Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00073319 (transcript) - C. hemisphaerica

Overview
NameTCONS_00073319
Unique NameTCONS_00073319
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1006

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00073319 ID=TCONS_00073319|Name=TCONS_00073319|organism=Clytia hemisphaerica|type=transcript|length=1006bp
TCCTCAGTCAAGTTTACATTTACCTattcaataattgaaaaatgagTGGA
GGTCTTGCCCCCAGCAAAAGTACAGTTTATGTTGGTAATCTACCTTTCTC
CCTTACTAATAATGATTTACAcaaggtttttgaaaaattcggaCGGATAG
CTAAAGTTACAATCTTAAGAGATAAAGTAACACGAACCAGTAAAGGCGTT
GCTTTCGTTCAATTCATCGAGAGAGATTCTGCTATCACATGTTGTAAATC
AGTTAatgaaaaaacgttgtttgaacgGAAAATAAAATGTGTCATTGCAA
AAGACAATGGGAGAGCTTCAGAGTTCATTCGAAAAAAGGATTATCCAGAT
AAATCTAGTTGTTATGAATGTGGAGAGACTGGACATCTTAGCTATGCTTG
CCCAAAAAATTTACTTGGGAGCCGAGAGCCACCacctaaaaaagagaaaa
aaactaagaaaGAGAAAGCAGAGGAGAAAGAACATTCAAAGAAtttaatc
aagagttattaTGATGCTGATGAGGCAAATGATGGTGTTAATGAAGAAGA
ACAAGGGGAAGACCCTTATGAATCAAGTCTCAGTTATGCAATTGCTCTTG
ATTCTAGTCaacaaaaaagacatttttcCTCTATAGTTGTCCAACCTTCA
ACATCAAGGACTTCAACAGATTACGATGGTTACAAGGATAATAATGATAG
GGAAGAAGAGAGTTatgtcaaaagaaaaaagtataaacCGTCATCATATT
TCAGTGACGAGGAGGAAGAAGATGAATCTTAGGATAACAATTTGTGAACT
TCTTCTTTGTTCATTTAGtatcactaaatttgcaataaaaatatttggct
gATTTATAAATTATTATGTAAGCCAAATGccttttttaaatcaatgacat
cttagaataaaaataaaatgcttCTGATTATTCGAACAATATGAAGGAAT
GGTTTGATAAgaacactttttaaatttagcaACTTGATTTCTGTGCTTCT
AAaaac
Run BLAST on NCBI

transcript from alignment at scaffold_9:192786..220839-

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00073319 ID=TCONS_00073319|Name=TCONS_00073319|organism=Clytia hemisphaerica|type=transcript|length=28054bp|location=Sequence derived from alignment at scaffold_9:192786..220839- (Clytia hemisphaerica)
TCCTCAGTCAAGTTTACATTTACCTGTAAGTATATCATAGCTAATGAGAT ATGGCAATTTTCAAATAAGTATTTTTTTCAAGCAACAAGGATGTGACCAT TTTGTTTCGACCCATCTTCTTTGCGTTAATTGTCCACACAAAATTTATTG ATTGGGCCATTCCAGAATTTGTCTGTAACAGGGCAGGGGGGGCAGACGAC ACAGGATCTCCAAGCAGTTAGTCACACTAGGAAATCTAGCTTTCAGAAAA AACAACATCAGTCATCTACAGGATGTATTTGCACAGCAAGGATGAGAGTT ACATGAATCCAAGTTCGCAAGACAATTGATTAAAACTTGAAAGTTTGAAA CAAAATAAAACGTGCAGCAGCCAAATATCAACCAACCAAATTTTGTCATT CAATTCCCGAGATAGCGCTTCGATTTTGAAGGCCTTGTTTATACGCTAAA GTAAAAATAATTCCGAACATGTAAATGGGTCATTGTTTGAGTTCCGGCAA AATTTCCGGGAAATAGCCTATCCGGCGGTGCGCGGATCTAGGTGGCNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNGTATGGCGGTCACATTAAATTCAAAAGGAAACCGGGTTCTTTTTA TTATTTTCGGTTCACGGTAAAAATGTCTACTAAAAAATTCCTCGCGTGCA AAATGGGGCAAAATGTTGTGTTGTTGTGATTTGGACATCTTCGTTGAAAG TATGCTAATTAGTTTTTAGCGATTACTACATCGTTAAAGTTTTCTTTTCA AATATAAGTAATAACTCTTCACATTTCTCATATTATATTAACAATCTGTG ACGTGATAGAGAGAGAGTACATTTTAGTGATTGATTGATAACTTTGGTAT GTATTTGTTTATGTTTGATTTTTTATTTCGAAGACCAGCCTACAGCTATG TCGAGATTGCAAGACGTATGTCGAGATTAGACGACTCTACGGTAGCGCTT TCGCAGCATTAATCTTTGATATGCATTTTGGCGGGACGCTAGTGTGACTA ACTGCCAAGGGCAAAAGTTTTCACCAAAATTCAAAATTTCCAAGGGGAGA GAAGGAAATGTATGAATTTCCGAGGCAGGCGCAATACACCCGTTCAGTTC GGCGCAAATTGCATAGATCCGCAACGCTGCGAAATTCTGCATCTTTAGCG TTGTGATATTCTGCAACGTTGCGAAATTCTGCAGCTTTATCGCTGCATAA TTTCACAGCCCTAGCCTATGGACCAAAACCGGCATCGCAGGGCCTGGACC GGGGTCCCAAAATAATCCAGACGTCCGCGCTCGATAGGATCGATCATCGG AACGGCTCGATGACGGATCGATNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNAGGAGATCGATGGAAGATTCAGCCAT TAAAAAGTCTTGAGTATCGATCCTTCGTTGATCCATTATCGAGCTAGTAT TTCAATCGAGTATATTGATTCGTCATCGATTGTTAATCGATTCGTCATCG ATTGTTAATCGATTCGTCATCGATTGTTAATCGATTCGTCATCAATTGTT AATCAATTTGTTATCGATCGTAAATTGAGTATGAGTCGATAGGGTCGATA AGATCGATAAAAGATCGATGATAGATCGATAAATAATCGATAACTAATCA TAAGCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNCCGGATCGTTAAGTAATCCATCGATCACATATCGATCCGTCATC GAGCCGTTCCGATGATCGATCCTATCGAGCGCGGACGTCTGGAATAATGT