGTAACGGTTGACATT GGAGattgcaaaatattttgtctgcaTCCTCAAGGTAAATTATTGAGTGA ATTATATTGATGAGATTTTTATTTCTCAGGAAAATCTTGACAGGTCGAGC TGATGCTGAATAATTTGCAAAACTTGCTGTTAAAATTAACGAAGTTTAAC CAGGTATGTCGCCCTTCGTCCACCATTTTATATGGTCTGCTTACAAAATA ATGTCTGCAGCTATCCAGGAAATCGGTTATTTACTTTGGATGTTATGTTT GATCCTCTGATGCAGCTTAGAACTGCATTCTCTGATTATTTTCAGGTCTC TGCAAAATGATAACTCCTAAAATTGGAGCTAGATTTTGCAAAAACTAGAG CTAAGCGTGAACAATAGAATTATGTATTTGATTTATGTAGTTTTAAAGCA AACCATCAACATGTTCTTCAATTATAAAAGCATCTCTAGAGCCTACATTT ATGTATGGCATTTTGCAACATTTCTGTAAACGGCTCCAGTTATTTTGAAG GAAGTCGACTTTTACATCATTGTATTCATGTGTTGTCACgcaatttacag accagattgtTGCGTCTAATATTCCATTTTGCAGACGCGCGTTCAATCTC GGCTTACCACGCACGTGTAAATTAGAACCTTaataaaagttaaaagtgaG TCCGCGATTTACATCCCACTGCAAACGTCCGGTGATTACTTTATTTTAAC TACAAACTCAATGTTGGGCTGGttgaaaaaaggaaacaaactTTTGAACA GCGATACTCTCTGTGCCTTATAATCTACTCAACTGTACACAAAGTTTATG CACTACTCAAACAAATTGGAAATGTTAagtgagaaaaattgaatgaatca TTGATGTCTTGATCTCTACAATACATTCGGTATGTTTTTTGCTGGGTTGT GTTTTGTTTACATGATCAAGGGGTCACCAGGTAGCTTTGTACTTTGCAGC TTGCAGAAAATAAAGTTTTGCTCAACACAGTGTTAGCTTGCTTTGTTTGA ATGTTAATACTTAAAGTAgtgattgaaattttcaaaagccaATGTTGCAA GTCACTGATTAGagctttttgtttgaaatggttataatatcataataaaa ttttgtgCATGGTGCATGGAGTTATTTTTATAATCGTGGAAAAAATGAAT GCAGACAAAATTTCAAACCAGGAAATAAAACCGGAAGGgacaaatcaaaa tgataacAGTGGTgatataaatcaaaatttcttgaaCGACGGATCTACAA GATTTTCAGCTCAGTCTCAAACGCAAAAAGCTTATTCAAGAGGATTGAAT AATTCAAAGCCAAGCCCAGATTCAGGGTGGACATTTCCTAACTTGATGAA CTCTCCTATGATTCCACAGGGATTAATTCCGCATTCGCAAGCAGACAGGA ATTTATCAAATCTTCACCTACCACTCAATAAACCTGCTGATAATTATAAC CCTGCAATCTTCACAGATGCGTATCAGCCAAAAATGATCTCCCCACTTGT GGAAATGAATCTACGAAAACAATTTTTCCTTCAGCAACAGCAACATTATC ATCAAATGCAAAATGTTCATCATCAAAGCCAATTTTTTAATAACAGTGCC TACAATGCTTCTCCTGTTACAAACATTGCTTTCAATGGtatttctaagga aaatggTTCTCACAATAGGAGTCATCCTGTAATCACTCctaatgttgaaa ataagaatgGAAGCAGTTTACCATCATTTGCAACCTTGACTTCTGGAATA CAGGTTGCTGAAAGTCCCCAATATTATGCAGCTGTAACAGCACAACAGAT GAATACTTATTTATCCATGCTACAGAAAAGTCAGCCTAAAATACCTTCAA ATAATGGAATAACTTTACCATCGCCATCTAAAAATGCCAgcttagaaatt tcaaaaacgCAGAGCTGTACTTCTGAAAACATAAccaatgaaacaataaa aagagataAAGTTAGTACTAGCAAGCCTGCCTCTTCACAAATTAGACCAA AAAGACCAACATTGCTTGGTAAGCTAAGAATCTTTTAATATTAAACTTCA GGCTTTTCAAATACTTATAAGGAGCCAGGATAGCCAGCTTATACATATTA GCCTTTTTTAAGCAATGTTGTTCATGTTACCAGGCCAGATCAGGCATATT AATTCTAGCTATAAGTCATGCATGTAAAGATGATTGGACAAAAACTCTGA GGGGCTATCTTGCATGTTGCAGATAGGGGTATGACCACATAAAAATGCTT TAGATGATGTACTTCCATGTTaaaggatttaatttttttctaggaAAGGA TATTCTTGTATTTTTCTGTACTTTTGCACTTTCCTAGGGAGATTTTCCAG TTTTAAAATGCAGTTAAGATATAGAGTGATATGCAATCAAAACATTAGTT ATTTCCTAAAAGAATGATAGCCAGAGTGTCAGACGTGAAGTCTATATCCT CCGTTCAACAAGtcgctaccttaattcaaaaggggcctaagtcctgtgag ccttaattcaaaaggggcctaagtccatttgggtcattttgagaaaattg caattaaagTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNTTGCTTctgattattttgata aaatagcgcgttcaaaacaaagaaaaaatttgtcatttttattgCCTTGG AATACGAAAAGTCTTTAGCGAAGGCGATCATGTTTTTACCAAGTTTGTTT GCAACTAAGCTAATAGTATACACTTTTTAACATCAAAATTATATACTATT AGCTTAGAACTGTGGCTAAAAGAATGAAAGCCTATATGGATGTTCAGTAA ATGTAAACTGAGTATACTAAAAGTTACCATGTAGTTAGAAACAGTAGAAT TTGACTGAAACACTGatcttttcaaacattttaattCAATGTAGACGAAa gccaaaaattattttcaacataaaatttggacaaagttattattattata aggaTAACAGGTTATGCATGGTTTTGTAAACTCTATTGATATAAtttcta acttttatatttATGATTCAGTAAAGTCTGAGAGGTCGCCTTTGATATTA GGCATTCGCTTGATTGGCTGTCTACGCCTTTTATCCTTTTGAAGGTATTC AtagttttttatcatttttattaaTATAGAGAAGTACAGTTCAGGCACAC GAGGGTCTCTAAACGGTTCTtgtacaaaaaactttttaaaatacaatttt tcatGAGGGCTTCCTCGTACCCTCCATTTAAAATCGTCATTTCATTTGAT CTGGCTTTTTTCATCTTGTCTGCTCTCTTTTTTCACTCTTGATTTGTTCT CTCTCCATTTTTGTCAAGTCGTCAGTGATACTTAATTTCAAGTACTTCTC GTGTTGTTTCAATTCAGTCAACTTCTTCATGAATCTGTATTTGATATGAC TGCCTTTGAATACAACTTTGATTGGGCACTTTAGATTCTTTTCCAACAGG AGAGACATAGGTTGGTTGAGTTTTTAAATTAACGTCATTCAGAAGCTCGT TAACGAAATTAATATATCttctttactttcattttcatttacccCATGCA ATGGATAATGATATTTGCGTCTATCAATAACTTTCTTTGCTCTTCAATTG GTTCATCAATTCTCTAACTTCAAAGTAGCTGTTTCATGCTATTTGCGCTT TAATTGATCAATGTTTTTAGTCGTCtcagcaaaacttttctttcgTTCTG TTCTGTTGTGGTTTGAATTTTTGGAGTCTTGTTATTCATCTTCTCTTCCA TCTTGGCTGTTAGTTTTGTTTCTAGCGTGGAAAATTGGCTCTGTATTAGA TCAGTAACTCAATTTTTATCGATGTTGTATTCCTGACATCTTGCCTGTAA ATCTTTGACTATTGTGTTTATTCTTTTTTCGCTCTCACTTTTGACTTTAT GCTTTTGCACACTTTAATTTCTTTATAGCTGTGCGTGCAGCTTTTGACTA TTGCTTGATTATGGACTTTTCTACCAAGGTCTTTTGCCAGAGAGCAAAAA TGTAGCATTTGTTGGCATTTTTGACATTGAATTctcattttttcatcatt tttatacAATTATGCTCAGTACATTGAGATTGTTGTCACTCCATCTTCAT CATGGATCAGGATCTTATCAGGTGATGTtgtttttggttgaaatttggct gttttttccatatttttgaaaagagcGCAACCTTTCTGCTTTACGGTTCC TTGCATTGTTCCTCAACATTCTAACTGTAGATGGATTTTTTAATGCTCAG ATCAGGCCCTTGATGatcacacaaaattttgacacaAGTCATACATTTAT CTGATTGATATTTAGTTTTGCTCAAAGAATTAAGtacaataaaagaaata tggcATTGGTGTCAtaaatttttgaggaaaatagAGAGATGAGTTTTTAT TTGTCTTGCCTACTGAACCCAGTAAAACTTTGCTTTTCTAAAATTGGGTA AAAATGTATTGCAAAGAGAGGAATTTTCCATCACTGAAGGTGAAAACCTG TTTTCCCTGGTTTTCCAAATCGAATCTTTTTTTGTAATGATGGTGATGAC TCCAACAATGGGTTTTGTCAAGNTATGGCATTGGTGTCAtaaatttttga ggaaaatagAGAGATGAGTTTTTATTTGTCTTGCCTACTGAACCCAGTAA AACTTTGCTTTTCTAAAATTGGGTAAAAATGTATTGCAAAGAGAGGAATT TTCCATCACTGAAGGTTGGCTACTTGCAGTGAAAACCTGTTTTCCCTGGT TTTCCAAATCGAATCTTTTTTTGTAATGATGGTGATGACTCCAACAATGG GTTTTGTCAACATGGAGATCAGGAAgatatattttgattggtttaaaaat ctcaagaagcaattttttttgcaatgacTTTTAGGAATTCTCTTTATCTC ATTAAAAACCAAAGGAAGTTTTCatgatgaaaagaaatattttttctaca aaaagtttaatATTGTGTCACATCATAACGTTTTGAGAAGGCAAGTGTAG TAGTATAATCTAGCTCTCTTGCCAACAGTTTACAGAAAAGACTCAGAGAC AGATATTTAGCTATAACTGAAGGTGCCATGATAAAGACTTTGACtaatag tcccgctgctgagatcgaaaaaagtggctagaaaacaacTTTCGTGccac acatcttagaactaactttttttggtagAAACNtttctacaaaaagttta atATTGTGTCACATCATAACGTTTTGAGAAGGCAAGTGTAGTAGTATAAT CTAGCTCTCTTGCCAACAGTTTACAGAAAAGACTCAGAGACAGATATTTA GCTATAACTGAAGGTGCCATGATAAAGACTTGACtaatagtcccgctgct gagatcgaaaaaagtggctagaaaacaattttcgtgccacacatcttaga actaactttttttggtagaaagtcacgaattagtatatgtacattccaaa atcaaaaagtttccacgatattatcgtgcaagtaacgagtaattggcaat tttttgcgtttccaggcaaaattgcatgatttttggggggtcttcaaNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNGTAATTGgcaattttttgcgtttccaggcaaaattgcatgatttt tggggggtcttcaaattaaaaaaatacctatatcacatgatagagctctt caaacatagcaaaaaatgtattacaccaaagtcccaacttctctagatca aaagttatgggcctaatTGTGgccaaaaaggtgtttaattttgcataaat taatacagattgtggggaaattccctgttttccatccgtttttgaccaca aataggcccataacttttgatctagagaagttgggactttggtgtaATAC ATTTTTTTGCTCAGTTTGAAGAGCTCTATCATGTGATATATgtctttttt taatttgaagaccccccaaaaagcatgaatttccaggccttgcaattttg cctggaaatgcaaaaaatccccaattactcgttacttgcacgataatatc gtggaaacttttcgattttggaatctacatatactaattcgtgagtttct accaaaaaaagttagttctaagatgcgTGTCACGAAATGAAATATTTATC GACCTCAGCAGCAGGACTATAATGTTTTGTAAATGCAGAGGTTTGGACTC AATAGTGCTCAATACAATAACAATTTGCTCTGATATTAACAGACTATGAA ACTTGTTATTGATTAATTGCTTTTTTAAATTGTTACTTTTATATTTTACT TCTAGGCCATTTGAAGTCTATGGACCAAAATCGCAACAAGTCCAATGGTC CAACTTATGGAAACCCAAGTTATCGATCTGTATTACCTTCAATGGAAAAA CAAGAAGATAAATTTAATCCTCAAAGACCTAGCCATCTAGGTATGAATAA ATTTTATCTTTGGAAAAGAAATTAActcatttttaaaatgaagacCAATG AGCCATATGTAAAAAATACCAATTTCAAAAGCACTTCTGCTGAAGTTGAG AAAATCCAGTTGTGTGGACAATCCTAGAACTGGGATTAAAGCATGTAAAT TTTAGCAATTGGCCTTATTTTAGATTCTAGGACCAAAAGCTTTGGGATTC TGTTTTCTTCATTATTGTCTATCAATACAAAAGTGaatgcaaaaaaattt catactaACAAATTATCTAAAACTCCTAGTTCGGACACCTCCCCCCTTTC TTAAGACACCTTATGACACCTtccgaaaaaatgaagaaggggtGAGGGTT AGAAATTTAAATGAAAGCAAAGAAGGGGTCTTACATATATATATTGTAGA atattttcaagcactgttatgaactttggtcttcatgaaaggaagttttc tgttagagaagtctgagtcaaaaagaagaaagaagtttattattttcctc tctctctaaagatatttcacattATATTTGTTACCtattttgtccaaaat cctttgGAATAGGCATTTTTAACGtttgggggatgccaagaaagggggat