Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00073309 (transcript) - C. hemisphaerica

Overview
NameTCONS_00073309
Unique NameTCONS_00073309
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length3134

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00073309 ID=TCONS_00073309|Name=TCONS_00073309|organism=Clytia hemisphaerica|type=transcript|length=3134bp
aagaaaacaaatgttGTGATGGATTTCTCCCAATTCACCATCTCTGACTA
GTCAGTAGACTAGAATTCACTTCCAGCTCTAGCCAATGGCAATTGAGTCC
TCGGGTTCCACATGGACCTGTAGCTCAATAGTAGAGCAAATGCCAGCaaa
tggcatggttgtgagtttgagtctcgccggatccgttggttttccaacgg
ttctggtggctggtcagaagacaacatgagagcgactgtattcacttcac
tGTAAAACTAATGTTGGCAAAGAAAAGTTAAGTTTCTTTTAATGAAGTAT
GAAATGACCTCAATAAAGCACCCTCTTTTACCTGAATGTAATTCTTTAAA
CTTGTTGTTTACCTACCTACTTAGAATGATGTTTAAAATGTCCAAGATTG
CTAGAAAACTCATGACAGGAACAAACCTCCAACAACAAATAAGAAAGATA
TCTGGTTATGTTGCTGTAGATAATGGAACATTATTTTATGAAAGGCATGG
CTTAGGATCGGAAGCTGTTCTTTGTATCCCTGGTGCGCTTGGTTCAACTC
AAtcagatttttcataccaattgaGCGAAATGTCAAAAGATTTCACAATG
GTTTCATTTGATCCAAGAGGTTATGGAAAATCAAAGAAAGTATTCCGAGa
tttatcaaaaaacttttacgAAGATGATGCTAAAGATGCAGTCAAGGTTA
TGGAAAAGTTAGGTTTTGAGAAATATTCCATTCTTGGCTGGAGTGATGGT
GGTATGGTGGGAATGATAGTGGCAGGAATGGCACCTCATGTTGTAAATAA
CCTTGTAGTGTGGGGATCAAACGCCTTTTTGACAGAAAAAGACAAAGCAT
TGGGTGTCTCAATGAGAGATTTGAACAAATGGAGTGAAAGAATGAGAAAA
CCAATGGAAGATATTTATGGTAAAGAAGGCTTGGAGAAGTTGTGGCATGG
ATGGTGTGATGGCTATTCTGCTATTGATGACGTGTGTTGTGATAGCTTAC
CCAAAATCAAGTGTCCAACTTTCATTTTACACGGAATGAAAGACCCCATG
TTAGATTCCTGTCATTATAAATATCTACATGATAATATCAAAGGTTCAGA
ACTTTACATATTTGAAAACGGCAAACATAACATTCACATGAGGTATCATG
CAGAATTTAATGAACTGGTCACAGACTTTATCAAGAAAAATAATACATCC
AAGCTGTGATGATGTCAGGATTACTTAAAATGTTCTGGATTTACATTATA
GTTCCACAAGAAAATTTATTATGAAATCTTTACTATTTGTTATCAAGCAA
CGAAATTTTTGAAGGCAACGAGACCAGCCTCATAGTATCAGCCTACTCCA
ACATCGATAGTATTTTTTCGGGTTTCTTTACATAATTTAATTAGATTTTA