GTATTTTGAAGAACAACTGAAAAGGAAACTTTTCACCCTAGCATTTTAAT TTCCCACCTAGCGATTATTCACAATCATTCATGACAGTAAGGCTACTTCG TTCAAAAAAGCGCTACTTTGTTCAAGAAAGCAAGTTTTTGCCTGATTTTG CATGTGTTTAGAAGAAAATTGGTAGGCGCTCATAATTTTTANNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNCGCTCATAATTTTTAAAATCACAAGCTTCAATTGGAAGTGTTGCG TAAAATAGCAGCGCAACCCTGGGGAAACGCTGCGAAAAACCGCAACGTTG CGGATCTATGCAATTTGCCGAACTGCGTTTAACAGTGTCGACTGCGCACA CGTATGTATGAACAATTTTCCATTGTTTTGCAGTCAGGACCTCTTTGGTC TTTTTTAACATTAGTTCGGATAGAATAAAAACATACCTGATCAACACAAT CAAACCTTCTGTCTTGTGTTTACTATTTCCTTCCCAACAACTTTTGTTTT TGCTTATGTAGGTTTTAAAATCCACAAGTAGTGAACCTCTTATAGCTTTA TCTGAATAAATCTGGTTGAAAACCTTCTGTCAGGTTTCATTCCGTACGTT TTTTATCCACGTGGTGAACCGGTTTCCCGGATTTCCCGTTAATTAAAAAT TGGAACTTTCCTGTGGGCGCAATTGGGCGTACCGCCATCGCAAAATATTT TTCGTGAAAATTTACCGATTCTCTAACGCTAATATAATCTAGATAGGAAA CAAATATTAAATTTGATTCTTTTTTTGTTCGTATTTCTAAATTTCAAGAT AAAAAGAACTATATCTATGAATTATTTTTTTTAACGGGCGTTGAATCGAC ATTGACATATTTAATGATGTCATAATCAATGCCGTGCATATTTTGTCAGC GCCGTGCATATTTTGTCAACATCCTTTTCATTGGATAAATACCACTAAAA TATACAAGATCAGTAAACATAAATTTATCGCCCGCGAGCACGGCTTAGCT AAGCGCACCTCTCTTATTCATTATCTAAGAATTGAAGCGGGCAAAGATTA CCGCACGGGCTGATAGCGGACGAAGGTTTTTTGAAGATGCTTTCAGTTAT AATCCAAGGTAGAACAAACTGAACATAGAAAGGGGGTAAATTTTAGTGCT CTATACGATGATCGGTATTTTTTTTGAATTCTATGTTTAGATTTTTCTAC CCAGCCTTGTTGCTATGTCCGCGCGCACTGTTGCTAAGACCTTTGCTTGA AATTGAAAGCGAAACCAAGATTATTTAGCGCACACTGCCGTTTGCGTAAT ATCGATAAAGTGAAATGAGGTCCTGACTGTTTTGGCAACCACGGGAAACT TCACTCTCCCCCGTAAAAGATGGTAGGTAGACATCCAGTTCTCATAAGAA AACCCAGTAGAGAAATGGTAGGTAAAGAATTCCTTTTAATCATAACTTCT TTTCCTCAAGATGAATTTTTGTGAAATTTTCAGGAGAGATACATAAAATT GTCATTAATATCATGTTCAAATATCTAAAACATTCTCTTTAAAAGAAAGA AAATAAACCAGCCGAGGCTGGAAGGTAAGCCAATAGAGCTTAGCTAGATA GCTTTAATAAGTGGGTTAACAGATGTAAGAGATGTACTGAAACAGAGTAG ACTAAAAATGTTGAATACACGCTTTTTTTTTATAAGAATAGTGTACTTTG GTTGAGGGTAAGCATTATTCTTATTTTTCTATTGTTCTAAACAATAGGCC TATTGTTTTAAACCCGAAATCTCACCCTGATATTCTTATAGAAGTTAATC TTATAAAAGAAAAAGCGTGTAATGTAAAAAATGTGAAACATTTGATAACA AGCCTGAGAGCTCCTTCACACCTCCCCCCCCCCACGAGAAACTCAAAGTA TACTTCTCTTTAGCATTGTAGCACTGTNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTG AGATCGGAAAATCGGATTTTTTTTTTGCCGTCTTATGATGATGATGATGG AAGAAATGAATTTTACGGATTTGAATGCTCAGCTTAGGCTGACCAAAAAT GGCAATGTTTACATTTCTCTAACCTTCCACAGTACTAAAGTGAGCATTTT TACCTACCGCCTCTACGGTCAGTGAAGTCAAGTTTGAGGATATTCTTTAT TAGAAAAACAGTTAAAAGCAGTCAAAATGTAACTGTAACTATGCCCGGGT TATGTTAAAAACAAAAGCGACTACGGCAAAAAGTAGCGATTTTCGTAATA AACCTCAAATATTGATACTTGACTGTACTGACTTTCTGGTCTATAAAGTA CAGTTAGATTGGGTAACTTGCATCAGTGGAGGCTAACATGCATAGCCCTC AAATGAATGACACGTCTGGTCATTAAAATACCAAGTTCGATCAAAACAAA AATGGTAGAGTAGAGCTGCGAGCGGAGCTGAATATAGTTTATTTTAATGA CCAGCCAGGTCATTCATTTTAGGGCTATGCATGTTAGCCTCCACTGATGC AAGTTACCCAATCTCACTGTAGTTAAAGTGATTTTTTAAAGCAGCTTACT CCATCCAAAGCGCAAAGGTTTTGTTTATGACTTATAATAGGGTGGTAGTT AGCCAAATTTTCAAACTTAATCAGAAAAAATGAAAGTAGTTGGCTCATCT GATAGCCTTAAGCACAAGAGAAAAAATGAGGGGTCACATTTGAGAAATGG TAAAGTACTTCATAAGATATAAGAAAGCCAAATATAGGAGATGTTGCGCT CCTCGCACCATAATATTCCAAAATGGAGTGCAAAAGTAGATTAGACTACA AAGATGACATCACATCACACACATGCAGTCTGTTGGTGCAAGTAGCAGTA GGCTATAGAGACTTTATTTTTCAAAATTAAGTTTGCATAATTTTTTTTGG TCCGTTGGGACCCAAATAACACAAATCTGAGATATTTTTTGATTTTTTCA ATTTTTGACGGAATTCTCCGGCCTTTTTTATGCCCGAAATGAGCCAATTT TGGGCATTTTTGCCTGGATAAAAAACCTAGAACTTGTTATGTTGGTGCTA CCAACCTCAAATTGGACTTAAAATATTCCTTGGAAAAAAGTAGGATTGGA ATGCAACAATTATTTAAAAATTCAGGTATTTAGGCCAAAATTGACCGAAA ACAGGGAAAAACAGGGTTTGTTTGGGAATAAAAGCTAAAATCTGTTCTGA TTGTGCTATAAACCTTAACTTAGGCTCAAAATGTTCTTTGGAAAAAAGTA GGATGAGAATGTAACAATTATATACCTCTACCATGTATATAAAATTCAAA GAATTAGGTATTTAGGCCAAAACTGACCGAAATCAGGGGAAAACGGGGTT TTGCCTGGAAATAAAACCTAAAATCTGTTCTGTTGGTGCTACAAACCTCA