cagacccctttccgcactatgaaaCTGTCTGGTTATTAGCCAAAGTGGGG GAAATTGTTTTGTTGCTATTTTTCACatttgtgactccccaagcgatttg aagtataTNTATGAAACTGTCTGGTTATTAGCCAAAGTGGGGGAAATTGT TTTGTTGCTATTTTTCACatttgtgactccccaagcgatttgaagtataT TAAAGTCCAATCGGTAAAAATACCATTCTTCTTTGGCCTCTACTCGCCCG GTCTTTTTACCGTTTGGGTCGCTCGGATATTGAAAAAGGCCGATGCGAGG CCGCTTATTAAAAGCGGCCACAGTGAAGCGGCGACATAGTAAGTTTTAAG TCGCTAACAGCGGCCATTAGCGGCTCttagttttgtttttcaatttcctt acattttcaagtacatttggaacaaagaaagattttttcagccagggtAC CAGGTACAGACAGCAGGGACGTCTTCTTCCATTTCACAcatgtttgaaaa agaaacttcTTACTTCAAAACTTTCCTTCTAAGCTCGTGATATTTTCAGG AATAAGCCTTCTTTTCCATGGTTGAATTGAAAGATGGGTCTATCTGCAAT ATGTACTTAccgattttatttatgtttttttgcaaCAATCAGCAGAATTT TCCGGATAAAGATAATTTTAGGAATGAGCCGAATTCTAGATTGCTTCCTT CATTCTTGTGGTTAAATCGTTTTGCAAAATATACTTTTCTGCTTATATTT GTTTTCGTTGGTCACCGGCAAACATTTAAAGCGGCCTTTTAACCACTCAA AGAGAGGCCGCTAATAAGCTGCTGGCCGCTAAATAGGCCACTGGCTGCTT GGCCGGTCTCTCGATCAAGAAAAAGCCTCTAATAGAGGCCTTGAGGCCGT TCTTGGAAAAATTCCATTGGCCGCTTCATGGCCGATCTTCTAAAATGNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNagacccattg aagtccagcggagggggcagaaccgacaaattttcactaaaatagcttaa aaacgcttaaaaagctctatttaagcgtttttaaggcttttttgagcaaa aaacgtaaaaacgcaaccttgcaagcaagtgagctacttccaaaggctct aattagcatatttccatggtgctgaagcgattttgagaatttagaacccg ctgggaacagtagttttgccagaaaaccggtttttaggcctccagagccg cctgggcttacgctgtaagcttacagcgctgtactggagcctNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNTGTGTTTCGATATAATCACCTGAT TACAGAGACTAAAAGTGCGACTCAGttgatttaaaagttgaaattggaaa atttaagggttatttaaaaaaaaaatcacagctacttattttgtttgtaa gatttttgattttgtgttttggttgaccacttttcaatttggccctttag ccgatcggacttttgtgcttggggagtcacattaATTTGGGCCGCAAGTG CCATCAGATTCcttattgttttttcaaaatgtgtcTAAAAGTGGCAAAAG TGCTTGTTGGCACTTAAATTTTCACTGATCGTTTGTTCCATTCGTGTTCA AAGTGGCAAATTCTCAACCTCCACCaagcaaaaaacaaatttgatttgTT TCGTGTAGTTTGTGTGAAAAGTAGGAAACAAAATGGCAGCTTTCGAATGC ATAAATTTGAGCATTTCGCCTGTCTATCAAAGCAACCACTTTTagggttt ttttcatttctaggGCACTAGTTTTAACTAAAATATGACTCCCCAAGGGA TTTTAAATACCCAGTCTAAACCGATTGACCATAAAACTGTAAaataccag ctttttagcagcCAAGATTTCACTTTTACTGGTCCCCTTCTTTCTTTATC GGCTAAGGATCGGCCACTCTCGTTTCACTTTAAAGCAGCTTCTGTCTTTT ACGCCCGCAAAAGTTATTAACAACTGTAATAAAAGGACTGACAAAAGAGC CTCTTTATAAACCATTTATATTTCTGAAGCAAGACTGATCCTTTGCTTCG TGGTCTtcatttgggcaaatttgggccaaaaactaccttaaaaagggttt tttggactttgtatgaaattttctcattagttttttctgattttatgcaT AAACGTAAAGGGCAAGGTTTCTATAAACTGACTGGAGGCATTTTTTCTGC AGAAAATTGTTTTGGCCGGGAAATAatagattttcttatttggggaaatt cccttttgtcatttttaggaaAAATGACCATTTCTCTTGATTGCCTtggt aaatttttctgattttttgacaatgacaaaaaatgctaaaatgtTTGAAA TCTGGGGGAACGAGATagtcaaaaaataatattttagccaatttggggcc aaaaagtgcctgaaaatttttttttttttgacttatgaattgcttcattt gtttttttctgatcttttgcaTAAAGGGCAAGTGTCTCTTAAAAGTGGCT GAAGCTGTTTTTTTGGGGGATTTTGATGTAAAATGTTATTGTTTAACATC TGATAGATCTGGAtagattccagaaaaaaatttggctaatttgggccaaa aactaaaagtgcctaaaaatggggttttttcGACTGTGTGAAATTCCTtc tttagtttttcctgattgaCGGTGATGCAAAATTGTAATCCTTAAAATGT AAGacttgaagatttttaaaaagaaaaggttttagctaaatttgggtcaa attattttctcaaaaatgtttagttttattatcaggtaggtccataaaag tatagCTTGTTTACATTCaaagtccctctaagggtcaTAGAAATCATAAT tccaaattaaataaataaaaccaAAAACTCAACAATATTAATCACTAAAA AGGCTAAGTTTTAGGAAAAAAGTCCTGGTAAGGGTTTCAAAATCcacaaa atttcagttttttccTTAATTTCAGACCCTAAAAtttcctattttcaaaa atcgggcagCACTCCGTCCCAGACATATCGTAAACATAGTACCTCCTGGG TTTCTGAGTTAAAAACTACTTGAATTAGGACCTCACGCTTTAAAAAACTT GGAAATTCCAGGCCCATTATTCTCAATAGCTCTATGAATGTGGTGTTTCT CAGCATTAATGATTAAAATTTTAGGTGACCCCTTCAACTTGAGACATTAG GGGCTTAGGCAAAGGCGAGTGGTGTTTGTGTGCCAGGTTTTCACATAAGC AAGTCAAAGAAATGTATTATAAAAAAGTACGGAATTTTTCGTCGTCCGga gaattttcttttcttctaaaggaagaaatttttccaaaaataaagaaagc cTCCCTGGGGGTCACCTTCTCAGCAAAATTCAATCAATtgtgttgaattt tttttcaatcttgaTATAAGTTGCACATTAACTCAAagggaaaaacaaaa tttcagtaATATTCAGGGAGAATAAGCATTATTTTGTGCAAAATCTCAGG GAAACCACTTTTTTTATTCATGTCTGAACCCCGATTGTTGAAATATTGCT ACAAATTGTATGATTTTGagtttattcttttctttttaatccTTCAAGAT TGTTGTTACAAATATATTTCTTCTATCCTCTTACATATTTAAAAACTTAC AatatattttctgaataatGAATGCAGGCCTTTTTAATTGGTGTTAATTA GACCTCAAATTCTCCCTCAGAGTTTTAAAGGTTGCTTGCTGCAAGTTTTA AATGCTGACTAAGAGCAACCCCTGTTTTACAATTTCATTATCTCTACTGT ACTTTCGGCTGCACGGATCACTGCATACTCTCTTTGCAAATTTCTTCATA CCCTTTACTTAGCAAGTGTGTTTGTAGAATTTACAACAGTGTTAAACTgt aaacaaagcaaaaaattcACCTAAGTTGATTAACATTGTTTTATAAAATA ACGATTTGAGCTAAGAACTTGTTTAGTACCACCCTAATCAAACTATTCAA AAGTGTCACTTTCCTActgtgagaaaattaaaaagcaGATGAAAAAATGG TTTTATGTTCATACTGTATCCATACCTTCCAAAAAACTCAATTCAAAAAC TAACTTTTCGAAACCCAATCCAGATATATATGAAATTTCATGAGCTCCAG ATTTTAAAAACTATGATTCTAACTTTCGTTTATcgttatattatttattt tttctctttttcaggGTCAACTTTCGTCCCACAAACACAATTCTTGTCCG TCAATGTTTCACATGCCAATGACAGACCATCAAGTCCTGGACACCAAAGT CCCTACTCTCTATCTTCAACAAGCAGCCCAGCTGGAAGTGATAAAGGGAA AAACCCAAATAATGTCTGTAATCAGTGTGGCAAAATGTTCAGCAGTTCAA GTGCTTTGGTTAAGCACAAGTTGACACACagtgaagaaagaaaatttgta tGTCCTATTTGTTCAAGAGGCTTCAAACGACAGGATCATTTGTAAGTCCC CCAATTTTCTACTAAGTGTCTGTAAATGTTTTGGTTAAGATTATAGTTGA CGTTCAAAAGGAAATGATAGATATTCACCACTTCTAAGTATATTCAGTTG AAGTCTGCAATGCAAACTTTGGTGGCTAAATAGAGGAGTTGTAATATTTG TAATTTCCTTTGTGGGTCATAACTCAATGAAAGCGGCGTTTCTCGAAGCA ATTAAAAAGGATTAATAGCTTCTAACTTCCATACAAATTATATGATGTGC TGTGACGTTTAGATAAGCTTGTCTTTAAACTTGTATTGTTTGCTTTTATA TATAGAAGGTATCACACAAAGCTCAAACAAAATTTTACATAACTCGTTGC GAGGACGGTTTTTTATTCTAAGTTGGAAGTAAAGTCCTAAATCAatgttt agttttttctaaaatgaaacATGTTTGTTTGGTTTTCAATTGATAGTCGT AACCACACCATAAGTCTTGTTCACTCTTTCTATGNCAATTTTACATAACT CATTGCGAGGACGGTTTTTTATTCTAAGTTGGAAGTAAAGTCCTAAACCA atgtttagttttttctaaaatgaaacATGTTTGTTTGGTTTTCAATTGAT AGTCGTAACCACACCATAAGTCTTGTTCACTCTTTCTATGACTCAAACTT TGTGTGTGTTGTGTACTTTTCCAGATATTAACAAATTATATACTACACTT CAATCGTAATGTATATTACGTTGAAAAATTGATTTGTGAAGGTGTCATCG TTTTTAAGTGTTTATTAATCAGATTATATGAAATTTGTCGAGAGTTATGG TGTTCGAAGAgtgatgttttatgattttttctTGTTGTCGTAATACTTTT GTATTACGATGTCTGATATAAACGTAAAAGAttccaatcaatttttttga cattACACTTATGATGGGCTGTCCAAAATGtcgtttctttttttattgtc ttGAAATGACAAACAGAATTATAGTTTGATACACAGAACGCATTAAATAT AAAGATAGTGTGCTGTGTGTccgtttaaaaatttttgttctgagtgattt gtttttatttttcatgttcTCAGAAATGGTCATATGATAACGCACAGAGA GAAAAAACCTCACGAATGTCATTTTGCAGATTGTGGtaaaagttattgtg acatgagATCACTTCGTCGTCACTTGGAAAGTCATCACAGCAGCCCTCCT GGTGGAACTACGCCTGGATATTTACCTAAACTTATGCTATATCCTGAACT CAGTGCAGAAGAAAGGAAAGAACGAGAAACACAAATACAAGAGAATAGAC TACATGTTCCAGAAGAGCCACCAAGACCTTCTAGTGCACCACTTGTTGTC CCACCTGAACCAAAACGAATACAGAGAACAAGGCGGAGTAGTAGTGGTGA AGAGACTCATATGCAACTTGACCCAGCTATGATTCGTGAGATTGAACAAC GAAAACATGGAAATCCATTCCAAAGAAGAACGAGAGAGGAGTCAGACGAA TATATTAAGCCAAGAGAAGAGACTCCTCCACTAGGTATCTCACCTCAATC TTCAGGGATAGCATCTTTACCGAGTCATTTACTAAAAACTGTTGTATCCT CTGCTGCTAATCATCGTTACAGTAATATAGAAAATCATAAACGAGAAATG GAAGAGAGACGTGTAGAAtatgggaaacattttcaaagagATTTCAAACC ACCGACGTCAACCAGTCAAACCGGTAAACACGAATCTCCTTATAATTATC CACCGGGTTTAACTCCTCGCTCATCTCTTACACCTCAAGGACACCCTCCG AGACCAACAAACGCTCAAGGAACAATGCCTTATTTATTGAACATTAGAAA CCCATTCNTCGCTCATCTCTTACACCTCAAGGACACCCTCCGAGACCAAC AAACGCTCAAGGAACAATGCCTTATTTATTGAACATTAGAAACCCATTCG GTCTTTCACCTCATGGGGCTTACCCTTCTCAACAGAATgaagaattctca aaaatatctaaaaGTGAGGCTGAAGCAAGGCATCAAGCTGTCAGCACTTA TCTTCAAATGTGGGCAAGTGGGCAACATAATATGCCTCCTGAACAGATTT TTAGTATGTTTCCTGGAGGTCGTGGAGGACCACCCAGGGGTAATCATCGT ACAAACCACCCACAGACTCCTACTGATGCTATCGCGATTGCAGTAGCTGC AGCCAAGGAACCGAATGACAGACATCCTTATGCAGGCAGAGATGGGATTT ATGGGATTCATCCAGCGAATGCTAAATGGCAATCTGTAAGTATCTCTCTC TATTTGTTTCTTGTCTGTTTAATAATAAAGAGTCCTACATGTCTTTTGGT AAAACGTGCACCCAGATAGTTTTCGATAATTTCTTGGTCCTAAGAAAAAC TCCcttagtttttttgaaaaagtgtttTACAAATCTTATAAATatactta ttttttgaaatttcgaaatcAAGTTAAATCAAGTATCGCTGCTGGgttaa aaaatttgtttttattcttaGGTTCTTTTCCCCTATTTACAGGAAAAAGC