TTAGAtaaattttgtaatattttcaaTGCATTTATATAAAGCttttttgt
agatttatattttATCGTTTTTAACTTAAGCTAAAGTTTTCTGCTTTGGT
GTTGGTTGATTCGGTTTTAAGgtgtgttttgattttttagagTTTTCTTG
AGACTCTTGAGTATTATTTAGACATCGTTTGTCCTTTCGGTGAACCATCA
GTTGGAATCTCTTGTTAACCTTTTCGCAGTACATTGAGCAAGTTTCACAA
CTAttctcttatttttttcctcgtagataaaaaacaaatcttagGCCAAC
CAAACACCAACAATGAAGCCACTTTTTCTTGATGGCGAACAAGTAGAACA
ACACTTACCATTACTCGATTTGTTGGATGGCATTGAGAAAAGTTTTGTCA
ACTATTCCAATAAAATCGAAGGACTTATTCATCCTCAACGATTAGTTCTT
AACGTCCAAAACAATGATTTATTTTTCGTCAAACCAGTTGTATCAACACC
CGACAAAACAATTTGTACCAAACTCCTGACTCTATTTCCCGAGAACGAGG
CCAAATACCAAGTACCGTCACACCAAGCAATCGTTACTGTTTTTGATTCA
GACACAGGTTCACTCCAAGCTGTCATGGATGGTGTTGCAGTGACCGATTT
GAGGACAGCTGCTGCAAGTGCAATAGCTCGAAAGCACTTAGCACCTCGGG
GTGATTCAAATATTCTAGCTATAGTGGGTACAGGGCATCAAGCTGTCAGT
CATGTCAAGTTATTCCGTGCTGTCTCAGGTTACAAAGAGATTCGCGTGTG
TAGTCGGAGTAATCCTCAGAGAGCGCAACAATTTGCAAAGCAATGGGGGA
TCAAAGCTGCTTCCAGCGTACAGGAAGGTGTTCGAGACGCAGATATAGTT
GTCACTGTCACCAAATCTTCGGCACAGCCTGTTGTCTTATACGAATGGCT
CAAACCTAACGCCTTAGTTGTCATCGTCGGTTCACCCATATCAAGTCAAC
GTGATGTTGACAGTTCTACAATGTTGAACTCAATAGTGGTTGCTGATTCT
AAACCGGGTGCTATGGAAACGAGTGGTGACGTAATCCAATCAGGATGTGA
AGTTCATGGGGAACTTGGGGAAGTCATTGGTGGAAAAATGAAAGTTGGTT
TCGATAAAATGAGAGTTTTTAAGTCTTCTGGTCTAGCTGTGCAGGATTTA
GTTGCTGGTAAAATAGTTGTACAGAATTACAGGAAAGCAATTGGAGAATG
TTAATGGgaaatatattttctgattcacAGTGGGTATCTCTTGTTGGAGC
CCAAGTATGGGAATGTAGTGTTTTACATCTATAGACTTTAGTAATAATAA
gtatgtttttcttcttttcgaCCATATTACTTTTTAGATATTGttataaa
agtgaaatttttttattagctGAATTTTTTATACATTTAAAATCATAGCG
ATTATGCGAAGCTCGACACTTATTGTTTGTGCACTCTGGGGACAATAGCA
GTCTATGCTAAAGACGAAACAAGTGTCTGCGGATAGAtacatttaaaatt
atacattctACCAGTTTATGAACCAATTCAATtactttctttagaaaaag
ctgTTAACGATGAGCACATCGGTTTCGTTTGATTAAAATAATTCGGGTCC
GCAGATCCCCTTTTGTTTGATTGCTCTGTTATCTGTATTTCGGGTCTTTC
AGATAATGTTGAAACGATATCGCCTGACACCAGC
Run BLAST on NCBI