AATTAGGCTTAAAATGTTCTTTGGAAGAAGGTAGGATTGGAAAGTTACAA TTATATCACTTGATCACCTGAAAAAAAATTGTGAAAAAGGGGAATTTGCT AGTCACAGGGGTAGCTTCTTCTTAGTCTAGGTGAAAGATAGAAAAATACA AAGATTTAAAAGAAATAAGAATATGAGACCAACAAAAGGATAAAATCTTT ATATTTTTCTATCTGAAATGAAAATAAAAAAAAACTATCAATATCAATTT CTGTAAGACTTCACTACTAAATCATGGCTCCGCCCCCCCCCCACTTATTT GGGGGGGGTGTAAATCTCAAATTGGCTTAAAAGTGGGTGGGAGCTGTCTC ATTTTTTAAATTCAGGGGGGACCTAAAAAAGTGGGGGGAGCTGAAGGGCT ACACTAAAGTTCTGGGGGGCTAATTAGGAAACTGTAAAATACCCCCTCAC TATTGTTTTGGTTAATAAGTTATAGATTTTTCTATTGAATTTATTATCTC TTACAGTGGGGGTTTCGCATGTCTTTACGTGTGCGCGAGGCTTGCGCGTT GCGAGTACATAATGTATAGGTGTTAGAAATCCAATTTATGCAGACTCGTT CAATGCGAGTGCTTTTGATTTCCCTCCCAACACTCAACTCGTACCTTTTA TAAAAGGCCTATTTAGTTTAGTATAAGGTACGTGCTATTCAACCGCTGAT TAATAGGAAAGCAAAGCTATTTATTTTGAATTAATGGGGAAGCGAGTGAG TATTTACTGACGTTTCATATTTAAAGGCCTCCTATTTTAAGTAAAGAAGA TACAGCTGAAACATTTGTGAAAAGTCTTTCAATGTATTTATTGAATAATA AGAGCGTCCAAAAGACGAGATAATATAAACAATATCCAGGGTTCCAATTT ATAGCTTCGCACTTCACAAAATGCGAAGTGAATTTTTTAGCGATCCAAAA AGATTTCCTAACTAAAAATGCAAAATTAAAAAACTATAAGAAAAGCTCTA TTTTGCTACTTCTTTCATTTGTTTATCTATTGCTTTATGAACTCGATACT TCGCTAATTTACTCACTCGTTTATCTATTGCTTTACCAACTTGCCACTTC GCTACTTTATTCACTCGTTTATCTATTGTTTTATCTACTCGGCTACTTTA TTCACTCGTTTATCTATTGCTTTATCGACTTGCGAGTTCGCTACTTTCTT CATTCGTTTATCTATTGCTTTATAAATTCGCTAGCTCACTAATTTATTCA CTCGTTTATCTATTGCTTTATCGACTTGCGAGTTCGCTACTTTCTTCATT CGTTTATCTATTGCTTTATAAACTCACTATTTCGCTAATTTATTCACTCA TTTATCCATTGCTTTATCAACTTGCCACTTTGCTACTTTCTTCATTCGTT TATCTATTGCTTTATAAATTCGCTAGCTCACTAATTTATTCACTCGTTTA TCTATTGCTTTATCAACTTGCCACTTCGCTACTTTATTCACTCGTTTATC TATTGCTTTATCTACTCGGCTACTTTATTCACTCATTTATCTTTTGCTTT ATCTACTCGGCTACTTTATTCACTCGTTTATCTATTGCTTTATCGACTTG CGAGTTCGCTACTTTCTTCATTCGTTTATCTATTGCTTTATCGACTTGCG AGTTCGCTACTTTCTTCATTCGTTTATCTATTGCTTTATAAACTCGCTAC ATCGCTAATTTATTCACTCGTTTATCCATTGCTTTATCAACTTGCCACTT TGCTACTTTCTTCATTCGCTTATATCTATTGCTTTATCTACTTGCCACTT TGCTACTTTATTCACTTGTTTATCTATTGCTTTATCGCCGCGAAACATAT TACGTTTTAGATAATATACAAACTATGTTATATCATAATAATACATTATA CGGACGATAGCATCGTCTAGTTTATGTAATGCTTTATCTACTCGGCTATT TCTTCATTCGTTTATCTATTTCTTTATAAACTTGCAACTTTATTCACTCG TTTATATATTGCTTTATAAGTAAGTCTGCGACTGCAGTTGGAGGCGACCC GAAGGCTCTTGCTTTATAAACTCACTACTTCAAAACTTCACTATACTTTG CTTTGCCTATAATCTCTGACTACAAGTCTTACTTTGCTCCTTTATCTCGC TTCGCTCAAAAAAATAGGGAAGCTCCAAAAATTCATAATTCGAACCCTGA TATCAGACTAACACTGTAATAGTATATAAAGGGTAATAATAAGCTTATAA GTAAATGAAATTAGAAGAACTCAGAAAAAAATTAAATCTAAAAAAACCTA TGCTATGCTGAAATGAAATATCATCTCAGCAATGCCGATACAATAACCCA TGGACGTTAACCACATAAACAAAGTATTACCAATAGTGTTTAAACGAGGG GGTAAAGCTTCAGGACACTAAAAAATGATACACGTTTTTTTTTTATTAGA ACGTCTTAATTTTAGCTGAGGCTGGATGTGCCTACTTTCTCATCAATTTT CGGCCTGAAATGTTCTTATTGACGTTCTTGAAATCGATTCGCTTAAAATC TAATGAAACCTTTGAATTTCGATATTGGGTTAAAAATCGAGTAAATTTGC TATTACTTTTAGATGAGAGGAATAATTACAGTAATAATTGCACAAAGTTC CTTAAGAAATCTAAAGATTTTTAAGCGAATTTCGTCAAACTATTCGATTC TCAGGCTGGACATGTTCTTTATAATGTTCTTAAATTTTTGCCAAATTTCA GCCTAAATGTTCTTACAAACTGGGTTCTAATAAAAAAAACAACGTGTAGC TATTTTCATTGACATAAAAATAAGGGTTAAAACTTTTTTTTCCGAAACGA ATCTTCCAGAATAAATTTCTGGACAGGTGAGAGACAAGTTAAAATATCCA GTATTTGTATATTAGAACGTCACATTCAGATTAGGAAGTCTTAATTCAAT ACTTTTATTGAATTTCTAGTTGTTTCATTTAATTTCATTTAATTTTCTAT ATTCAATTCTTTTAGTAGCAACAACATTTGTTTCCGTTGTTTCCTTACTA CATTTCGAAATTTTAGACTGAAAGAAAAGTAAAATTGAATTAAAAAGGAG AAAAGAAAAAGTTTACTTTCTTTCATTTCAAGTCTTTTAGTTCCATCACA ATACATTTTTATAAAACGATTTAAGCAACTGTTAAGCGTCCAACAATAGG AGCACTCGCACATAAGTGCACACAACTCGCACTGTTATGGATTCAAGTCC AACTGTAAATATATTTCAAAGCTTATAAGAGAAAATGACTGTATCTATTT GACCGAAACTTGGCTTCTTAAATCAGAGGAGCACTTCTTACATGAATTTG AGTCAGAGTATAAAATTATAACCGTTCAAGCAGAAAAACGAAACAGCGGT AGACCTTTTGGAGGAACAATTCTACTCCTGAAAAATAATAAATTCTCTCA GACTAATACAATACTACAAGAAATGAACTACACTACAATCAATACACACC TTGGTAACACATCAATCACCATCTCAGGAGTCTACTTACCAACATCAAGT