ATGTTTGTCTTTTGTTTTGGAAAGGCTGCAGGCTTAAGTTTCGTTGTAGT TGTTATGATATTTACTTTCTCGTTACTAATTTTATTGACGAAACATTACG TAATTTTTTCGCTTTATTGTTTGCTGCTTAGTTCGGGAATTTCCATGTCA TTAAAAAAAGTGCTAGAATTTGGATTCGTGTTGAGACTGGATGTAAAAAT AATtggatacactttttttataagaacaaactataagaacatcaggcttc ggtggccgaaatgttaagaacaagttacgaacattttaaggctttgccga cTCTAAAACAGCCGATTTCTTTGTAGGTGCTCAAAAGGCTTaacaaaaat ggtgaaaacaaTAACACGCTactatgttaagaacattcttaggcttaaaa ctcaaaaagttaagagcatccgacggcttcaaaaattttggatgctccta taaaaaacgtgtagtaggCGTATTACTAGTTCGTTCTTTCTTTAGCTTTC CCTATTTGATGGTTTCATTAAAACTTCCTGTTTAGTTAGTATGTAATGAA CTTTCGTTGCAGTCAGCAGTTTTTACGGAATCTTAAGCCTTTAGTTATGT GAGCAGCTCCAAAGTCGATTTTTCTAAGAATTCGTGATCACGAGATGAAT CGTTTCTCTTTTGCGAAGAGTTGCGAAATCCCATTTGATCTTTCTTGATT TTCTGCAGGTAGCAGTATCGGTCTAAATGCTATTGCAGCTACCTCCTTTG AATCTGCACAGGGGAATTTTGTCAGACTTAATTGCTTATAAGTGCTTTGG ATTTGTTAgtaatttgtcaaaatattgctTTTTTGAGTAATAGCTTTTTA GttgaacaaaagaaattattttggtttcttTGATGTCAATCAAAAAGAGC TATTAATTAAAAAGCTCTTCCTTGGTCACTGATGGTGACGGTGATGAAGT TATTGATGAGGGGAGCTTCTtagtaatgtttttgttttgtttttttgata tTGTAAATAAGAGAGAATAATGTAACAACGTAACGAGTAGGATTTCTTCA TAAACAAGAAATGTCTGGAAGCTTATCGAATAAAAACTTTATACTATTCC AAGCTTTGCATAAGGTACTGTAACTTTCAGTTGCGTGTCAATTCTTGCAT TTTCAATGAATTGAGATCTTTGGCAATTTaatacttcatactgtttttaa aatactttcattAACTTTCTCTCTGTCAGATACTTCTAGTCTTTGTTTAG AATTCCACTGAAGCTTTTTAACAGTTGAAATTGTCATAGTGTGATGATGA AAACATTTAAGAAGCTTTGCTCCTGGTCGATTTCTTTGGAACTTCCTTAA TGTGTTTATACAGTTCTTGGTTTCTCTTTCTGGAAGCAAAACATGGTTGG AAGTCGTCAGTCAAAACGTTTAAATTTTCTGTACGTTTTAGGTTATGCAA GATGACTCGATTACAATGGAGAAAGATTCTAAAGTGAATAGCTACTACCA TAACACACAAGGCAATGTTCATGACAATTACGCGAAACGCCCCACACCAA CCAAAGAACGAAATATCATCGACGAACCGTTTAAACCCAGTGAAAGTAAC CAcaaatatcaaaacaataataacaacaataacATTAATCGATTTTTCGA TCGTCCAGCTCCTCATCTGGACCCACTTAAAGGTCGTGAATATGCGCATC CCTCGCATGTCTACGAAAATAAACGTCGTGAATTAGACTCGAAAGTCTTC GATACTTCAAGGCATCCTGCTTTATCGTCAACTAGAGATCATTCACCTCA TCGCTACGATCCACGATACCCTACATCAAGAGACGAGCTTAATAATAGAC TATCGGAACCACCTCATTTAAGAGTTGAAACTGCGGAAGGATTAGCTAGC GGTTCAGCTCTTTCTCCAAACAGAAAACGTCCACGACCTGGACCTATTAT AATACCTCCGGCTGTTAACAACCGGTCAATACCAACCACCATCTCTCCTT CTCGTCATTTCGCTGCGTTTCCGAAAGGAATTTACACTCCACCTGCCATG TTGAGTCCGCGAAGTATTTTCTTTAATCCACCCTTCAATGCACCGAGACA CCATCCCAACGCCCCACATACGCCAGGGCGAATGCAGTTATCCAAAAGGC GTTCTTGTAAGTGTCTGATTACATATTTTTAGTTCCCctttttttcttgc ttggaAACGAAGCTTTTTTCCTTCCCTGGTTGATTGTCGCGTTGCAAAAA TTACTCAAACATACGTGCAGGAAATGGACGATTTATACTATGATTATTTA GTCATTTGAGGTCGCCGCTtggattttaaaatctttaaaaggaaCCTCAA CTTCCGcttttgcattttctttttctggcttttctagcatttttttcTTG CATGATCAGCTTACGGATAGAAAATGTTTtgacgaaagtgaaagtgcacG AGTTCCGAGCTCATTAGGATGTAAAAAAGCGTAGAAATATCCTTGCAAAC ACGGGCCATTTATTCAAGGCACTCACTTTATTCGGGATTGAATATAGGTG ATACATATTACAACGAGCAATGATTTACTTCATTTTCAGCGAGTTTCAAC GAACCACAACCTCTCAACACATCTCAACAACAACTCCAACTAAAACAACT CGAACAACAACAAATTCAACAACAGCAGCAATCTGTTGTACAGCAAACGC CGAAACAAACAACACCTGTCTCTGCTGAACCTTCTACTGTGACACCCACA AACGAAGAGGAAATAAACGTTACAACTGTCGCTTCTGACCCAACTGAACC GTAAGTATCTTACTTTTGTTGGTATCCATGGTATTTGTTGGTATTAatgt tttcccttttttccctCTCTGAATAATATGAAAATGATCTCAGGGCTTTA TCAAAGTAAATGgtgttaaaacattttttttcgatcgAGAGGTCacgtag actagagtctacttctggctgaactttgctttttgataattttttcatga cgctgagtccagtcaagtagactaggagcatttggcgaggtcgccatttt gaaaaaaaaaattaaaaatccaaataacaataaaactacttggagttgaa ggatataatcaaaaataagaaacaaacacgattaacagatttgtaatccc ttattctcaaataaaaatattgcttcatactgtttttaccttccaaaaac aactaaaatctggcggactgttttacagtccgcctaggcaaaagcatatt accatatactaccgggccacttatcagcaccaaaaagtccataaaaaagc tctaagtggaccccgggctagagGTCACGGTGATAAATTCAAATTGGACT TTCGTCTTCTAGTTTAGCCTGTACCACTCCGCCCACGGGCgttatttata ttttgaaaaaacttgccgTTATCTTTTCGgtcagcgaagaagagtttggt acaggctactTCTAGTTGTGCCAAGCTAGCTTCATGTAATTTAACACTGT GGAATTTAATATACTATAAGGAGAATTCAATTATATGTATCCTGTGTCAA CATGACCTGGATACAAGAATTTCAATAATGTTGTTATTTTGTATGGGGAT GGAATTCGTGTATAATATCTTTCACACAGGCCAATAGTCAGGTTAAGTTA TTTGTCTCACTTTTCATGATTGGTCTTAATTACTGAACAGTTATGTTATC AAACTAGCTTATGTCGCTTTCTACAGGAAAATCAATGTTGGGCCAGAGTT TCAAGCAGTTCTTCCTCATGTTTGTAAGTATATTGCTAGTTTGCCTGAAA TTTCAGTATTTGATCAAATGATACAACTCCCTCTTTAACTTAAAAGCTCA TATATACTCACATTGGGTAACTAACTTTGATTTAACCTCGCATATCGCAG GCTCCAAAGAAAATAGCTTTTAACTGTCTAAGTGTTGAATGCCCCTTGAC TCATAAAAGTCACCATTGGCAATATAGATGACGAGGATGTGATTTTTTGA TAGCTAAGAATGACATTATCGTATACCTTTAATCGATTTTCTTGTGTCCT ATGTTTAGTAAATCGAACGGAAGCACAGAAAGACAGTCACCGTGCATCTC TGATGTGGTCACCTCTCAAAGAAGATGaacaaaagcaaaaagaagGTAAG ATTTCTTTTGGTCAACTTGATGCAGGCTGTTGAACCGATTTATTTcgacc aacgatgtaaaaataatagataaccaacttgcttgtggtacctttatctt ttgaaaaaaaatccaaaatttgcagtaaataacaattcaaatattctatc aattcagtggatgtcaaaaagtgtgtcaaaatctagctaaaagcattaca cgcactgcacacagagctttttaatagagtgctcatttcaataggaaaac aatggttgttctcttgggagaagtgccttctagaggtagttggttatcta ttatttttacatcgttgttTCGACTAAATCTCACTTTGGTTTCGCATAAT AATTAGTCAATTTTTCTCCACAAAATACCTGATTTGAAACAAATCTGAAG AAGACCAATAGACCAAAAATTTGATGGCTGTTAACTTAAAAATGTTTGAC CCAAAATATCATGCTTGTTTCTTTTCGTTTCAGTTGAAGCTTACTTAGAC ATGGCTTGTTCTCTCGTCTTATACGGTGGATCGAACAATAAAGAATATGC TTTACATATCTTACAAAGGACACGTGGTAATGTCAAGGTAATAATGACAT TTTCCAAACCCCTGAAGGAAGAATGAAACGTATTCCATGAGCTTCTTAGT GTCAGACTTTTTACTTTctattgaaaaagaagaatggggaaaagcatttt tttaataCTTCGGGGTTGTATAATAGTTATAGAAGAATGCGTTaaagttt gagatttttttcaattttcaaagaaatcttttttgttacACTTGGAAATT catgtattttttttattattttaaccCTTAGGAAGCTGTAAGGCTGCTTC TTTCACGGAGACATATTCTACGAGCAGACGATCCCAATGCAGATTATCAT TACTCCGGATCAGTACGCTGGACGGCCAAAGAAAGGCTTGCATTCAGGCA AGCTTACAGATCGAAAGGCAAAATCTTCATGGGTATTCAAAAAGAGGTAT GGATGAACGGCTTTATATCCAGAATATTTACTACTAAATCACGACAGGGT TTTGGTTTTTGAAATTATGACAGTGTTTTCAAGACGAAATATCTAGACAC GTGAGCGTTCACTTACcctttctctgattttttattCAGGTTGAAACGAA GTCTGTACAACAATGCGTGGAGTTCTATTACCTTTGGAAAGCAATGCATC CTGAGAGCTTTCGAGCTCGCACGCGAATGGTTGAAGTGGAATCAGAGCAG GTATTATTTCCTTTGTAAATTCAAATCGTTTTTTGAAAGCTGTTGTACAC AAGACTTGCAAGGGAAGAGTTCTTATTGTTTGGTCtaatttgctttttat atgCAAATACTTTCAAGAGGTATTTAGGTTTgtctttatctttttctttc tcgactgattttatttttttgaggcATCCTAAATGTTTTACCTTTGTATG TTTTGTTGTCTAGGACGACGAAGAAGTTCCTCCAACTCCAACAGCAGCTG TTGCACCGCTATCCACTCTTCGTGAACCTGTATTCGAATGTGATTATCCT GAATGTCGGGCACGCTTTGTTTCCAGACAAGCGCTCAATGGTCATATTCG AGTTCATGGTGGAAGGTAAGACATAAAATTGACGACagtattataaaaag aaagccAGCTTTATTTCATTGGCATTTTTGCTTGAATTTGAACCATTAGG AGAAATATGAGTAATTCGCTTAAATCAGAAATTAGACTTGCTTACCTATT TCCCCTTGTACCTTGCGgatttcttttaatttattctTTACTTTTACAGT TTTACAAAACCATCGGATACGCGACGAGCAAAAACGAAAGCAGCAGATGG CTCCTCACCTCGTCCTCCCGGTGATGGCTTACCAAGTCCGCCCAAGAAAA AGAAAGTGGCGGCGCCCGACCCCTCCATTATCATCACGAACACGAGTGAA GGCCCTCAACAGCAGTTCCAATGTAAAGTGTGTGGAAGGTAAGAATATAC TCGAGGAGTATCAAGATTCTCCATGGAGATGATTAATGTTTGTCCTACTT CTTTGACCAATAAGAAAGCGATTTTTCCTCATCTTAAAAATTAACTTGAA TGGGGGAGGTcattttcccgaaaatttttttttgatactcTCAACTACAG TTGAACTAGAATCTGAGattgtctgtctgtctgtccgtCTGTCCGCCAAA AACTTTAAGGTGACAGCCTGGAGTCTTctaaaatggtcggatttggctga aatttggcacacttaagtgaatatctgggggtattattttttatttttca aaattttggctgGGCACTAatcttttggtttgttttgctaCACTTGGgtc tatgaataatttgaagctactgaagttgagccgTTTGACTATGTGATATT TAaccaatttctttcttttctttatcaGGGTGTTCAGCAAAGTGAAAAGT CGATCAGCGCACATGAAAACTCACGTTAAGAGGGACGAGAACAATAAACC TATCAAATCAGCGAAAGCCACTGCAAAGCAAAAGCAAaaacaactacaac aacaacaacgacagcagcagcagcagcagcagCAACTTCAACAACAATTT GGTGAACATTCAATGCCGCCCTACCCGCCGCAACCGACACACCCTGGTCC ACCCCAACCACCCTCAAATCTAAATCCAATGACTGTTTTTGCACATGCGT AAAGTTTATTTGTtatctttatttaattttcttttgttttttttaatatc catattaataatttttttattataaacatagaaaaaataatttaaattat tatatcttatatctttataattttttacacCACTCTTTTCATGAAAAGAT GCTTTTTATCCAACTTTAGTAGTCCCAAGATAAACCAAGCAAATAAATTA AAAcaatgctaaaattttcaatgaaagaaaattttttaatagaCAATTAT TTACAGTagcaaataattttaaattatttggaTTTTATTGATCacttttt tggttgtttttgtatattattttgaaatctatttgttttacttttttttg gtttttctatcCACTTACGACAACtcgtttaatattttaataattattat tttaaagggAAAAAGCTACGTGATATTATATTGTTAATTTTTGTGCTGCG CTTTTATTATTGTAAATTTTCGTAAATGAATCTATAGGAGTTTTTTTCTC TCAAGCAGCAGTATTTGTTTTAACAGTAGTTAGTTTGCAACATTCCTATA AGAGTGAAACCAAGAAAGTCATTTTTCATACCTCACCAAAGTcactaaaa ttttcttttcagtgTTTTACAAGCCGTTTTGTGATAAGTAATTGAGATGA GCAAATTTATTCGTGACTAACGCTAAACAAACTAAATATTATGTTTTTGG TCTTTGTGAATGAACCATTCGTCCGGCATCGCGCCTTTAAGGAAACATAA ATGCTTAGTTTTTTGTCAGTGAATGTtatggaaaaaagataatagatACA TTTTTCGCGACACTTATTGTATTATATAcattattaaaaattattttacg aGTAAAAATATAGTAATAATTATTAATTAATGACGATACTCTTAAACTGT CATCTTGGTTCATCT

