Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00073327 (transcript) - C. hemisphaerica

Overview
NameTCONS_00073327
Unique NameTCONS_00073327
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length386

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00073327 ID=TCONS_00073327|Name=TCONS_00073327|organism=Clytia hemisphaerica|type=transcript|length=386bp
GCTAACTGAAAAAGAAGGACTTTTTCGGAACCTACAGACAGTTTTGTCAC
GGTTTTTGGATGTCGATCAATTAATCTCATGTCTCGTCCAAATACCTAAG
AAAAAAGATCTGAGAGTGTTCGAAAAGAAAATTGCTGATTCCATCTCCTT
GAAACACGTCATTGAACTAATACCAACACTCCAAGAAGCCTTGAAAGATT
CAGAAAATGGATTGTTTAAGGCATATTATCAGtcACTTTCAGATCCACGA
TATGAGAATATTCTCGAAGAAATAGGAACAGTGATTCACGATGAGACGCA
TTACCATAAAGGAACATTGAATATGAGAACACAAAAATTGTTCTCAGtta
aggtacacgtttttttatacgaacaaactatataag
Run BLAST on NCBI

transcript from alignment at scaffold_9:338392..339471-

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00073327 ID=TCONS_00073327|Name=TCONS_00073327|organism=Clytia hemisphaerica|type=transcript|length=1080bp|location=Sequence derived from alignment at scaffold_9:338392..339471- (Clytia hemisphaerica)
GCTAACTGAAAAAGAAGGACTTTTTCGGAACCTACAGACAGGTAAATTTT AGATTCTTTCTTGTATGTATTTCTGTATTTCGTCGCGAAATGTTGCAAAT ACAATAATTTTCATAGATTTTACATCAAAATGGGATAATAACTTTCGCGG CGATTAAATTTCGTGGTTGAGTTCACCCGAACTTTTATAGAACTTAAGGC TTGTCATACTCAGTGCCGTTACCAATCTGGTAATTTAGGAGTAGTCCGTC GAATTTGAGCTGAGTCAACCAGTTCTTTTGTTATCTCTTAAATTTCTTTA ATACGGAACTTTTAAAAATTTTCTTTACAGTTTTGTCACGGTTTTTGGAT GTCGATCAATTAATCTCATGTCTCGTCCAAATACCTAAGAAAAAAGATCT GAGAGTGTTCGAAAAGAAAATTGCTGATTCCATCTCCTTGAAACACGTCA TTGAACTAATACCAACACTCCAAGAAGCCTTGAAAGATTCAGAAAATGGA TTGTTTAAGGCATATTATCAGGTTCGACTTTGGGTTAATATCATTTCCAA ATAACAAACTTCAAATCAGTCAAATTAAATTATTGACTTTTTGATCAGTA GATTGATATCCCTATCGTTCGTCAAATGAAGGGATGGTAAAAATGGGAAA ATATGCGCGGAGTTTAACAGCCATATGTATAGCAATATACGGAAAAATTA GCGGCGGTAGAGTTTGGAAAGACCGTCAAACTCTACCAGTTGTAAACTAT TTTCGGCAAAAAAAAAACTTTCGCGAATTTTCTTCAGATTTGGGCCTTTT TCTTAGATAGTGGTTTGTTGTCCCCTTTCAACTAGTTCGGCAATGTCCCT TTTCAGTTTACGAAACCCCTTGTTTCTGCTCTTCTGTTTGGAATCAATAT ATTTTGATTTTTTCAATTTTTTTAAGTCACTTTCAGATCCACGATATGAG AATATTCTCGAAGAAATAGGAACAGTGATTCACGATGAGACGCATTACCA TAAAGGAACATTGAATATGAGAACACAAAAATTGTTCTCAGTTAAGGTAC ACGTTTTTTTATACGAACAAACTATATAAG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_045491XLOC_045491Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073327-exon-scaffold_9-1575043694:339431..339471TCONS_00073327-exon-scaffold_9-1575043694:339431..339471Clytia hemisphaericaexon
TCONS_00073327-exon-scaffold_9-1575043694:338951..339141TCONS_00073327-exon-scaffold_9-1575043694:338951..339141Clytia hemisphaericaexon
TCONS_00073327-exon-scaffold_9-1575043694:338392..338545TCONS_00073327-exon-scaffold_9-1575043694:338392..338545Clytia hemisphaericaexon
TCONS_00073327-exon-scaffold_9-1510915933:339431..339471TCONS_00073327-exon-scaffold_9-1510915933:339431..339471Clytia hemisphaericaexon
TCONS_00073327-exon-scaffold_9-1510915933:338951..339141TCONS_00073327-exon-scaffold_9-1510915933:338951..339141Clytia hemisphaericaexon
TCONS_00073327-exon-scaffold_9-1510915933:338392..338545TCONS_00073327-exon-scaffold_9-1510915933:338392..338545Clytia hemisphaericaexon
TCONS_00073327-exon-scaffold_9-1491911889:339431..339471TCONS_00073327-exon-scaffold_9-1491911889:339431..339471Clytia hemisphaericaexon
TCONS_00073327-exon-scaffold_9-1491911889:338951..339141TCONS_00073327-exon-scaffold_9-1491911889:338951..339141Clytia hemisphaericaexon
TCONS_00073327-exon-scaffold_9-1491911889:338392..338545TCONS_00073327-exon-scaffold_9-1491911889:338392..338545Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_9supercontigscaffold_9:338392..339471 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0 0 0 0 0 0.817134 2.92755 0.740588 0 0 2.76036 1.4499 0 0 0.28851 0 0 2.04189 0 0 1.00951 0 0 2.07074 0 1.03245 0 0 0.1578 0
Blast
BLAST of TCONS_00073327 vs. Swiss-Prot (Human)
Match: MSH4 (MutS protein homolog 4 OS=Homo sapiens GN=MSH4 PE=1 SV=2)

HSP 1 Score: 119.013 bits (297), Expect = 2.679e-31
Identity = 60/120 (50.00%), Postives = 83/120 (69.17%), Query Frame = 2
Query:    2 LTEKEGLFRNLQTVLSRFLDVDQLISCLVQIPKKKDLRVFEKKIADSISLKHVIELIPTLQEALKDSENGLFKAYYQSLSDPRYENILEEIGTVIHDETHYHKGTLNMRTQKLFSVKVHV 361
            L + E LF  LQ+V+SRFLD +QL+S LVQIPK+  +   E KI + I LKH +EL+  L+ A+K+    L +AYY SL D R+  ILE+I TVI+D+  Y KG LNMRTQK ++V+ ++
Sbjct:  375 LLQDEELFFGLQSVISRFLDTEQLLSVLVQIPKQDTVNAAESKITNLIYLKHTLELVDPLKIAMKNCNTPLLRAYYGSLEDKRFGIILEKIKTVINDDARYMKGCLNMRTQKCYAVRSNI 494          
The following BLAST results are available for this feature:
BLAST of TCONS_00073327 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
MSH42.679e-3150.00MutS protein homolog 4 OS=Homo sapiens GN=MSH4 PE=... [more]
back to top