AATACAGACTATATAGAAACCTACAAAACCCAATTGTCAACTTTGATGGG AATCCATACTCAATTTGCTTCAACCTCTGAATCTATCATATTAGGTGATT TCCAGTGCTTTCCAAATATCCCAAACTCACCAAGGACTGCTAAACTCAAC ACCCTTTCAAAATTTCTTACAAACTTTATAAACGAAATGGATCTGATTGC AATTGATATCATGAACGGAACAGGCCCATCATACACATATCATCACCATA CCCTACCAAATAAATCGTACATTGATCACATTCTTGTTTCACAAGACATT GCAAATATGACATCCGAGACTGCGGTAATAGAACCAGCGCCTGAGAATAC CAGTGACCATCTCCCAGTTTCCACTTCCTTATTTCTCGAGAACACATCAG ATCATCATCAACAGCAAACAACACCTCCGAGATTGTCTCAAATACCCAAC TACCTTTGGTCCAATGAAAGATTTCTGGAGCTCTACAGAAAAAAGGTTGC TGAGGCAATGCCACTCAAATCAAGCGAAAATATTAACAAAGATCTAGACA CTCTCTCTGATCTACTTAAAGAATGTGCTAGTAAAAGCTATACAGAGATA GAAAGCAATTTCCGGAAAGTCGAACCAAAACAGTGGTGGAATCAGGATCT AACAAGGTGCAGAAATACACTCAAACAAACCTTCAATATATGGAGAGACA ATGGTTTCGAAAAGGATATGAATTCAGTGTATTATGCCCGATATGTGTTT GCCAGGAAAAGATTTCGTTTATCTCGTGCGCCATTACAAAAACCAAGCGA CAGCCAAATACTACGTAAACATTGATCGGTTAAAGAAAATAAACCCTAGA AACTATTGGAAAAAGATTAGACTTAACAAAACATCAGCAGAAAAACTATA CACAATTAACAACAAAACGTCAACAGAGGAGATCACAGAAGAATTTGGCC ATCATTTCCAATCCGTTTTGAACGAACCTAGAGTCCAACANGACATCTCA CAAATCCTGGACAATAAAAAACTCAGTCTCCTAAAGGAACTTATCGAAAA CAACAACACTAGACACTACGCCCTATACGTCACCACACTGGGTAAAGATG ATAGAGGCTTCTCGACAATCGAAGACCTCAACAAGACATGTGAGAAATAT GAAATAGATTTATTCGAAAGCTTTATTAAAAAACAATCAATCAAGGTGAT TGACTCTAATATGCCTGGTGAAGACTTGGATCAACTCCGTCTGTGTGTCG AAAACTGGCACAAGTATGAAAATAGATTGCGATTCAGAGAAATCCTTGAG GAGTCAATCAAGCGCTGAATCTTAGCTTCTTAAATCCCTCTATCATTTAA GTAATCTAGCTAATCTACCAAATTTTATCTTAATTTTATCCCTTTCCTTT CTACGCTAAGAAACAACACTGGTTCTTCCCAAGGACTTCTCTTGGATCTA CAATTCTGTATATAAGATATAAGATAGTTTAATTACGACTTTAATAACTA TACTTCCATCCTGGCCTTGTGAGATAATCACCCATTAATTCATTATAATC AATCTCCTCAATTTTTATTCTAAATCTATCTTCCAGACTTTGTTTGTTTT GATTTTGCAGGATGAGATTCCCACGCTACACTTTTTTTGCTAACTCATCA TTTTGTCAGTTTTCCTTTTGTTCTCGTGGGTGATTCCCCACTGCCTTTTG GATTTTATAAGGGCGGCAATTTTGGAAGATTCCCATTCGTCTCGAGCTCC GCGATCTATATATATATACCACCGCCCTTCTCCCTCAGTCGACTACCTCA ATATTTTTATTTTAATCAACAAAAAAAGAAAAAACTTTTTTAAATGTACA TAACTCAAGCATATATTTTAAAAAAAAAGAGAGAGACCTCCTTTGTATTT ATTAGATAGTTATATTCATGGTTATACCAAATTGGTGATAAAAGAGATGA CAAAATAAGAAGACTTGCGACACTAAACGCGCAGACTATTGTTTTCTGTT TGCACTACATAATAGCTCGCAAATTATAATAGGCTTTTGACCTGTTTTAA ATAGCTTGAGTGTCCCTATTAATTTGAGGCTACGAGTCGCCAATAAATAG GTTTTCAATAGTGAAAGAAGCCGCTTGCGAGTCTCTGACACGCAAGGTTC GCGTACGTGTAAAGACATGCGAAAGCCCCACTGTACATTCTATCAAAATG TAGGCTAAAATGGCAGATTTCTACCCTTAAAATTCCAAAATTTTCTTGTT GCCCAACCATGGTGGGCAACATTTATTTAAATTTTCAATTTGGACCCCCA ATTTTTTTTAACCCGCATTTTTATGATGTACATGAATTCTTTCTTCTCTT CCTCAGTTGGTTGACGTCCCATGTTGATGCGTAAAAAAACTAGTAATAAT ACTACTAGAAATGACAATAGCTTTTTTTGCTGGGACCCGAACCTTGAAAG CAATTTGTGCAGAGACCTGAACCTTTATATTTCAACTGGGACCTGAACCT TACTGAAAAGTGGGGGGACCTAAATCGTAGGGGGGACCTAAATTTGTTGG GGGGACCTAGAAGCCCATTGGGAGCCAGGTAAATCAACCAATGAAGATTC GTCTCAGATGTGTATATAATAGCCAAAAAACCTTGCAATCAATTCATTCA GTCAAGAATCATTTACAATTTGGAACATATTATAGTCTTAGCAATGCAAT AACTTCTTTTTTATATATATGCAATACAATAGCATCAAAAAGTCAGACTT GAAAAATTAAAGGCTTGTGTACTTTTTAAAGCTATCTTTCACCTAGACTA AGAAGAAGCTAACCCCTGTGAATAGCAATTTTTGCCCTATGATACAAATT CCCCTTTTTCACAATTTTTTTCAGGTGATCAAGTGATATAATTGTAACTT TCCAATCCAACTTTTTTCCAAAGAACATTTTAAGCCTAATTTGAGGTTTG TAGCACCAACAGAACAGATTTTAGGATTTATTTCCAGGCAAAACCACGTT TTCCCCCGATTTCGGTCAGTTTTGGCCTAAATACCTAATTCTTTGAATTT TATATATATGGTAGAGGTATATAATTGTTACATTATCATCCTACTTTTTT CCAAAGAACATTTTGAGCCTAAGTTGAGGTTTATAGCACCATTAGAACAG ATTTTAGCTTTTATTCCCAAACAAACCCCGTTTTTCCCTGTTTTCGGTCA ATTTTGGCCTAAATACCTGAATTTTTAAATTTTATATTTATGGTAGAGGT ATATAATTGTTGCATTCCAATCCTCCTTTTTTCTAAGGAATATTTTAAGC CTAATTTGAGGCTTGTAGCAGCAACAGAACAGATTTTAGATTTTTTCCCA GGCAAAACCTTGTTTTTTCATGGATTCGGTCAATTTTGGCCTAAATACCT AATCATTTGAAGTCTATGTATATGGTAGAGGTATATAATTGTTGCATTCT AATCCTAGTTTTTTCCAAGGAATATTTTAAGTCCAATTTGAGGGTGGTAG