Coding sequence (CDS) from alignment at scaffold_90:54729..81843+

>TCONS_00073349 ID=TCONS_00073349|Name=TCONS_00073349|organism=Clytia hemisphaerica|type=CDS|length=26664bp|location=Sequence derived from alignment at scaffold_90:54729..81843+ (Clytia hemisphaerica)
ATGCCTTATTTATTGAACATTAGAAACCCATTCGGTCTTTCACCTCATGG
GGCTTACCCTTCTCAACAGAATgaagaattctcaaaaatatctaaaaGTG
AGGCTGAAGCAAGGCATCAAGCTGTCAGCACTTATCTTCAAATGTGGGCA
AGTGGGCAACATAATATGCCTCCTGAACAGATTTTTAGTATGTTTCCTGG
AGGTCGTGGAGGACCACCCAGGGGTAATCATCGTACAAACCACCCACAGA
CTCCTACTGATGCTATCGCGATTGCAGTAGCTGCAGCCAAGGAACCGAAT
GACAGACATCCTTATGCAGGCAGAGATGGGATTTATGGGATTCATCCAGC
GAATGCTAAATGGCAATCTGTTATGCAAGATGACTCGATTACAATGGAGA
AAGATTCTAAAGTGAATAGCTACTACCATAACACACAAGGCAATGTTCAT
GACAATTACGCGAAACGCCCCACACCAACCAAAGAACGAAATATCATCGA
CGAACCGTTTAAACCCAGTGAAAGTAACCAcaaatatcaaaacaataata
acaacaataacATTAATCGATTTTTCGATCGTCCAGCTCCTCATCTGGAC
CCACTTAAAGGTCGTGAATATGCGCATCCCTCGCATGTCTACGAAAATAA
ACGTCGTGAATTAGACTCGAAAGTCTTCGATACTTCAAGGCATCCTGCTT
TATCGTCAACTAGAGATCATTCACCTCATCGCTACGATCCACGATACCCT
ACATCAAGAGACGAGCTTAATAATAGACTATCGGAACCACCTCATTTAAG
AGTTGAAACTGCGGAAGGATTAGCTAGCGGTTCAGCTCTTTCTCCAAACA
GAAAACGTCCACGACCTGGACCTATTATAATACCTCCGGCTGTTAACAAC
CGGTCAATACCAACCACCATCTCTCCTTCTCGTCATTTCGCTGCGTTTCC
GAAAGGAATTTACACTCCACCTGCCATGTTGAGTCCGCGAAGTATTTTCT
TTAATCCACCCTTCAATGCACCGAGACACCATCCCAACGCCCCACATACG
CCAGGGCGAATGCAGTTATCCAAAAGGCGTTCTTCGAGTTTCAACGAACC
ACAACCTCTCAACACATCTCAACAACAACTCCAACTAAAACAACTCGAAC
AACAACAAATTCAACAACAGCAGCAATCTGTTGTACAGCAAACGCCGAAA
CAAACAACACCTGTCTCTGCTGAACCTTCTACTGTGACACCCACAAACGA
AGAGGAAATAAACGTTACAACTGTCGCTTCTGACCCAACTGAACCGAAAA
TCAATGTTGGGCCAGAGTTTCAAGCAGTTCTTCCTCATGTTTTAAATCGA
ACGGAAGCACAGAAAGACAGTCACCGTGCATCTCTGATGTGGTCACCTCT
CAAAGAAGATGaacaaaagcaaaaagaagTTGAAGCTTACTTAGACATGG
CTTGTTCTCTCGTCTTATACGGTGGATCGAACAATAAAGAATATGCTTTA
CATATCTTACAAAGGACACGTGGTAATGTCAAGGAAGCTGTAAGGCTGCT
TCTTTCACGGAGACATATTCTACGAGCAGACGATCCCAATGCAGATTATC
ATTACTCCGGATCAGTACGCTGGACGGCCAAAGAAAGGCTTGCATTCAGG
CAAGCTTACAGATCGAAAGGCAAAATCTTCATGGGTATTCAAAAAGAGGT
TGAAACGAAGTCTGTACAACAATGCGTGGAGTTCTATTACCTTTGGAAAG
CAATGCATCCTGAGAGCTTTCGAGCTCGCACGCGAATGGTTGAAGTGGAA
TCAGAGCAGGACGACGAAGAAGTTCCTCCAACTCCAACAGCAGCTGTTGC
ACCGCTATCCACTCTTCGTGAACCTGTATTCGAATGTGATTATCCTGAAT
GTCGGGCACGCTTTGTTTCCAGACAAGCGCTCAATGGTCATATTCGAGTT
CATGGTGGAAGTTTTACAAAACCATCGGATACGCGACGAGCAAAAACGAA
AGCAGCAGATGGCTCCTCACCTCGTCCTCCCGGTGATGGCTTACCAAGTC
CGCCCAAGAAAAAGAAAGTGGCGGCGCCCGACCCCTCCATTATCATCACG
AACACGAGTGAAGGCCCTCAACAGCAGTTCCAATGTAAAGTGTGTGGAAG
GGTGTTCAGCAAAGTGAAAAGTCGATCAGCGCACATGAAAACTCACGTTA
AGAGGGACGAGAACAATAAACCTATCAAATCAGCGAAAGCCACTGCAAAG
CAAAAGCAAaaacaactacaacaacaacaacgacagcagcagcagcagca
gcagCAACTTCAACAACAATTTGGTGAACATTCAATGCCGCCCTACCCGC
CGCAACCGACACACCCTGGTCCACCCCAACCACCCTCAAATCTAAATCCA
ATGACTGTTTTTGCACATGCGTAAATGCCTTATTTATTGAACATTAGAAA
CCCATTCGGTCTTTCACCTCATGGGGCTTACCCTTCTCAACAGAATgaag
aattctcaaaaatatctaaaaGTGAGGCTGAAGCAAGGCATCAAGCTGTC
AGCACTTATCTTCAAATGTGGGCAAGTGGGCAACATAATATGCCTCCTGA
ACAGATTTTTAGTATGTTTCCTGGAGGTCGTGGAGGACCACCCAGGGGTA
ATCATCGTACAAACCACCCACAGACTCCTACTGATGCTATCGCGATTGCA
GTAGCTGCAGCCAAGGAACCGAATGACAGACATCCTTATGCAGGCAGAGA
TGGGATTTATGGGATTCATCCAGCGAATGCTAAATGGCAATCTGTTATGC
AAGATGACTCGATTACAATGGAGAAAGATTCTAAAGTGAATAGCTACTAC
CATAACACACAAGGCAATGTTCATGACAATTACGCGAAACGCCCCACACC
AACCAAAGAACGAAATATCATCGACGAACCGTTTAAACCCAGTGAAAGTA
ACCAcaaatatcaaaacaataataacaacaataacATTAATCGATTTTTC
GATCGTCCAGCTCCTCATCTGGACCCACTTAAAGGTCGTGAATATGCGCA
TCCCTCGCATGTCTACGAAAATAAACGTCGTGAATTAGACTCGAAAGTCT
TCGATACTTCAAGGCATCCTGCTTTATCGTCAACTAGAGATCATTCACCT
CATCGCTACGATCCACGATACCCTACATCAAGAGACGAGCTTAATAATAG
ACTATCGGAACCACCTCATTTAAGAGTTGAAACTGCGGAAGGATTAGCTA
GCGGTTCAGCTCTTTCTCCAAACAGAAAACGTCCACGACCTGGACCTATT
ATAATACCTCCGGCTGTTAACAACCGGTCAATACCAACCACCATCTCTCC
TTCTCGTCATTTCGCTGCGTTTCCGAAAGGAATTTACACTCCACCTGCCA
TGTTGAGTCCGCGAAGTATTTTCTTTAATCCACCCTTCAATGCACCGAGA
CACCATCCCAACGCCCCACATACGCCAGGGCGAATGCAGTTATCCAAAAG
GCGTTCTTCGAGTTTCAACGAACCACAACCTCTCAACACATCTCAACAAC
AACTCCAACTAAAACAACTCGAACAACAACAAATTCAACAACAGCAGCAA
TCTGTTGTACAGCAAACGCCGAAACAAACAACACCTGTCTCTGCTGAACC
TTCTACTGTGACACCCACAAACGAAGAGGAAATAAACGTTACAACTGTCG
CTTCTGACCCAACTGAACCGAAAATCAATGTTGGGCCAGAGTTTCAAGCA
GTTCTTCCTCATGTTTTAAATCGAACGGAAGCACAGAAAGACAGTCACCG
TGCATCTCTGATGTGGTCACCTCTCAAAGAAGATGaacaaaagcaaaaag
aagTTGAAGCTTACTTAGACATGGCTTGTTCTCTCGTCTTATACGGTGGA
TCGAACAATAAAGAATATGCTTTACATATCTTACAAAGGACACGTGGTAA
TGTCAAGGAAGCTGTAAGGCTGCTTCTTTCACGGAGACATATTCTACGAG
CAGACGATCCCAATGCAGATTATCATTACTCCGGATCAGTACGCTGGACG
GCCAAAGAAAGGCTTGCATTCAGGCAAGCTTACAGATCGAAAGGCAAAAT
CTTCATGGGTATTCAAAAAGAGGTTGAAACGAAGTCTGTACAACAATGCG
TGGAGTTCTATTACCTTTGGAAAGCAATGCATCCTGAGAGCTTTCGAGCT
CGCACGCGAATGGTTGAAGTGGAATCAGAGCAGGACGACGAAGAAGTTCC
TCCAACTCCAACAGCAGCTGTTGCACCGCTATCCACTCTTCGTGAACCTG
TATTCGAATGTGATTATCCTGAATGTCGGGCACGCTTTGTTTCCAGACAA
GCGCTCAATGGTCATATTCGAGTTCATGGTGGAAGTTTTACAAAACCATC
GGATACGCGACGAGCAAAAACGAAAGCAGCAGATGGCTCCTCACCTCGTC
CTCCCGGTGATGGCTTACCAAGTCCGCCCAAGAAAAAGAAAGTGGCGGCG
CCCGACCCCTCCATTATCATCACGAACACGAGTGAAGGCCCTCAACAGCA
GTTCCAATGTAAAGTGTGTGGAAGGGTGTTCAGCAAAGTGAAAAGTCGAT
CAGCGCACATGAAAACTCACGTTAAGAGGGACGAGAACAATAAACCTATC
AAATCAGCGAAAGCCACTGCAAAGCAAAAGCAAaaacaactacaacaaca
acaacgacagcagcagcagcagcagcagCAACTTCAACAACAATTTGGTG
AACATTCAATGCCGCCCTACCCGCCGCAACCGACACACCCTGGTCCACCC
CAACCACCCTCAAATCTAAATCCAATGACTGTTTTTGCACATGCGTAAAT
GCCTTATTTATTGAACATTAGAAACCCATTCGGTCTTTCACCTCATGGGG
CTTACCCTTCTCAACAGAATgaagaattctcaaaaatatctaaaaGTGAG
GCTGAAGCAAGGCATCAAGCTGTCAGCACTTATCTTCAAATGTGGGCAAG
TGGGCAACATAATATGCCTCCTGAACAGATTTTTAGTATGTTTCCTGGAG
GTCGTGGAGGACCACCCAGGGGTAATCATCGTACAAACCACCCACAGACT
CCTACTGATGCTATCGCGATTGCAGTAGCTGCAGCCAAGGAACCGAATGA
CAGACATCCTTATGCAGGCAGAGATGGGATTTATGGGATTCATCCAGCGA
ATGCTAAATGGCAATCTGTTATGCAAGATGACTCGATTACAATGGAGAAA
GATTCTAAAGTGAATAGCTACTACCATAACACACAAGGCAATGTTCATGA
CAATTACGCGAAACGCCCCACACCAACCAAAGAACGAAATATCATCGACG
AACCGTTTAAACCCAGTGAAAGTAACCAcaaatatcaaaacaataataac
aacaataacATTAATCGATTTTTCGATCGTCCAGCTCCTCATCTGGACCC
ACTTAAAGGTCGTGAATATGCGCATCCCTCGCATGTCTACGAAAATAAAC
GTCGTGAATTAGACTCGAAAGTCTTCGATACTTCAAGGCATCCTGCTTTA
TCGTCAACTAGAGATCATTCACCTCATCGCTACGATCCACGATACCCTAC
ATCAAGAGACGAGCTTAATAATAGACTATCGGAACCACCTCATTTAAGAG
TTGAAACTGCGGAAGGATTAGCTAGCGGTTCAGCTCTTTCTCCAAACAGA
AAACGTCCACGACCTGGACCTATTATAATACCTCCGGCTGTTAACAACCG
GTCAATACCAACCACCATCTCTCCTTCTCGTCATTTCGCTGCGTTTCCGA
AAGGAATTTACACTCCACCTGCCATGTTGAGTCCGCGAAGTATTTTCTTT
AATCCACCCTTCAATGCACCGAGACACCATCCCAACGCCCCACATACGCC
AGGGCGAATGCAGTTATCCAAAAGGCGTTCTTCGAGTTTCAACGAACCAC
AACCTCTCAACACATCTCAACAACAACTCCAACTAAAACAACTCGAACAA
CAACAAATTCAACAACAGCAGCAATCTGTTGTACAGCAAACGCCGAAACA
AACAACACCTGTCTCTGCTGAACCTTCTACTGTGACACCCACAAACGAAG
AGGAAATAAACGTTACAACTGTCGCTTCTGACCCAACTGAACCGAAAATC
AATGTTGGGCCAGAGTTTCAAGCAGTTCTTCCTCATGTTTTAAATCGAAC
GGAAGCACAGAAAGACAGTCACCGTGCATCTCTGATGTGGTCACCTCTCA
AAGAAGATGaacaaaagcaaaaagaagTTGAAGCTTACTTAGACATGGCT
TGTTCTCTCGTCTTATACGGTGGATCGAACAATAAAGAATATGCTTTACA
TATCTTACAAAGGACACGTGGTAATGTCAAGGAAGCTGTAAGGCTGCTTC
TTTCACGGAGACATATTCTACGAGCAGACGATCCCAATGCAGATTATCAT
TACTCCGGATCAGTACGCTGGACGGCCAAAGAAAGGCTTGCATTCAGGCA
AGCTTACAGATCGAAAGGCAAAATCTTCATGGGTATTCAAAAAGAGGTTG
AAACGAAGTCTGTACAACAATGCGTGGAGTTCTATTACCTTTGGAAAGCA
ATGCATCCTGAGAGCTTTCGAGCTCGCACGCGAATGGTTGAAGTGGAATC
AGAGCAGGACGACGAAGAAGTTCCTCCAACTCCAACAGCAGCTGTTGCAC
CGCTATCCACTCTTCGTGAACCTGTATTCGAATGTGATTATCCTGAATGT
CGGGCACGCTTTGTTTCCAGACAAGCGCTCAATGGTCATATTCGAGTTCA
TGGTGGAAGTTTTACAAAACCATCGGATACGCGACGAGCAAAAACGAAAG
CAGCAGATGGCTCCTCACCTCGTCCTCCCGGTGATGGCTTACCAAGTCCG
CCCAAGAAAAAGAAAGTGGCGGCGCCCGACCCCTCCATTATCATCACGAA
CACGAGTGAAGGCCCTCAACAGCAGTTCCAATGTAAAGTGTGTGGAAGGG
TGTTCAGCAAAGTGAAAAGTCGATCAGCGCACATGAAAACTCACGTTAAG
AGGGACGAGAACAATAAACCTATCAAATCAGCGAAAGCCACTGCAAAGCA
AAAGCAAaaacaactacaacaacaacaacgacagcagcagcagcagcagc
agCAACTTCAACAACAATTTGGTGAACATTCAATGCCGCCCTACCCGCCG
CAACCGACACACCCTGGTCCACCCCAACCACCCTCAAATCTAAATCCAAT
GACTGTTTTTGCACATGCGTAAATGCCTTATTTATTGAACATTAGAAACC
CATTCGGTCTTTCACCTCATGGGGCTTACCCTTCTCAACAGAATgaagaa
ttctcaaaaatatctaaaaGTGAGGCTGAAGCAAGGCATCAAGCTGTCAG
CACTTATCTTCAAATGTGGGCAAGTGGGCAACATAATATGCCTCCTGAAC
AGATTTTTAGTATGTTTCCTGGAGGTCGTGGAGGACCACCCAGGGGTAAT
CATCGTACAAACCACCCACAGACTCCTACTGATGCTATCGCGATTGCAGT
AGCTGCAGCCAAGGAACCGAATGACAGACATCCTTATGCAGGCAGAGATG
GGATTTATGGGATTCATCCAGCGAATGCTAAATGGCAATCTGTTATGCAA
GATGACTCGATTACAATGGAGAAAGATTCTAAAGTGAATAGCTACTACCA
TAACACACAAGGCAATGTTCATGACAATTACGCGAAACGCCCCACACCAA
CCAAAGAACGAAATATCATCGACGAACCGTTTAAACCCAGTGAAAGTAAC
CAcaaatatcaaaacaataataacaacaataacATTAATCGATTTTTCGA
TCGTCCAGCTCCTCATCTGGACCCACTTAAAGGTCGTGAATATGCGCATC
CCTCGCATGTCTACGAAAATAAACGTCGTGAATTAGACTCGAAAGTCTTC
GATACTTCAAGGCATCCTGCTTTATCGTCAACTAGAGATCATTCACCTCA
TCGCTACGATCCACGATACCCTACATCAAGAGACGAGCTTAATAATAGAC
TATCGGAACCACCTCATTTAAGAGTTGAAACTGCGGAAGGATTAGCTAGC
GGTTCAGCTCTTTCTCCAAACAGAAAACGTCCACGACCTGGACCTATTAT
AATACCTCCGGCTGTTAACAACCGGTCAATACCAACCACCATCTCTCCTT
CTCGTCATTTCGCTGCGTTTCCGAAAGGAATTTACACTCCACCTGCCATG
TTGAGTCCGCGAAGTATTTTCTTTAATCCACCCTTCAATGCACCGAGACA
CCATCCCAACGCCCCACATACGCCAGGGCGAATGCAGTTATCCAAAAGGC
GTTCTTCGAGTTTCAACGAACCACAACCTCTCAACACATCTCAACAACAA
CTCCAACTAAAACAACTCGAACAACAACAAATTCAACAACAGCAGCAATC
TGTTGTACAGCAAACGCCGAAACAAACAACACCTGTCTCTGCTGAACCTT
CTACTGTGACACCCACAAACGAAGAGGAAATAAACGTTACAACTGTCGCT
TCTGACCCAACTGAACCGAAAATCAATGTTGGGCCAGAGTTTCAAGCAGT
TCTTCCTCATGTTTTAAATCGAACGGAAGCACAGAAAGACAGTCACCGTG
CATCTCTGATGTGGTCACCTCTCAAAGAAGATGaacaaaagcaaaaagaa
gTTGAAGCTTACTTAGACATGGCTTGTTCTCTCGTCTTATACGGTGGATC
GAACAATAAAGAATATGCTTTACATATCTTACAAAGGACACGTGGTAATG
TCAAGGAAGCTGTAAGGCTGCTTCTTTCACGGAGACATATTCTACGAGCA
GACGATCCCAATGCAGATTATCATTACTCCGGATCAGTACGCTGGACGGC
CAAAGAAAGGCTTGCATTCAGGCAAGCTTACAGATCGAAAGGCAAAATCT
TCATGGGTATTCAAAAAGAGGTTGAAACGAAGTCTGTACAACAATGCGTG
GAGTTCTATTACCTTTGGAAAGCAATGCATCCTGAGAGCTTTCGAGCTCG
CACGCGAATGGTTGAAGTGGAATCAGAGCAGGACGACGAAGAAGTTCCTC
CAACTCCAACAGCAGCTGTTGCACCGCTATCCACTCTTCGTGAACCTGTA
TTCGAATGTGATTATCCTGAATGTCGGGCACGCTTTGTTTCCAGACAAGC
GCTCAATGGTCATATTCGAGTTCATGGTGGAAGTTTTACAAAACCATCGG
ATACGCGACGAGCAAAAACGAAAGCAGCAGATGGCTCCTCACCTCGTCCT
CCCGGTGATGGCTTACCAAGTCCGCCCAAGAAAAAGAAAGTGGCGGCGCC
CGACCCCTCCATTATCATCACGAACACGAGTGAAGGCCCTCAACAGCAGT
TCCAATGTAAAGTGTGTGGAAGGGTGTTCAGCAAAGTGAAAAGTCGATCA
GCGCACATGAAAACTCACGTTAAGAGGGACGAGAACAATAAACCTATCAA
ATCAGCGAAAGCCACTGCAAAGCAAAAGCAAaaacaactacaacaacaac
aacgacagcagcagcagcagcagcagCAACTTCAACAACAATTTGGTGAA
CATTCAATGCCGCCCTACCCGCCGCAACCGACACACCCTGGTCCACCCCA
ACCACCCTCAAATCTAAATCCAATGACTGTTTTTGCACATGCGTAAATGC
CTTATTTATTGAACATTAGAAACCCATTCGGTCTTTCACCTCATGGGGCT
TACCCTTCTCAACAGAATgaagaattctcaaaaatatctaaaaGTGAGGC
TGAAGCAAGGCATCAAGCTGTCAGCACTTATCTTCAAATGTGGGCAAGTG
GGCAACATAATATGCCTCCTGAACAGATTTTTAGTATGTTTCCTGGAGGT
CGTGGAGGACCACCCAGGGGTAATCATCGTACAAACCACCCACAGACTCC
TACTGATGCTATCGCGATTGCAGTAGCTGCAGCCAAGGAACCGAATGACA
GACATCCTTATGCAGGCAGAGATGGGATTTATGGGATTCATCCAGCGAAT
GCTAAATGGCAATCTGTTATGCAAGATGACTCGATTACAATGGAGAAAGA
TTCTAAAGTGAATAGCTACTACCATAACACACAAGGCAATGTTCATGACA
ATTACGCGAAACGCCCCACACCAACCAAAGAACGAAATATCATCGACGAA
CCGTTTAAACCCAGTGAAAGTAACCAcaaatatcaaaacaataataacaa
caataacATTAATCGATTTTTCGATCGTCCAGCTCCTCATCTGGACCCAC
TTAAAGGTCGTGAATATGCGCATCCCTCGCATGTCTACGAAAATAAACGT
CGTGAATTAGACTCGAAAGTCTTCGATACTTCAAGGCATCCTGCTTTATC
GTCAACTAGAGATCATTCACCTCATCGCTACGATCCACGATACCCTACAT
CAAGAGACGAGCTTAATAATAGACTATCGGAACCACCTCATTTAAGAGTT
GAAACTGCGGAAGGATTAGCTAGCGGTTCAGCTCTTTCTCCAAACAGAAA
ACGTCCACGACCTGGACCTATTATAATACCTCCGGCTGTTAACAACCGGT
CAATACCAACCACCATCTCTCCTTCTCGTCATTTCGCTGCGTTTCCGAAA
GGAATTTACACTCCACCTGCCATGTTGAGTCCGCGAAGTATTTTCTTTAA
TCCACCCTTCAATGCACCGAGACACCATCCCAACGCCCCACATACGCCAG
GGCGAATGCAGTTATCCAAAAGGCGTTCTTCGAGTTTCAACGAACCACAA
CCTCTCAACACATCTCAACAACAACTCCAACTAAAACAACTCGAACAACA
ACAAATTCAACAACAGCAGCAATCTGTTGTACAGCAAACGCCGAAACAAA
CAACACCTGTCTCTGCTGAACCTTCTACTGTGACACCCACAAACGAAGAG
GAAATAAACGTTACAACTGTCGCTTCTGACCCAACTGAACCGAAAATCAA
TGTTGGGCCAGAGTTTCAAGCAGTTCTTCCTCATGTTTTAAATCGAACGG
AAGCACAGAAAGACAGTCACCGTGCATCTCTGATGTGGTCACCTCTCAAA
GAAGATGaacaaaagcaaaaagaagTTGAAGCTTACTTAGACATGGCTTG
TTCTCTCGTCTTATACGGTGGATCGAACAATAAAGAATATGCTTTACATA
TCTTACAAAGGACACGTGGTAATGTCAAGGAAGCTGTAAGGCTGCTTCTT
TCACGGAGACATATTCTACGAGCAGACGATCCCAATGCAGATTATCATTA
CTCCGGATCAGTACGCTGGACGGCCAAAGAAAGGCTTGCATTCAGGCAAG
CTTACAGATCGAAAGGCAAAATCTTCATGGGTATTCAAAAAGAGGTTGAA
ACGAAGTCTGTACAACAATGCGTGGAGTTCTATTACCTTTGGAAAGCAAT
GCATCCTGAGAGCTTTCGAGCTCGCACGCGAATGGTTGAAGTGGAATCAG
AGCAGGACGACGAAGAAGTTCCTCCAACTCCAACAGCAGCTGTTGCACCG
CTATCCACTCTTCGTGAACCTGTATTCGAATGTGATTATCCTGAATGTCG
GGCACGCTTTGTTTCCAGACAAGCGCTCAATGGTCATATTCGAGTTCATG
GTGGAAGTTTTACAAAACCATCGGATACGCGACGAGCAAAAACGAAAGCA
GCAGATGGCTCCTCACCTCGTCCTCCCGGTGATGGCTTACCAAGTCCGCC
CAAGAAAAAGAAAGTGGCGGCGCCCGACCCCTCCATTATCATCACGAACA
CGAGTGAAGGCCCTCAACAGCAGTTCCAATGTAAAGTGTGTGGAAGGGTG
TTCAGCAAAGTGAAAAGTCGATCAGCGCACATGAAAACTCACGTTAAGAG
GGACGAGAACAATAAACCTATCAAATCAGCGAAAGCCACTGCAAAGCAAA
AGCAAaaacaactacaacaacaacaacgacagcagcagcagcagcagcag
CAACTTCAACAACAATTTGGTGAACATTCAATGCCGCCCTACCCGCCGCA
ACCGACACACCCTGGTCCACCCCAACCACCCTCAAATCTAAATCCAATGA
CTGTTTTTGCACATGCGTAAATGCCTTATTTATTGAACATTAGAAACCCA
TTCGGTCTTTCACCTCATGGGGCTTACCCTTCTCAACAGAATgaagaatt
ctcaaaaatatctaaaaGTGAGGCTGAAGCAAGGCATCAAGCTGTCAGCA
CTTATCTTCAAATGTGGGCAAGTGGGCAACATAATATGCCTCCTGAACAG
ATTTTTAGTATGTTTCCTGGAGGTCGTGGAGGACCACCCAGGGGTAATCA
TCGTACAAACCACCCACAGACTCCTACTGATGCTATCGCGATTGCAGTAG
CTGCAGCCAAGGAACCGAATGACAGACATCCTTATGCAGGCAGAGATGGG
ATTTATGGGATTCATCCAGCGAATGCTAAATGGCAATCTGTTATGCAAGA
TGACTCGATTACAATGGAGAAAGATTCTAAAGTGAATAGCTACTACCATA
ACACACAAGGCAATGTTCATGACAATTACGCGAAACGCCCCACACCAACC
AAAGAACGAAATATCATCGACGAACCGTTTAAACCCAGTGAAAGTAACCA
caaatatcaaaacaataataacaacaataacATTAATCGATTTTTCGATC
GTCCAGCTCCTCATCTGGACCCACTTAAAGGTCGTGAATATGCGCATCCC
TCGCATGTCTACGAAAATAAACGTCGTGAATTAGACTCGAAAGTCTTCGA
TACTTCAAGGCATCCTGCTTTATCGTCAACTAGAGATCATTCACCTCATC
GCTACGATCCACGATACCCTACATCAAGAGACGAGCTTAATAATAGACTA
TCGGAACCACCTCATTTAAGAGTTGAAACTGCGGAAGGATTAGCTAGCGG
TTCAGCTCTTTCTCCAAACAGAAAACGTCCACGACCTGGACCTATTATAA
TACCTCCGGCTGTTAACAACCGGTCAATACCAACCACCATCTCTCCTTCT
CGTCATTTCGCTGCGTTTCCGAAAGGAATTTACACTCCACCTGCCATGTT
GAGTCCGCGAAGTATTTTCTTTAATCCACCCTTCAATGCACCGAGACACC
ATCCCAACGCCCCACATACGCCAGGGCGAATGCAGTTATCCAAAAGGCGT
TCTTCGAGTTTCAACGAACCACAACCTCTCAACACATCTCAACAACAACT
CCAACTAAAACAACTCGAACAACAACAAATTCAACAACAGCAGCAATCTG