CACCAACAGAACAGGTTCTAGGTTTTTTATCCAGGCAAAAATGCCCGAAA TTGGCCCATTTCGGGAATAAAAAAGGCCGGAGAACCGTCAAAAATTGAAA AAATCAAAAAATATCTCAGATTTGTGTTATTTGTGTCCCAACGGACCAAA AAAATTATGCAAACTTAATTTTGAAAAAAAAGTCTCTATACACTATAGCC CACTGCTAGTGCAAGGTTGAAGAATTCTCAACCATCATGTCTTGAATAGT ATTAAAATACTTTACCATCTTTTCTTTTCTTTTTTTTAATTTCTCGCGCG CGAGAAAGTCAGTGGCTTCCAACCTCCCTAACAGTAGTTATTTTTGGGGC AAAGTCAGAAAATACAAGATGTAGTGTTTTATTTGTGAAAATTTAACCTA TGATGGCGAGGCACCCTACACAATTTTTGAGGTCAAAGGTCCAAAACTAG ATGAACCCCCTGGCAGTGCTGAAAATAAGTAAATTTCAGTTGGCCGGTAG TTTTTTGAGGGCAACAAAAATAATTTGAGCAGGGGGTCTTGCAGAACCCC ATAGAAAAGTTCAAAATGACCTTTAGTTGGCTTGAACACCTGTATTAATT CAAAATCTATTTCTCTTTTAATTAGAAGCACTATTAAGTATTTATCTAAG CTTCAAGTCTTCAAATTTTAACCGGACAAAATGAAAGATTGAGCTTCAGA GTGGCCGATAGAAACTATGACATGACCGGTCACTGGCCATTATTTGCAGC ACTGCCTGTAGGTTGTGATTGGCACTACCTGCAAAAATTAGAAAAAATGG CATTTTTTGGCCTTTTCAGGTCTGTAAATATGTCAAACTGTGAGATTGGG AACTTGCATCAGTGGAGGCTAACATACATAGCCCTCAAATGAATGACCTG GCTGGTCATTAAAATACAATGTTGAATTAAAACAAAAATGGTAGAGTAGA GCTGCGAGCGCAGCTGCGTAGTTCATTTGTTTTGAAATTTTGTTGCTTTG ATTGGTCAGTCATTTGATGGCTAAGTTTCCCTCCACTGATGAAAGTTACC TGACTTCACGGAAAGTATTGCAAATCTTCTTTTTTTTCAATTTCTTGTTC TAGATTTTATGAAGAAACAGCAAAATCATCAGATTTTTTTTAAATTGTGC CTGTTGGAGTCGTTAAAGAGCCATTTTAAGCCAATTTTGAAAGCAAAATG TGTTTTAGGCCAAGCAGTCTAGACTTAAAAACTCTTATATCAGGATTAGA AACCTGGCTAGTCATACCTCTTATCCTTCCATTTGCAACAAAACAATGCT GACAAGTTGACACAACACATTGACAAAGTAATCACTGTGAGAAGTTTATA TTGAAATTTGCAACCAAACAAAAGTGGTCTCTTTTACTAATTGTTTTCTG GTGCTCCTTTGCGGACTGTTTACTTAATTTCTCCCAATAAGATTGCCACA TTTCACACAGCCCTTCTTTTTTACTCCCGTGGCTGGGTAGCTGCAAAATC TCACCCTTCATAACTTTTATTTGTTCCGAACCGTGATCCTATGTAGACTA TTTCTCATCTCCAATTCTCAGAAGGAAGCGGAAATTTGATGCAAGGGTTA GATTGTCAACAAAGTGCCGTAAATCATTGAAAAAATAAAAAAATCTTAAA TATTTTTATTTTGAAGAATTGGGGCCAAAAAAGTGAAATATGCATAACTT TTAAACTGGTTTATGTCTAAAATTTCCAGAGATGGAAGTCGTCAATAAAG TCTTTAAGCAAAATAAATTTTGAGTTTTTCACTTTTTTCAAAAATTCATT ATTACACCTTTAAAAAATGCTTTTAGCTAGAAAAAATCATCTTTATCAAA GAAGGCGTTTTTTAAACATGAGTCCCCCCTTAAACAGCAAATTACCCCTT ATCCATTTCTCCCCCCTCAATTTGGAATTCCATTTGAACTGTGCCCTTAT TTACAAACTTGCCCCTTAAATCTTCATTAAAATACGCCCTTAGATTTTTT GCTTTCAAGATTGTGATTTGTCTTCGGTATTTGATTTGAGCATGGATTTT TTTACAGACATGGCCCTTGGACTGCAAATCAGATGGAGGGGGCTGTAACG CACTTTGTGATAATGCCACACTTTGTAATAAAAATCTTTGTAATATGAAA AGCTGACACACTTTGTAATAACACCTAATTTCCATCCAAAACAAAACTTG GAGATTTTCTAAGATTTCAAAACTGTTAAACAATAAATGCAAGGTTATAA AAATGTAGGTGAAGTTGTCTGACATGCCTGGAAAATTAGTTAGGGGAGAC ATTCAAATCTTTCTTGGCAGGGCAATGGATTTTTTTATCATGAAAGTTAA AACATTCGTTCTCTTCATAGCCCCCAAAACATTTTATTACTACAGTCTTT TAAAATTTGGTTTGTTAAAAAAAAGTCAATTGATTATTCTTTCAACCATA TAAATCTTTTTCTTCGCTTTTCTTGCTTCATGGAAAGAACAAAGAATATA TGACTTTTCTATGATAAATGTTACTATAACTGGCCCATGATTAAGACAAT AAGATCATTCATTATTTTGCATTTTTAAGTATTTGGAGACTTTGGTGTAA CCCAGTCAGTCTATTTGGTTTATATTAAAATCCAAATCTTCAATTTTCTC TGTTTATAAGTGTATAATGAAGCAATTTAGAGGGCTTTTTACAAAGCCAT TTTTATGGCATTTAAATTTATATTTTATATCAAAGTGCGCCAGCTTTTGG TATTAAAAGTGCAGCAGGTATTGCAACTGTTGTGTTTATTGCAAAGTGTG TTAGAACAGGGCCAAAAAATCATTTCACCCACACAAAATTTTCGAATTTT CATCCTTAGTTTACTTACCACCTTAAACGGTATCTAAAGTATATTTAAGT ATAAAAAACTCTGCAATAGTATGAAAAGAGATACAGAACTACTCCCCCTT AAATTCAAAATAACTTTTTCTTTGGTCCCAGACATATAAATCCCCCCTCA TTTCTGAAAATTTCAAAAAGTTTCCCCTTGAGATTTTGCCAAAATTCAAG TCCCTCTTATTTTAAGGGGAGGGGGCTGAAACCATGAAGGCAAGCTTCTA CAAAATGTTGAGTAAAATTCTTTTTGCAGTGATAGTATTTTGGAGCTATA CTCAAGGGAAATCAAAATCCTTTGGGTTTGGGATACATCTATGTTGGCCT TTGAAAAATGCTTTTTTAATAAAGATGGTTTTTTCTTGCTAAAGAGCAAT TTTTAACCCTTTCCGGACGCACAGGCCATTGGGTGGCCCATGAATTGTGT TCCTATATGACGCACGGGCCACCAGGTGGCCCATAGCTTTGTAAAAGATT TTAACCGTTTTCGCGCCAAATACAATAACATGGTTTTGAATAATGATTTT GATATAAATTTCCCGTAACCTGCAAAAAAACGCTTTTCGGTATCTTGTTA CCAACTAGAATTAAAAATGTTCAATGTTTGTTGTAAATTTACTCAGGCTA