TTGTACAGCAAACGCCGAAACAAACAACACCTGTCTCTGCTGAACCTTCT
ACTGTGACACCCACAAACGAAGAGGAAATAAACGTTACAACTGTCGCTTC
TGACCCAACTGAACCGAAAATCAATGTTGGGCCAGAGTTTCAAGCAGTTC
TTCCTCATGTTTTAAATCGAACGGAAGCACAGAAAGACAGTCACCGTGCA
TCTCTGATGTGGTCACCTCTCAAAGAAGATGaacaaaagcaaaaagaagT
TGAAGCTTACTTAGACATGGCTTGTTCTCTCGTCTTATACGGTGGATCGA
ACAATAAAGAATATGCTTTACATATCTTACAAAGGACACGTGGTAATGTC
AAGGAAGCTGTAAGGCTGCTTCTTTCACGGAGACATATTCTACGAGCAGA
CGATCCCAATGCAGATTATCATTACTCCGGATCAGTACGCTGGACGGCCA
AAGAAAGGCTTGCATTCAGGCAAGCTTACAGATCGAAAGGCAAAATCTTC
ATGGGTATTCAAAAAGAGGTTGAAACGAAGTCTGTACAACAATGCGTGGA
GTTCTATTACCTTTGGAAAGCAATGCATCCTGAGAGCTTTCGAGCTCGCA
CGCGAATGGTTGAAGTGGAATCAGAGCAGGACGACGAAGAAGTTCCTCCA
ACTCCAACAGCAGCTGTTGCACCGCTATCCACTCTTCGTGAACCTGTATT
CGAATGTGATTATCCTGAATGTCGGGCACGCTTTGTTTCCAGACAAGCGC
TCAATGGTCATATTCGAGTTCATGGTGGAAGTTTTACAAAACCATCGGAT
ACGCGACGAGCAAAAACGAAAGCAGCAGATGGCTCCTCACCTCGTCCTCC
CGGTGATGGCTTACCAAGTCCGCCCAAGAAAAAGAAAGTGGCGGCGCCCG
ACCCCTCCATTATCATCACGAACACGAGTGAAGGCCCTCAACAGCAGTTC
CAATGTAAAGTGTGTGGAAGGGTGTTCAGCAAAGTGAAAAGTCGATCAGC
GCACATGAAAACTCACGTTAAGAGGGACGAGAACAATAAACCTATCAAAT
CAGCGAAAGCCACTGCAAAGCAAAAGCAAaaacaactacaacaacaacaa
cgacagcagcagcagcagcagcagCAACTTCAACAACAATTTGGTGAACA
TTCAATGCCGCCCTACCCGCCGCAACCGACACACCCTGGTCCACCCCAAC
CACCCTCAAATCTAAATCCAATGACTGTTTTTGCACATGCGTAAATGCCT
TATTTATTGAACATTAGAAACCCATTCGGTCTTTCACCTCATGGGGCTTA
CCCTTCTCAACAGAATgaagaattctcaaaaatatctaaaaGTGAGGCTG
AAGCAAGGCATCAAGCTGTCAGCACTTATCTTCAAATGTGGGCAAGTGGG
CAACATAATATGCCTCCTGAACAGATTTTTAGTATGTTTCCTGGAGGTCG
TGGAGGACCACCCAGGGGTAATCATCGTACAAACCACCCACAGACTCCTA
CTGATGCTATCGCGATTGCAGTAGCTGCAGCCAAGGAACCGAATGACAGA
CATCCTTATGCAGGCAGAGATGGGATTTATGGGATTCATCCAGCGAATGC
TAAATGGCAATCTGTTATGCAAGATGACTCGATTACAATGGAGAAAGATT
CTAAAGTGAATAGCTACTACCATAACACACAAGGCAATGTTCATGACAAT
TACGCGAAACGCCCCACACCAACCAAAGAACGAAATATCATCGACGAACC
GTTTAAACCCAGTGAAAGTAACCAcaaatatcaaaacaataataacaaca
ataacATTAATCGATTTTTCGATCGTCCAGCTCCTCATCTGGACCCACTT
AAAGGTCGTGAATATGCGCATCCCTCGCATGTCTACGAAAATAAACGTCG
TGAATTAGACTCGAAAGTCTTCGATACTTCAAGGCATCCTGCTTTATCGT
CAACTAGAGATCATTCACCTCATCGCTACGATCCACGATACCCTACATCA
AGAGACGAGCTTAATAATAGACTATCGGAACCACCTCATTTAAGAGTTGA
AACTGCGGAAGGATTAGCTAGCGGTTCAGCTCTTTCTCCAAACAGAAAAC
GTCCACGACCTGGACCTATTATAATACCTCCGGCTGTTAACAACCGGTCA
ATACCAACCACCATCTCTCCTTCTCGTCATTTCGCTGCGTTTCCGAAAGG
AATTTACACTCCACCTGCCATGTTGAGTCCGCGAAGTATTTTCTTTAATC
CACCCTTCAATGCACCGAGACACCATCCCAACGCCCCACATACGCCAGGG
CGAATGCAGTTATCCAAAAGGCGTTCTTCGAGTTTCAACGAACCACAACC
TCTCAACACATCTCAACAACAACTCCAACTAAAACAACTCGAACAACAAC
AAATTCAACAACAGCAGCAATCTGTTGTACAGCAAACGCCGAAACAAACA
ACACCTGTCTCTGCTGAACCTTCTACTGTGACACCCACAAACGAAGAGGA
AATAAACGTTACAACTGTCGCTTCTGACCCAACTGAACCGAAAATCAATG
TTGGGCCAGAGTTTCAAGCAGTTCTTCCTCATGTTTTAAATCGAACGGAA
GCACAGAAAGACAGTCACCGTGCATCTCTGATGTGGTCACCTCTCAAAGA
AGATGaacaaaagcaaaaagaagTTGAAGCTTACTTAGACATGGCTTGTT
CTCTCGTCTTATACGGTGGATCGAACAATAAAGAATATGCTTTACATATC
TTACAAAGGACACGTGGTAATGTCAAGGAAGCTGTAAGGCTGCTTCTTTC
ACGGAGACATATTCTACGAGCAGACGATCCCAATGCAGATTATCATTACT
CCGGATCAGTACGCTGGACGGCCAAAGAAAGGCTTGCATTCAGGCAAGCT
TACAGATCGAAAGGCAAAATCTTCATGGGTATTCAAAAAGAGGTTGAAAC
GAAGTCTGTACAACAATGCGTGGAGTTCTATTACCTTTGGAAAGCAATGC
ATCCTGAGAGCTTTCGAGCTCGCACGCGAATGGTTGAAGTGGAATCAGAG
CAGGACGACGAAGAAGTTCCTCCAACTCCAACAGCAGCTGTTGCACCGCT
ATCCACTCTTCGTGAACCTGTATTCGAATGTGATTATCCTGAATGTCGGG
CACGCTTTGTTTCCAGACAAGCGCTCAATGGTCATATTCGAGTTCATGGT
GGAAGTTTTACAAAACCATCGGATACGCGACGAGCAAAAACGAAAGCAGC
AGATGGCTCCTCACCTCGTCCTCCCGGTGATGGCTTACCAAGTCCGCCCA
AGAAAAAGAAAGTGGCGGCGCCCGACCCCTCCATTATCATCACGAACACG
AGTGAAGGCCCTCAACAGCAGTTCCAATGTAAAGTGTGTGGAAGGGTGTT
CAGCAAAGTGAAAAGTCGATCAGCGCACATGAAAACTCACGTTAAGAGGG
ACGAGAACAATAAACCTATCAAATCAGCGAAAGCCACTGCAAAGCAAAAG
CAAaaacaactacaacaacaacaacgacagcagcagcagcagcagcagCA
ACTTCAACAACAATTTGGTGAACATTCAATGCCGCCCTACCCGCCGCAAC
CGACACACCCTGGTCCACCCCAACCACCCTCAAATCTAAATCCAATGACT
GTTTTTGCACATGCGTAAATGCCTTATTTATTGAACATTAGAAACCCATT
CGGTCTTTCACCTCATGGGGCTTACCCTTCTCAACAGAATgaagaattct
caaaaatatctaaaaGTGAGGCTGAAGCAAGGCATCAAGCTGTCAGCACT
TATCTTCAAATGTGGGCAAGTGGGCAACATAATATGCCTCCTGAACAGAT
TTTTAGTATGTTTCCTGGAGGTCGTGGAGGACCACCCAGGGGTAATCATC
GTACAAACCACCCACAGACTCCTACTGATGCTATCGCGATTGCAGTAGCT
GCAGCCAAGGAACCGAATGACAGACATCCTTATGCAGGCAGAGATGGGAT
TTATGGGATTCATCCAGCGAATGCTAAATGGCAATCTGTTATGCAAGATG
ACTCGATTACAATGGAGAAAGATTCTAAAGTGAATAGCTACTACCATAAC
ACACAAGGCAATGTTCATGACAATTACGCGAAACGCCCCACACCAACCAA
AGAACGAAATATCATCGACGAACCGTTTAAACCCAGTGAAAGTAACCAca
aatatcaaaacaataataacaacaataacATTAATCGATTTTTCGATCGT
CCAGCTCCTCATCTGGACCCACTTAAAGGTCGTGAATATGCGCATCCCTC
GCATGTCTACGAAAATAAACGTCGTGAATTAGACTCGAAAGTCTTCGATA
CTTCAAGGCATCCTGCTTTATCGTCAACTAGAGATCATTCACCTCATCGC
TACGATCCACGATACCCTACATCAAGAGACGAGCTTAATAATAGACTATC
GGAACCACCTCATTTAAGAGTTGAAACTGCGGAAGGATTAGCTAGCGGTT
CAGCTCTTTCTCCAAACAGAAAACGTCCACGACCTGGACCTATTATAATA
CCTCCGGCTGTTAACAACCGGTCAATACCAACCACCATCTCTCCTTCTCG
TCATTTCGCTGCGTTTCCGAAAGGAATTTACACTCCACCTGCCATGTTGA
GTCCGCGAAGTATTTTCTTTAATCCACCCTTCAATGCACCGAGACACCAT
CCCAACGCCCCACATACGCCAGGGCGAATGCAGTTATCCAAAAGGCGTTC
TTCGAGTTTCAACGAACCACAACCTCTCAACACATCTCAACAACAACTCC
AACTAAAACAACTCGAACAACAACAAATTCAACAACAGCAGCAATCTGTT
GTACAGCAAACGCCGAAACAAACAACACCTGTCTCTGCTGAACCTTCTAC
TGTGACACCCACAAACGAAGAGGAAATAAACGTTACAACTGTCGCTTCTG
ACCCAACTGAACCGAAAATCAATGTTGGGCCAGAGTTTCAAGCAGTTCTT
CCTCATGTTTTAAATCGAACGGAAGCACAGAAAGACAGTCACCGTGCATC
TCTGATGTGGTCACCTCTCAAAGAAGATGaacaaaagcaaaaagaagTTG
AAGCTTACTTAGACATGGCTTGTTCTCTCGTCTTATACGGTGGATCGAAC
AATAAAGAATATGCTTTACATATCTTACAAAGGACACGTGGTAATGTCAA
GGAAGCTGTAAGGCTGCTTCTTTCACGGAGACATATTCTACGAGCAGACG
ATCCCAATGCAGATTATCATTACTCCGGATCAGTACGCTGGACGGCCAAA
GAAAGGCTTGCATTCAGGCAAGCTTACAGATCGAAAGGCAAAATCTTCAT
GGGTATTCAAAAAGAGGTTGAAACGAAGTCTGTACAACAATGCGTGGAGT
TCTATTACCTTTGGAAAGCAATGCATCCTGAGAGCTTTCGAGCTCGCACG
CGAATGGTTGAAGTGGAATCAGAGCAGGACGACGAAGAAGTTCCTCCAAC
TCCAACAGCAGCTGTTGCACCGCTATCCACTCTTCGTGAACCTGTATTCG
AATGTGATTATCCTGAATGTCGGGCACGCTTTGTTTCCAGACAAGCGCTC
AATGGTCATATTCGAGTTCATGGTGGAAGTTTTACAAAACCATCGGATAC
GCGACGAGCAAAAACGAAAGCAGCAGATGGCTCCTCACCTCGTCCTCCCG
GTGATGGCTTACCAAGTCCGCCCAAGAAAAAGAAAGTGGCGGCGCCCGAC
CCCTCCATTATCATCACGAACACGAGTGAAGGCCCTCAACAGCAGTTCCA
ATGTAAAGTGTGTGGAAGGGTGTTCAGCAAAGTGAAAAGTCGATCAGCGC
ACATGAAAACTCACGTTAAGAGGGACGAGAACAATAAACCTATCAAATCA
GCGAAAGCCACTGCAAAGCAAAAGCAAaaacaactacaacaacaacaacg
acagcagcagcagcagcagcagCAACTTCAACAACAATTTGGTGAACATT
CAATGCCGCCCTACCCGCCGCAACCGACACACCCTGGTCCACCCCAACCA
CCCTCAAATCTAAATCCAATGACTGTTTTTGCACATGCGTAAATGCCTTA
TTTATTGAACATTAGAAACCCATTCGGTCTTTCACCTCATGGGGCTTACC
CTTCTCAACAGAATgaagaattctcaaaaatatctaaaaGTGAGGCTGAA
GCAAGGCATCAAGCTGTCAGCACTTATCTTCAAATGTGGGCAAGTGGGCA
ACATAATATGCCTCCTGAACAGATTTTTAGTATGTTTCCTGGAGGTCGTG
GAGGACCACCCAGGGGTAATCATCGTACAAACCACCCACAGACTCCTACT
GATGCTATCGCGATTGCAGTAGCTGCAGCCAAGGAACCGAATGACAGACA
TCCTTATGCAGGCAGAGATGGGATTTATGGGATTCATCCAGCGAATGCTA
AATGGCAATCTGTTATGCAAGATGACTCGATTACAATGGAGAAAGATTCT
AAAGTGAATAGCTACTACCATAACACACAAGGCAATGTTCATGACAATTA
CGCGAAACGCCCCACACCAACCAAAGAACGAAATATCATCGACGAACCGT
TTAAACCCAGTGAAAGTAACCAcaaatatcaaaacaataataacaacaat
aacATTAATCGATTTTTCGATCGTCCAGCTCCTCATCTGGACCCACTTAA
AGGTCGTGAATATGCGCATCCCTCGCATGTCTACGAAAATAAACGTCGTG
AATTAGACTCGAAAGTCTTCGATACTTCAAGGCATCCTGCTTTATCGTCA
ACTAGAGATCATTCACCTCATCGCTACGATCCACGATACCCTACATCAAG
AGACGAGCTTAATAATAGACTATCGGAACCACCTCATTTAAGAGTTGAAA
CTGCGGAAGGATTAGCTAGCGGTTCAGCTCTTTCTCCAAACAGAAAACGT
CCACGACCTGGACCTATTATAATACCTCCGGCTGTTAACAACCGGTCAAT
ACCAACCACCATCTCTCCTTCTCGTCATTTCGCTGCGTTTCCGAAAGGAA
TTTACACTCCACCTGCCATGTTGAGTCCGCGAAGTATTTTCTTTAATCCA
CCCTTCAATGCACCGAGACACCATCCCAACGCCCCACATACGCCAGGGCG
AATGCAGTTATCCAAAAGGCGTTCTTCGAGTTTCAACGAACCACAACCTC
TCAACACATCTCAACAACAACTCCAACTAAAACAACTCGAACAACAACAA
ATTCAACAACAGCAGCAATCTGTTGTACAGCAAACGCCGAAACAAACAAC
ACCTGTCTCTGCTGAACCTTCTACTGTGACACCCACAAACGAAGAGGAAA
TAAACGTTACAACTGTCGCTTCTGACCCAACTGAACCGAAAATCAATGTT
GGGCCAGAGTTTCAAGCAGTTCTTCCTCATGTTTTAAATCGAACGGAAGC
ACAGAAAGACAGTCACCGTGCATCTCTGATGTGGTCACCTCTCAAAGAAG
ATGaacaaaagcaaaaagaagTTGAAGCTTACTTAGACATGGCTTGTTCT
CTCGTCTTATACGGTGGATCGAACAATAAAGAATATGCTTTACATATCTT
ACAAAGGACACGTGGTAATGTCAAGGAAGCTGTAAGGCTGCTTCTTTCAC
GGAGACATATTCTACGAGCAGACGATCCCAATGCAGATTATCATTACTCC
GGATCAGTACGCTGGACGGCCAAAGAAAGGCTTGCATTCAGGCAAGCTTA
CAGATCGAAAGGCAAAATCTTCATGGGTATTCAAAAAGAGGTTGAAACGA
AGTCTGTACAACAATGCGTGGAGTTCTATTACCTTTGGAAAGCAATGCAT
CCTGAGAGCTTTCGAGCTCGCACGCGAATGGTTGAAGTGGAATCAGAGCA
GGACGACGAAGAAGTTCCTCCAACTCCAACAGCAGCTGTTGCACCGCTAT
CCACTCTTCGTGAACCTGTATTCGAATGTGATTATCCTGAATGTCGGGCA
CGCTTTGTTTCCAGACAAGCGCTCAATGGTCATATTCGAGTTCATGGTGG
AAGTTTTACAAAACCATCGGATACGCGACGAGCAAAAACGAAAGCAGCAG
ATGGCTCCTCACCTCGTCCTCCCGGTGATGGCTTACCAAGTCCGCCCAAG
AAAAAGAAAGTGGCGGCGCCCGACCCCTCCATTATCATCACGAACACGAG
TGAAGGCCCTCAACAGCAGTTCCAATGTAAAGTGTGTGGAAGGGTGTTCA
GCAAAGTGAAAAGTCGATCAGCGCACATGAAAACTCACGTTAAGAGGGAC
GAGAACAATAAACCTATCAAATCAGCGAAAGCCACTGCAAAGCAAAAGCA
AaaacaactacaacaacaacaacgacagcagcagcagcagcagcagCAAC
TTCAACAACAATTTGGTGAACATTCAATGCCGCCCTACCCGCCGCAACCG
ACACACCCTGGTCCACCCCAACCACCCTCAAATCTAAATCCAATGACTGT
TTTTGCACATGCGTAAATGCCTTATTTATTGAACATTAGAAACCCATTCG
GTCTTTCACCTCATGGGGCTTACCCTTCTCAACAGAATgaagaattctca
aaaatatctaaaaGTGAGGCTGAAGCAAGGCATCAAGCTGTCAGCACTTA
TCTTCAAATGTGGGCAAGTGGGCAACATAATATGCCTCCTGAACAGATTT
TTAGTATGTTTCCTGGAGGTCGTGGAGGACCACCCAGGGGTAATCATCGT
ACAAACCACCCACAGACTCCTACTGATGCTATCGCGATTGCAGTAGCTGC
AGCCAAGGAACCGAATGACAGACATCCTTATGCAGGCAGAGATGGGATTT
ATGGGATTCATCCAGCGAATGCTAAATGGCAATCTGTTATGCAAGATGAC
TCGATTACAATGGAGAAAGATTCTAAAGTGAATAGCTACTACCATAACAC
ACAAGGCAATGTTCATGACAATTACGCGAAACGCCCCACACCAACCAAAG
AACGAAATATCATCGACGAACCGTTTAAACCCAGTGAAAGTAACCAcaaa
tatcaaaacaataataacaacaataacATTAATCGATTTTTCGATCGTCC
AGCTCCTCATCTGGACCCACTTAAAGGTCGTGAATATGCGCATCCCTCGC
ATGTCTACGAAAATAAACGTCGTGAATTAGACTCGAAAGTCTTCGATACT
TCAAGGCATCCTGCTTTATCGTCAACTAGAGATCATTCACCTCATCGCTA
CGATCCACGATACCCTACATCAAGAGACGAGCTTAATAATAGACTATCGG
AACCACCTCATTTAAGAGTTGAAACTGCGGAAGGATTAGCTAGCGGTTCA
GCTCTTTCTCCAAACAGAAAACGTCCACGACCTGGACCTATTATAATACC
TCCGGCTGTTAACAACCGGTCAATACCAACCACCATCTCTCCTTCTCGTC
ATTTCGCTGCGTTTCCGAAAGGAATTTACACTCCACCTGCCATGTTGAGT
CCGCGAAGTATTTTCTTTAATCCACCCTTCAATGCACCGAGACACCATCC
CAACGCCCCACATACGCCAGGGCGAATGCAGTTATCCAAAAGGCGTTCTT
CGAGTTTCAACGAACCACAACCTCTCAACACATCTCAACAACAACTCCAA
CTAAAACAACTCGAACAACAACAAATTCAACAACAGCAGCAATCTGTTGT
ACAGCAAACGCCGAAACAAACAACACCTGTCTCTGCTGAACCTTCTACTG
TGACACCCACAAACGAAGAGGAAATAAACGTTACAACTGTCGCTTCTGAC
CCAACTGAACCGAAAATCAATGTTGGGCCAGAGTTTCAAGCAGTTCTTCC
TCATGTTTTAAATCGAACGGAAGCACAGAAAGACAGTCACCGTGCATCTC
TGATGTGGTCACCTCTCAAAGAAGATGaacaaaagcaaaaagaagTTGAA
GCTTACTTAGACATGGCTTGTTCTCTCGTCTTATACGGTGGATCGAACAA
TAAAGAATATGCTTTACATATCTTACAAAGGACACGTGGTAATGTCAAGG
AAGCTGTAAGGCTGCTTCTTTCACGGAGACATATTCTACGAGCAGACGAT
CCCAATGCAGATTATCATTACTCCGGATCAGTACGCTGGACGGCCAAAGA
AAGGCTTGCATTCAGGCAAGCTTACAGATCGAAAGGCAAAATCTTCATGG
GTATTCAAAAAGAGGTTGAAACGAAGTCTGTACAACAATGCGTGGAGTTC
TATTACCTTTGGAAAGCAATGCATCCTGAGAGCTTTCGAGCTCGCACGCG
AATGGTTGAAGTGGAATCAGAGCAGGACGACGAAGAAGTTCCTCCAACTC
CAACAGCAGCTGTTGCACCGCTATCCACTCTTCGTGAACCTGTATTCGAA
TGTGATTATCCTGAATGTCGGGCACGCTTTGTTTCCAGACAAGCGCTCAA
TGGTCATATTCGAGTTCATGGTGGAAGTTTTACAAAACCATCGGATACGC
GACGAGCAAAAACGAAAGCAGCAGATGGCTCCTCACCTCGTCCTCCCGGT
GATGGCTTACCAAGTCCGCCCAAGAAAAAGAAAGTGGCGGCGCCCGACCC
CTCCATTATCATCACGAACACGAGTGAAGGCCCTCAACAGCAGTTCCAAT
GTAAAGTGTGTGGAAGGGTGTTCAGCAAAGTGAAAAGTCGATCAGCGCAC
ATGAAAACTCACGTTAAGAGGGACGAGAACAATAAACCTATCAAATCAGC
GAAAGCCACTGCAAAGCAAAAGCAAaaacaactacaacaacaacaacgac
agcagcagcagcagcagcagCAACTTCAACAACAATTTGGTGAACATTCA
ATGCCGCCCTACCCGCCGCAACCGACACACCCTGGTCCACCCCAACCACC
CTCAAATCTAAATCCAATGACTGTTTTTGCACATGCGTAAATGCCTTATT
TATTGAACATTAGAAACCCATTCGGTCTTTCACCTCATGGGGCTTACCCT
TCTCAACAGAATgaagaattctcaaaaatatctaaaaGTGAGGCTGAAGC
AAGGCATCAAGCTGTCAGCACTTATCTTCAAATGTGGGCAAGTGGGCAAC
ATAATATGCCTCCTGAACAGATTTTTAGTATGTTTCCTGGAGGTCGTGGA
GGACCACCCAGGGGTAATCATCGTACAAACCACCCACAGACTCCTACTGA
TGCTATCGCGATTGCAGTAGCTGCAGCCAAGGAACCGAATGACAGACATC
CTTATGCAGGCAGAGATGGGATTTATGGGATTCATCCAGCGAATGCTAAA
TGGCAATCTGTTATGCAAGATGACTCGATTACAATGGAGAAAGATTCTAA
AGTGAATAGCTACTACCATAACACACAAGGCAATGTTCATGACAATTACG
CGAAACGCCCCACACCAACCAAAGAACGAAATATCATCGACGAACCGTTT
AAACCCAGTGAAAGTAACCAcaaatatcaaaacaataataacaacaataa
cATTAATCGATTTTTCGATCGTCCAGCTCCTCATCTGGACCCACTTAAAG
GTCGTGAATATGCGCATCCCTCGCATGTCTACGAAAATAAACGTCGTGAA
TTAGACTCGAAAGTCTTCGATACTTCAAGGCATCCTGCTTTATCGTCAAC
TAGAGATCATTCACCTCATCGCTACGATCCACGATACCCTACATCAAGAG
ACGAGCTTAATAATAGACTATCGGAACCACCTCATTTAAGAGTTGAAACT
GCGGAAGGATTAGCTAGCGGTTCAGCTCTTTCTCCAAACAGAAAACGTCC
ACGACCTGGACCTATTATAATACCTCCGGCTGTTAACAACCGGTCAATAC
CAACCACCATCTCTCCTTCTCGTCATTTCGCTGCGTTTCCGAAAGGAATT
TACACTCCACCTGCCATGTTGAGTCCGCGAAGTATTTTCTTTAATCCACC
CTTCAATGCACCGAGACACCATCCCAACGCCCCACATACGCCAGGGCGAA
TGCAGTTATCCAAAAGGCGTTCTTCGAGTTTCAACGAACCACAACCTCTC
AACACATCTCAACAACAACTCCAACTAAAACAACTCGAACAACAACAAAT
TCAACAACAGCAGCAATCTGTTGTACAGCAAACGCCGAAACAAACAACAC
CTGTCTCTGCTGAACCTTCTACTGTGACACCCACAAACGAAGAGGAAATA
AACGTTACAACTGTCGCTTCTGACCCAACTGAACCGAAAATCAATGTTGG
GCCAGAGTTTCAAGCAGTTCTTCCTCATGTTTTAAATCGAACGGAAGCAC
AGAAAGACAGTCACCGTGCATCTCTGATGTGGTCACCTCTCAAAGAAGAT
GaacaaaagcaaaaagaagTTGAAGCTTACTTAGACATGGCTTGTTCTCT
CGTCTTATACGGTGGATCGAACAATAAAGAATATGCTTTACATATCTTAC
AAAGGACACGTGGTAATGTCAAGGAAGCTGTAAGGCTGCTTCTTTCACGG
AGACATATTCTACGAGCAGACGATCCCAATGCAGATTATCATTACTCCGG
ATCAGTACGCTGGACGGCCAAAGAAAGGCTTGCATTCAGGCAAGCTTACA
GATCGAAAGGCAAAATCTTCATGGGTATTCAAAAAGAGGTTGAAACGAAG
TCTGTACAACAATGCGTGGAGTTCTATTACCTTTGGAAAGCAATGCATCC
TGAGAGCTTTCGAGCTCGCACGCGAATGGTTGAAGTGGAATCAGAGCAGG
ACGACGAAGAAGTTCCTCCAACTCCAACAGCAGCTGTTGCACCGCTATCC
ACTCTTCGTGAACCTGTATTCGAATGTGATTATCCTGAATGTCGGGCACG
CTTTGTTTCCAGACAAGCGCTCAATGGTCATATTCGAGTTCATGGTGGAA
GTTTTACAAAACCATCGGATACGCGACGAGCAAAAACGAAAGCAGCAGAT
GGCTCCTCACCTCGTCCTCCCGGTGATGGCTTACCAAGTCCGCCCAAGAA
AAAGAAAGTGGCGGCGCCCGACCCCTCCATTATCATCACGAACACGAGTG
AAGGCCCTCAACAGCAGTTCCAATGTAAAGTGTGTGGAAGGGTGTTCAGC
AAAGTGAAAAGTCGATCAGCGCACATGAAAACTCACGTTAAGAGGGACGA
GAACAATAAACCTATCAAATCAGCGAAAGCCACTGCAAAGCAAAAGCAAa
aacaactacaacaacaacaacgacagcagcagcagcagcagcagCAACTT
CAACAACAATTTGGTGAACATTCAATGCCGCCCTACCCGCCGCAACCGAC
ACACCCTGGTCCACCCCAACCACCCTCAAATCTAAATCCAATGACTGTTT
TTGCACATGCGTAA
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_045513XLOC_045513Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073349-proteinTCONS_00073349-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073349-exon-scaffold_90-1491911889:54729..54881TCONS_00073349-exon-scaffold_90-1491911889:54729..54881Clytia hemisphaericaexon
TCONS_00073349-exon-scaffold_90-1510915933:54729..54881TCONS_00073349-exon-scaffold_90-1510915933:54729..54881Clytia hemisphaericaexon
TCONS_00073349-exon-scaffold_90-1575043694:54729..54881TCONS_00073349-exon-scaffold_90-1575043694:54729..54881Clytia hemisphaericaexon
TCONS_00073349-exon-scaffold_90-1491911889:57258..57331TCONS_00073349-exon-scaffold_90-1491911889:57258..57331Clytia hemisphaericaexon
TCONS_00073349-exon-scaffold_90-1510915933:57258..57331TCONS_00073349-exon-scaffold_90-1510915933:57258..57331Clytia hemisphaericaexon