AATCTGTAAGGGAAAAATTGCTCAAAATTTTGGACAAAAAATCACTTTAT TCAGATTCTTGGAACCCTTATGACATGAAATTTTTTTTACCCGGTCAGTA ATTCAATTCTCTAAATCATATTTAAAGTTCAAGGCGTAAAGCAAATGCCT TTTACTCTATTTCTTTATTCCATGTCGATAATTTTGCTGTTCCGAAAAAA AATCGTCACGTGACAAGGTGTCAGCCATATTTCCAAATTTTTTTTTTGGT ATTTCAAAACCCATATTACATGTGAAAAAAATGAGCTATTACTTATCGTG ATATCTTTTATCAATCACTTTCTATTGCAATTTTAGTGAAGTCAGTCAAA AATCAAATTTTTGTTTGCGTCATATAGCTGTGAAATCATGCGTCCGGAAA GGGCTAAAGACGCCATTATGAATTTTTGAAAAAAGTGAAAAACTCGAAAT TTATTTTGCTTAAATTAAATACTTTTTATTAAAGACTTTCATCTCTTGAA ATCCCAGACACATGAGTTAATCAGCAGTTGGAAAGTTATTAACTTGCAAA AATGGCCTTAAAAAGCATTTTGCTACCCAATATTTGATTAAAACAGCTTG TTTAGGTCTCAAAATGGGCACAATTTCTATGGAATAGGATTATTTTGTTG TTTCTATAAAATCTAGTACAACAACAAATTGAAAAAATAGGATTTGCAAT AGTTTTGACATTTTTATTAAAATGCCATTTTTTCCTAATTTTGGCCTGCA TTAGAATCAGTACCCCCAGGGGGGGGGTTCGGTCATTTTGGGCTTCTGAC CTTAAGAATTGCGCACTCCACCCTATTTATAAACATTTAAAAAACCATAA TTTTCCAAGAATTTTTTTGATTTTTTGCATGAAAGTAGTGTACCATAGGT AAAAGATGGCTCAAGCAGATTTTTGCAAAAAAAAATATTTGGCTTAAAAA ACGCATGTTTATCTATAAAAATCACTATTAATAAGCATACATCAATGTTC TTAGTCAAATTACTCAATTTCTTTATGAGATAGATCTTTCTTTTGCTCAT GAGGGCTTACTTTTGAAGAATATGTGTATTTCGACATGAAATTTTGGTTG CTTGGCGTGTTTTTATAGAAAAACTGGCCAAGTTCAAATCAATATTTTTT ATAAGCACATTATCAATTACTTTGGTATTAGCTTTCTCGAGATTGGCTCT TTCATTCTTTAAGACTTTTTGCACAAAGATGCATAACTATAAACCCTCGA ACGTGACGGAGCCCAATTTTCGAAAAAAGAAATGTTTTTGGACAATTTGG GCCAAAATACAGCTAAAAAGTGGGTTTTTTGGACTTTGTGAAAAATTGGA TCATTGATTTTTTCTGATTTTTTGCATGGAAGTAGGGTACCATCATAGGT AAAAGATGGCTCAGGGAAATTTTTGCAAAAAGATTTGTTGGCTCAAAAAA CGCATGTTTATCTATAAGAATCACTATTAATAAGCATACATCAATGTTCT TGGTCAAATTACTCAATTTTTTTATGAGATAGATGTTTTTTTTGCTCACG AGGGCTTACTTTTGAAGCATATGTGTGTTTAGACATGAAATGTTGGTTGC TTGGCGTGTTTTTATAGAAAAACTGGCCAAATTCGATATTTTTTTATAAG CACATTATCAATTACTTAGGTACTATTAGCTTTTCTCGAGATAAGCTCTT TCCCTTCTTTATGATTTTTTGCACAAAGATGCATAACTATAAACCCTCGA ATGTGACTGAGCCCGATTTTCGAAAAAAAAAATGTTTTTGGGCAAATTTG GGCCAAAAAACGGCTAAAAAAAGGGTTTTTTGGACTTTGTGAAATATTGG ATCGTTGTTTTTTTCGTTGATTTTTTGCATGAAAATAGGTAAAAGATGGG TCAAGCAGATTTTCGTAAAAAAACTTTTCAGCTCTAAAAATGCCTCTTTA TCTATAAGAATCACTATTAATAAGCATACATCAATGTTCTTAGCCAAATT ACTCAATTTTTTGATGAGATAGACGTCTTTTTATGCTCACAAAGTCTTGA ATATGAAAGAATATTTCAAGAGCATGATTGAAATTTTGGTTTCTGAACGT TTTTTTTATAAGAAACAAACGACTAATTTCAATAAATCGTCACTATTTGT GTTCTGAATGATTGTTTAACGTTCATGCTCACGTAGATATCAATTATATA TGTGTTAAATGTATACCTTTAAAGGGAAGAAATTTTCGCGGAATTTAATT TCGGGAATCAGAGTTTCAAAATGGCAAATTTTGCGGAATTTAATTTCGCG AATGAGCCAATTTCAAAAGTTTCACGGAATTTAATTTCGCGGTTGAGGGA ATTATTTGTTTACGAAAAGCCCTATTTTGCCCTAAAAAGACCAATTTTAG GGGTGATTTTTTTAATTGTGAGAATATTCATGTTTCGCGGAATTTGATTT TGCGGTTTACCCATTTTGGTGTGTTTCGCGGAATTTAATTCCGCAAAAAT TTCTTCCGCAAAAATTTCTTCTCGCAAAAATTTCTTCCCTTAAAAAGTAA CCAGGTAGGTCCATAAAAGTATCACTTGTTTAATTTGGTTTAGTGGTTCT CAAATTATAAGCTTTTAAAGTCAAAAACACGTAAAAAATGATGGGAGTAT TAACGCAATTAACGCAACTCTATGCAGAAAACCTCATATTTTCACTGTGT TAATTACTTTTACTGTCCCAATTAATGATCTCTGCTGATTTTCATCAATT ATCCTAACAAAATAGGAAAACAGTAATTCTGAGGGATTTTTCAAAAGACT TTTAGTGTAAAAAAAGGTTAAAAAATGTTTCTGTAAGCAGCCCTCGAATT TCAGGTCGGCATTCGGCAGTGCCGACCTAAAAGCCGACCAAAGAGTGCGT ATGGTCGGCAGTTCATTGCCGACCATATTCATTGATTCTCTCGGCAGCCG ACCATAAGTTATCTTTTAGGTCAGCAAAGCCGACCTTAACAGCAAAAAGT ATTAAAAGAGAAAAGAACCATATCGCACTCAAATAAAAAAACAAACATTG CCGTAGCCTTTTAAACAACTTTGCCGACCTAAAATATAGCTCAGATCGGC ATTGCCGACCTAAAAACAAGCTTAGGTCGGCAAAATTTTGCCGGCCTTCG TCCGGATTTGGACGGCACTTACGTGCCGACTTACTTTTACTTGAATTTCG AGGGCTGTGTAAAAATAGTTTCTGGTCTGTGGCGCATCCAAATATTTAAG TTTTAATGGAAAGGCAATCATTGAAGAAATGCTTAATTTTATACGCCTTT TTTCAAATAAATTTTGACTTCAAAAGCTTCTAACTTGAGAACCATTACCA ATTTTAAAAAGCTATATGCTAAATTTTAAGTTTGCCTTTCCTCTTGACAA TTAAAAAAGAATATAATAAAAACTCACATTATTTTGGACACAGTTAACCA TCAATCCTTTATATTTTATTCTGGGTCACCCAGTATGACGGCATTACACA AACCTTTAGTATGATTTTTGGAGGCTAGTGGGCCTGGGCCGTCATCGACA