TCONS_00073349-exon-scaffold_90-1575043694:57258..57331TCONS_00073349-exon-scaffold_90-1575043694:57258..57331Clytia hemisphaericaexon
TCONS_00073349-exon-scaffold_90-1491911889:64784..64918TCONS_00073349-exon-scaffold_90-1491911889:64784..64918Clytia hemisphaericaexon
TCONS_00073349-exon-scaffold_90-1510915933:64784..64918TCONS_00073349-exon-scaffold_90-1510915933:64784..64918Clytia hemisphaericaexon
TCONS_00073349-exon-scaffold_90-1575043694:64784..64918TCONS_00073349-exon-scaffold_90-1575043694:64784..64918Clytia hemisphaericaexon
TCONS_00073349-exon-scaffold_90-1491911889:71243..71519TCONS_00073349-exon-scaffold_90-1491911889:71243..71519Clytia hemisphaericaexon
TCONS_00073349-exon-scaffold_90-1510915933:71243..71519TCONS_00073349-exon-scaffold_90-1510915933:71243..71519Clytia hemisphaericaexon
TCONS_00073349-exon-scaffold_90-1575043694:71243..71519TCONS_00073349-exon-scaffold_90-1575043694:71243..71519Clytia hemisphaericaexon
TCONS_00073349-exon-scaffold_90-1491911889:72602..73813TCONS_00073349-exon-scaffold_90-1491911889:72602..73813Clytia hemisphaericaexon
TCONS_00073349-exon-scaffold_90-1510915933:72602..73813TCONS_00073349-exon-scaffold_90-1510915933:72602..73813Clytia hemisphaericaexon
TCONS_00073349-exon-scaffold_90-1575043694:72602..73813TCONS_00073349-exon-scaffold_90-1575043694:72602..73813Clytia hemisphaericaexon
TCONS_00073349-exon-scaffold_90-1491911889:75520..76234TCONS_00073349-exon-scaffold_90-1491911889:75520..76234Clytia hemisphaericaexon
TCONS_00073349-exon-scaffold_90-1510915933:75520..76234TCONS_00073349-exon-scaffold_90-1510915933:75520..76234Clytia hemisphaericaexon
TCONS_00073349-exon-scaffold_90-1575043694:75520..76234TCONS_00073349-exon-scaffold_90-1575043694:75520..76234Clytia hemisphaericaexon
TCONS_00073349-exon-scaffold_90-1491911889:76668..76878TCONS_00073349-exon-scaffold_90-1491911889:76668..76878Clytia hemisphaericaexon
TCONS_00073349-exon-scaffold_90-1510915933:76668..76878TCONS_00073349-exon-scaffold_90-1510915933:76668..76878Clytia hemisphaericaexon
TCONS_00073349-exon-scaffold_90-1575043694:76668..76878TCONS_00073349-exon-scaffold_90-1575043694:76668..76878Clytia hemisphaericaexon
TCONS_00073349-exon-scaffold_90-1491911889:77805..77851TCONS_00073349-exon-scaffold_90-1491911889:77805..77851Clytia hemisphaericaexon
TCONS_00073349-exon-scaffold_90-1510915933:77805..77851TCONS_00073349-exon-scaffold_90-1510915933:77805..77851Clytia hemisphaericaexon
TCONS_00073349-exon-scaffold_90-1575043694:77805..77851TCONS_00073349-exon-scaffold_90-1575043694:77805..77851Clytia hemisphaericaexon
TCONS_00073349-exon-scaffold_90-1491911889:78137..78223TCONS_00073349-exon-scaffold_90-1491911889:78137..78223Clytia hemisphaericaexon
TCONS_00073349-exon-scaffold_90-1510915933:78137..78223TCONS_00073349-exon-scaffold_90-1510915933:78137..78223Clytia hemisphaericaexon
TCONS_00073349-exon-scaffold_90-1575043694:78137..78223TCONS_00073349-exon-scaffold_90-1575043694:78137..78223Clytia hemisphaericaexon
TCONS_00073349-exon-scaffold_90-1491911889:78712..78815TCONS_00073349-exon-scaffold_90-1491911889:78712..78815Clytia hemisphaericaexon
TCONS_00073349-exon-scaffold_90-1510915933:78712..78815TCONS_00073349-exon-scaffold_90-1510915933:78712..78815Clytia hemisphaericaexon
TCONS_00073349-exon-scaffold_90-1575043694:78712..78815TCONS_00073349-exon-scaffold_90-1575043694:78712..78815Clytia hemisphaericaexon
TCONS_00073349-exon-scaffold_90-1491911889:79060..79224TCONS_00073349-exon-scaffold_90-1491911889:79060..79224Clytia hemisphaericaexon
TCONS_00073349-exon-scaffold_90-1510915933:79060..79224TCONS_00073349-exon-scaffold_90-1510915933:79060..79224Clytia hemisphaericaexon
TCONS_00073349-exon-scaffold_90-1575043694:79060..79224TCONS_00073349-exon-scaffold_90-1575043694:79060..79224Clytia hemisphaericaexon
TCONS_00073349-exon-scaffold_90-1491911889:79368..79478TCONS_00073349-exon-scaffold_90-1491911889:79368..79478Clytia hemisphaericaexon
TCONS_00073349-exon-scaffold_90-1510915933:79368..79478TCONS_00073349-exon-scaffold_90-1510915933:79368..79478Clytia hemisphaericaexon
TCONS_00073349-exon-scaffold_90-1575043694:79368..79478TCONS_00073349-exon-scaffold_90-1575043694:79368..79478Clytia hemisphaericaexon
TCONS_00073349-exon-scaffold_90-1491911889:79692..79843TCONS_00073349-exon-scaffold_90-1491911889:79692..79843Clytia hemisphaericaexon
TCONS_00073349-exon-scaffold_90-1510915933:79692..79843TCONS_00073349-exon-scaffold_90-1510915933:79692..79843Clytia hemisphaericaexon
TCONS_00073349-exon-scaffold_90-1575043694:79692..79843TCONS_00073349-exon-scaffold_90-1575043694:79692..79843Clytia hemisphaericaexon
TCONS_00073349-exon-scaffold_90-1491911889:80028..80216TCONS_00073349-exon-scaffold_90-1491911889:80028..80216Clytia hemisphaericaexon
TCONS_00073349-exon-scaffold_90-1510915933:80028..80216TCONS_00073349-exon-scaffold_90-1510915933:80028..80216Clytia hemisphaericaexon
TCONS_00073349-exon-scaffold_90-1575043694:80028..80216TCONS_00073349-exon-scaffold_90-1575043694:80028..80216Clytia hemisphaericaexon
TCONS_00073349-exon-scaffold_90-1491911889:80657..81843TCONS_00073349-exon-scaffold_90-1491911889:80657..81843Clytia hemisphaericaexon
TCONS_00073349-exon-scaffold_90-1510915933:80657..81843TCONS_00073349-exon-scaffold_90-1510915933:80657..81843Clytia hemisphaericaexon
TCONS_00073349-exon-scaffold_90-1575043694:80657..81843TCONS_00073349-exon-scaffold_90-1575043694:80657..81843Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_90supercontigscaffold_90:54729..81843 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0 0 0 0 7.41106 4.73104 4.98367 6.88496 1.64191 1.66507 2.48958 0.452902 3.09832 3.52533 0.989333 2.48382 1.49947 2.20903 5.65013 2.76637 2.55408 1.58525 1.56999 2.76812 2.63717 4.07909 0.352566 0 0.865633 1.83876
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR013087Znf_C2H2_type
IPR000949ELM2_dom
IPR001005SANT/Myb
IPR017884SANT_dom
IPR009057Homeobox-like
Vocabulary: Molecular Function
TermDefinition
GO:0003676nucleic acid binding
GO:0003677DNA binding
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
molecular_function GO:0003677 DNA binding
molecular_function GO:0003676 nucleic acid binding
Blast
BLAST of TCONS_00073349 vs. Swiss-Prot (Human)
Match: TREF1 (Transcriptional-regulating factor 1 OS=Homo sapiens GN=TRERF1 PE=1 SV=1)

HSP 1 Score: 143.665 bits (361), Expect = 3.492e-34
Identity = 75/189 (39.68%), Postives = 114/189 (60.32%), Query Frame = 1
Query: 2713 TVTPT-NEEEINVTTVASDPTEPKINVGPEFQAVLPHVLNRTEAQKDSHRASLMWSPLKEDEQK--QKEVEAYLDMACSLVLYGGSNNKEYALHILQRTRGNVKEAVRLLLSRRHILRADDPNADYHYSGSVRWTAKERLAFRQAYRSKGKIFMGIQKEVETKSVQQCVEFYYLWKAMHPESFRARTRM 3270
            TVTP   E+ ++V        EP+IN+G  FQA +P + + +   +D+H+A+L+W P  E E    Q+ VE  L++ CS  L GG  N E+ALH L   +G+V  A+ +LL R+ +     P A+YHY+GS +WT+ ER  F +A  +  K F+ +QK V++K+V QCVE+YY WK +     + RTR+
Sbjct:  765 TVTPGPGEQTVDV--------EPRINIGLRFQAEIPELQDISALAQDTHKATLVWKPWPELENHDLQQRVENLLNLCCSSALPGGGTNSEFALHSLFEAKGDVMVALEMLLLRKPVRLKCHPLANYHYAGSDKWTSLERKLFNKALATYSKDFIFVQKMVKSKTVAQCVEYYYTWKKIMRLGRKHRTRL 945          
The following BLAST results are available for this feature:
BLAST of TCONS_00073349 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
TREF13.492e-3439.68Transcriptional-regulating factor 1 OS=Homo sapien... [more]
back to top