ATCAACAATTTGTTTTTTGGACCTACCCCGGTGGGGTGGAGGTCTTATAA ATTAACCCATGTTCGTTAGTTAGTTCGTTTAGTTACCAGCTTTTCTCGAT ATTGGCTCATTAGTTTTTTCTGATTTTTGGCACAAAGGCGCATGACCATA AACCCTCGAATGTGACGGAGCCTGATTTGTGAAAAATTGGATCATTAATT TTTTCTGATTTTTAGCATGAAAGTAGGGTACAATCATAGTTTAAAGATGG CTCAAGCAGATTTTTGCACAAAAAATTGTTTGGCTCAAAAATCGCATTTT TATCTATAAGAACCACTTTTAATAAGAATACATCAATGTTCTTAGCCATA TTATTATTATTATTATTTTTATTAGTTTTTTTTTAAGATGAAAATGTCAC GGTGGAGGGTAATGGTTTGAGTTTTTTAGAAACACTTACATTATTGGAAC TAATTTTCGCGGGAACTAATTTTTGCGGTCGAAAAAAAATTTTCGCGTTT TTTTCCATTCTGGAATTTTGGCGGNTGCATTTCGCGAGTTTTAATTTTCG CGTTTTTTTCCATTCTGGAATTTTGGCGGGTTTTAATTTTCGCGGTTTTG CCCTCTTTTGAACAAATTTCTTTCATTTTCCTAGGGATTTTTCAAATTTT TCGATAAAATTGGAAAAAATTGTATTTTGCGGGAATTAATTTTCAGGGTT TTCCACTCTCGAAATATTTCGCGGGATCAAATTTTCGCGATTTTGACAAA AAACCGTGAAAAACGCTAAAATTAAAACCCGCGAAAATTAGTTCCAATAA GGTATTATTTTTTTGGCTGAAAAATGAATCTTTATCTATGAGAATCACTA ATTATAAGCATAGATCAATGTTCTTAGCCAAATTATTATTTTATTATTAT TTTTTCTAAACAAAGAAAATATCACCTTAGTTCCATAACGTTCTCGAACG TTCTTATTAACCTTTGGACTCAAAAGATCGTTAGTGAGCGTTCTGGAACA TTCTGCAACGTTCTCGAGCGTTCTGGAACGTTCTGGAACGTCTCTGAACG TTCCAAACGTCCCTGAACGTTCCAAACGTCCCTGAACGTTTTAGAACGAT CGAGGACGTTCTGGAACGTTCTAGGAACGCTATGGAACGTTAGTGAACGT TCAGGAACGTCTCAAGAACGCTCCGTTTTATTTGTACTTCAAATAGCTTG TGATGACACAAATGTTCTTAGCCAAATTATTATTTTATGTTCGTTCGTTC GTTCGTTCGTTCGTTCGTTCGTTCGTTCGTTCGTTCGTTCGTTCGTTCGT TCGTTCGTTCGTTCGTTCGTTCNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN CCGAAAATTCCGGAAATATGCCGGAAAAACCGGTTTTTTGACTTTTTCTC GAATTTTCATTTTTAGTTTTTTCTGATTTTTTGCAGAAAGATGCGTATTC GGAATGCTCAAAAGATGGCCGAGTTCGATTTTTGAGAAGAAAATTTTTCC GGTTGCCGGAAATCGCCTTTTTTGCAGATTTTCATTGGATTTTTTCCTTG TATTTCTATGTTTTTCACACAAAAACATTATTGATAACAATGCTCACCAT CAAGCATGATTCAATTGTCAATAAAACTGATTTTTGCGACCAAAACTTCC TATTTATTTTATCCCTACAACCCTTCTCTCTCCCCCCATCAACGATCAAT GATGAATTTATTGTGTTGTGTATTTTCGCTAAATGCTATATTTTCTGACT GATTTTTTTCATATTTCTCTACACATTGCTATCAATGCTAACTAACTTTC ATCATCAGGTAGGTCCATTCAGCATGTTGCTTGTTTATTATTATTTTTTC TAACAGAAGAAAATGTCACAGTAGAGCGCAACGGTTTGAGTTTTCTGGAA ACCTTATTTATTAAGCTGTGCATTTTTCTGATAGTGGTTTTTATAAGGAA AAGCGCTTATTGCTTTTTTATTTCTTTTTCAAAAATCTTTTTCAATAGTG TTAATAGTTTCTCTCAATAGATATACTTTCATTTTCTTTATTTTGACCAG TTATGTCTTATGTATTTCATTGTTTCAATGTTCACTGATTACTTTGATAA CCAGGTAGGTCCATAAAGTATCGCTTGTTGTCTTCAAAAATAATTAAAAG AGAAGGGAAATCTCACCTACTATAGAAAGGGTGTGCACTTGCACTTGTCT ACATTTTTTGGGTAGAACAAGGAAGAATGTACCGAAATGAACTTCAATGG ATTTAGTACTTACCTTTAAATCATGCAAATTTGAGCTAACCTAAGGATTT CAGCTGTCTAGTGGTAAAATTTGTTTTTAACTATTATTTCCACCTAAGTG ATAAATTAAAGTTTATTAACAACATTACATTAACAGTCAAACTCTTCACG CCCCGTCCCAAGGAAGGCTGGATTTCATCCGCCATTTTTGGTGCTTTCCA AAAGTTAATTCTTGCTGGCACGTGGTAAGCAGACAATCCTTTGGAAAGCT GATTTTTTGTGTTTTGAAAATAGAATAAGTTTGGAAATACTAACTTAAAC AATTTCAATGAGGGTAATTGTTTCGCTTACACTTATTGCCATTTTTACCC TTATTCTCACTTCTACCACCATCAAGTTGAAACATTTTAAAAAAGTGTGA AAAGTGGCTTCTTCAGCTAACTTGCATCAGGCAATGTTTAAAAAAGAGAC CACGTTCCTTCTAATACGTGTCCGAAATAGTGGTCCTTCTAGGTAAAATT CTGACGGCAACAGAGCCTCATTCTAGGTCTTTATGTTACATTTTCAATCA GTACAACATATGGCACAAACGATCAGTGGAAACTTAGGTGGCAAAAAAAT TAAGCACTTTTGCCACTTTTAGACACATTTTGAAGTTGGTAAAAATGGTG ATTTTTAAGTTTTAGCATGACAAAATCTTATCATGTTTGGCTATTTGGTC AAGCCTTTGTCTTCCTTTTTGAAAGGACATATATGGCATTTAGGGTTATT GGATCTAGCTGAATACAATGATTTGTCATTCTCTCCCCCTTTGGGTGCTT TATTTCAATCAGATAGCTAGGGTAAACCATTTGTTCCTCTTGTTTTTCTT GAGCCAAAAAAAAAAGATCAAAGGGGCGAGAAAGAGTTGTAATCATCACC ACATTATCATTTTGCTTGGCCCATGGGTCATTGAGATTGCCCATGGGTTA TTGAGATTGCCCATGGGTCATTGAGATTGCCCATGGGTCATTGAGATTGG CAAACACCTCAACGCACTTACAGTTTTTGCGAATAAGGTAGTTACTTTGT ATTTAAAAAATATGTATGCTCCCCTAAAATGTATGTAAGATATTTGCCAG CTGGAAATATTTTCAATTTTTAAACAAAGGATAGCCTTATTTACTGCAAC TTTTACCACAGTATTGCTGGGTGCTGTGGCCAATTGCCAGGACTGCAAAC ATCAGAATTCCACAGAACAGATCTGAATTTCAAGGTAGGTAGATTTTGCC TAAGAATAGATCCACGTTTTCCAGGTATCCAAGCAGATTTTCTTAGAAAA GATCGCTGCTGGTTCAGAACAGATGATTTCAAAGAACCTCTCTGTGGATG CTTTCAAGTACAGAGAGGCTTTTCATGTCCAAGATTTAACTCATTACATT TTTGAATTTCAGTCCCATTCAGGGTCACTTTTTTCGCAAATTTCGAGTCC CACGTAGGGTCCATTTTTCGAACCTCAGCGGAGCACCCCTGTCGGTCGAC AAGGGTAGTCCCCCCCCCCCGGGTCCAATATTTAACTCATTATTTAGCAA CAGGTGACAAGAGATTGTGACAAATAAATCTTTACTATTAGCACAACAGC TTTTTTTGTTTTCATTCAAAGGATAACAAAAAACACTATATACCTTTTTT AATTTCTTATTGATATTTTGTAGATTCAATAATTGAAAAATGAGTGGAGG TCTTGCCCCCAGCAAAAGTACAGTTTATGTTGGTAATCTACCTTTCTCCC TTACTAATAATGATTTACACAAGGTTTTTGAAAAATTCGGACGGATAGCT AAAGTTACAATCTTAAGAGATAAAGTAACACGAACCAGTAAAGGCGTTGC TTTCGTTCAATTCATCGAGAGAGATTCTGCTATCACATGTTGTAAATCAG TTAATGAAAAAACGTTGTTTGAACGGAAAATAAAATGTGTCATTGCAAAA GACAATGGGAGAGCTTCAGAGTTCATTCGAAAAAAGGATTATCCAGATAA ATCTAGTTGTTATGAATGTGGAGAGACTGGACATCTTAGCTATGCTTGCC CAAAAAATTTACTTGGGAGCCGAGAGCCACCACCTAAAAAAGAGAAAAAA ACTAAGAAAGAGAAAGCAGAGGAGAAAGAACATTCAAAGAATTTAATCAA GAGTTATTATGATGCTGATGAGGCAAATGATGGTGTTAATGAAGAAGAAC AAGGGGAAGACCCTTATGAATCAAGTCTCAGTTATGCAATTGCTCTTGAT TCTAGTCAACAAAAAAGACATTTTTCCTCTATAGTTGTCCAACCTTCAAC ATCAAGGACTTCAACAGATTACGATGGTTACAAGGATAATAATGATAGGG AAGAAGAGAGTTATGTCAAAAGAAAAAAGTATAAACCGTCATCATATTTC AGTGACGAGGAGGAAGAAGATGAATCTTAGGATAACAATTTGTGAACTTC TTCTTTGTTCATTTAGTATCACTAAATTTGCAATAAAAATATTTGGCTGA TTTATAAATTATTATGTAAGCCAAATGCCTTTTTTAAATCAATGACATCT TAGAATAAAAATAAAATGCTTCTGATTATTCGAACAATATGAAGGAATGG TTTGATAAGAACACTTTTTAAATTTAGCAACTTGATTTCTGTGCTTCTAA AAAC
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_045485XLOC_045485Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073319-exon-scaffold_9-1575043694:220815..220839TCONS_00073319-exon-scaffold_9-1575043694:220815..220839Clytia hemisphaericaexon
TCONS_00073319-exon-scaffold_9-1575043694:192786..193766TCONS_00073319-exon-scaffold_9-1575043694:192786..193766Clytia hemisphaericaexon
TCONS_00073319-exon-scaffold_9-1510915933:220815..220839TCONS_00073319-exon-scaffold_9-1510915933:220815..220839Clytia hemisphaericaexon
TCONS_00073319-exon-scaffold_9-1510915933:192786..193766TCONS_00073319-exon-scaffold_9-1510915933:192786..193766Clytia hemisphaericaexon
TCONS_00073319-exon-scaffold_9-1491911889:220815..220839TCONS_00073319-exon-scaffold_9-1491911889:220815..220839Clytia hemisphaericaexon
TCONS_00073319-exon-scaffold_9-1491911889:192786..193766TCONS_00073319-exon-scaffold_9-1491911889:192786..193766Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_9supercontigscaffold_9:192786..220839 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0 0 0 1.36936 8.77322 5.17754 9.86714 6.76122 0 8.50114e-10 0 0 0 0 0 0 0 0 0 0 0 0 0 0 5.55094 6.16303 0 0 0 0
Blast
BLAST of TCONS_00073319 vs. Swiss-Prot (Human)
Match: ZCRB1 (Zinc finger CCHC-type and RNA-binding motif-containing protein 1 OS=Homo sapiens GN=ZCRB1 PE=1 SV=2)

HSP 1 Score: 198.364 bits (503), Expect = 3.161e-61
Identity = 88/128 (68.75%), Postives = 109/128 (85.16%), Query Frame = 3
Query:   42 MSGGLAPSKSTVYVGNLPFSLTNNDLHKVFEKFGRIAKVTILRDKVTRTSKGVAFVQFIERDSAITCCKSVNEKTLFERKIKCVIAKDNGRASEFIRKKDYPDKSSCYECGETGHLSYACPKNLLGSR 425
            MSGGLAPSKSTVYV NLPFSLTNNDL+++F K+G++ KVTI++DK TR SKGVAF+ F+++DSA  C +++N K LF R IK  IA DNGRA+EFIR+++Y DKS CYECGE+GHLSYACPKN+LG R
Sbjct:    1 MSGGLAPSKSTVYVSNLPFSLTNNDLYRIFSKYGKVVKVTIMKDKDTRKSKGVAFILFLDKDSAQNCTRAINNKQLFGRVIKASIAIDNGRAAEFIRRRNYFDKSKCYECGESGHLSYACPKNMLGER 128          
The following BLAST results are available for this feature:
BLAST of TCONS_00073319 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
ZCRB13.161e-6168.75Zinc finger CCHC-type and RNA-binding motif-contai... [more]
back to top