protein sequence of TCONS_00073309-protein

>TCONS_00073309-protein ID=TCONS_00073309-protein|Name=TCONS_00073309-protein|organism=Clytia hemisphaerica|type=polypeptide|length=313bp
MKPLFLDGEQVEQHLPLLDLLDGIEKSFVNYSNKIEGLIHPQRLVLNVQN
NDLFFVKPVVSTPDKTICTKLLTLFPENEAKYQVPSHQAIVTVFDSDTGS
LQAVMDGVAVTDLRTAAASAIARKHLAPRGDSNILAIVGTGHQAVSHVKL
FRAVSGYKEIRVCSRSNPQRAQQFAKQWGIKAASSVQEGVRDADIVVTVT
KSSAQPVVLYEWLKPNALVVIVGSPISSQRDVDSSTMLNSIVVADSKPGA
METSGDVIQSGCEVHGELGEVIGGKMKVGFDKMRVFKSSGLAVQDLVAGK
IVVQNYRKAIGEC
Run BLAST on NCBI

transcript from alignment at scaffold_9:243986..248068+

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00073309 ID=TCONS_00073309|Name=TCONS_00073309|organism=Clytia hemisphaerica|type=transcript|length=4083bp|location=Sequence derived from alignment at scaffold_9:243986..248068+ (Clytia hemisphaerica)
aagaaaacaaatgttGTGATGGATTTCTCCCAATTCACCATCTCTGACTA GTCAGTAGACTAGAATTCACTTCCAGCTCTAGCCAATGGCAATTGAGTCC TCGGGTTCCACATGGACCTGTAGCTCAATAGTAGAGCAAATGCCAGCaaa tggcatggttgtgagtttgagtctcgccggatccgttggttttccaacgg ttctggtggctggtcagaagacaacatgagagcgactgtattcacttcac tGTAAAACTAATGTTGGCAAAGAAAAGTTAAGTTTCTTTTAATGAAGTAT GAAATGACCTCAATAAAGCACCCTCTTTTACCTGAATGTAATTCTTTAAA CTTGTTGTTTACCTACCTACTTAGAATGATGTTTAAAATGTCCAAGATTG CTAGAAAACTCATGACAGGAACAAACCTCCAACAACAAATAAGAAAGATA TCTGGTTATGTTGCTGTAGATAATGGAACATTATTTTATGAAAGGCATGG CTTAGGATCGGAAGCTGTTCTTTGTATCCCTGGTGCGCTTGGTTCAACTC AAtcagatttttcataccaattgaGCGAAATGTCAAAAGATTTCACAATG GTTTCATTTGATCCAAGAGGTTATGGAAAATCAAAGAAAGTATTCCGAGa tttatcaaaaaacttttacgAAGATGATGCTAAAGATGCAGTCAAGGTTA TGGAAAAGTTAGGCATGTCAATTCtcttttttgttgtattttgattattt ttttagtaTCAATAAAACGAATGAAGGGGGTCCCCTGATAACTGATTCTG CGACATTGaacatgaaaaaaaagattttaaaaaaagaaagatttttgttt GGATAAATAATTATGCTTcactttttccctaaaatacTGTTGTTTTTTAT GTTAGTGCAATCTTCATTGTACCAAGATAATAGGCAATCTCTTACTATAA ATTTTACACTTTGCTTTTTAGGTTTTGAGAAATATTCCATTCTTGGCTGG AGTGATGGTGGTATGGTGGGAATGATAGTGGCAGGAATGGCACCTCATGT TGTAAATAACCTTGTAGTGTGGGGATCAAACGCCTTTTTGACAGAAAAAG ACAAAGCATTGGGTGTCTCAATGAGAGATTTGAACAAATGGAGTGAAAGA ATGAGAAAACCAATGGAAGGTAAAATTTTtctgcatttaaaaaaaatctt attagtcatttaaaaaaaatcttattagTCATTTGTGAAATATACGTTTG ATACATAAGGGTTTTAAAGTTTTCATGAAGACTGTTAGCCTTTTGGGGTA AAGGCTTCAAAGAAAATTGTCTACACAGAAAATCTGAACTCCTTTTATAT TTGAATGAACAtcgtttctagaggggtcaagacccccccttaggtaagag tccctccttaggaaattcatttaaaatttcacaccccccttagaaaatca gtataaatgaaacAATTGTGCAAGAGTCATAATTAGGTTAGATGATTTTT Gatccccccttaggtaagaagaccccccttaactggcaaccccccttagg aaagtcatacttttaacacccccccccttgcttttggtttatcaaaaccc aagaccccccctaaatgtaggggggGTAACAACTATGATGAATATTCGAC CCTGGTTAACTCCAACACAACACCCttctcagctggcacacaacgttgtt tttaCGTTCAAaatcaaataacgttatttggacgttatgaatgtcaaatg gacgttgttttgacgttgtgtgccgtctgggttTATTACATTACTAAGGT TTGGTTGGTGTACCCAACATCATATCATTTTAAAGATTGGTATTTAACTT TCTTTCCAGATATTTATGGTAAAGAAGGCTTGGAGAAGTTGTGGCATGGA TGGTGTGATGGCTATTCTGCTATTGATGACGTGTGTTGTGATAGCTTACC CAAAATCAAGTGTCCAACTTTCATTTTACACGGAATGAAAGACCCCATGT TAGATTCCTGTCATTATAAATATCTACATGATAATATCAAAGGTTCAGAA CTTTACATATTTGAAAACGGCAAACATAACATTCACATGAGGTATCATGC AGAATTTAATGAACTGGTCACAGACTTTATCAAGAAAAATAATACATCCA AGCTGTGATGATGTCAGGATTACTTAAAATGTTCTGGATTTACATTATAG TTCCACAAGAAAATTTATTATGAAATCTTTACTATTTGTTATCAAGCAAC GAAATTTTTGAAGGCAACGAGACCAGCCTCATAGTATCAGCCTACTCCAA CATCGATAGTATTTTTTCGGGTTTCTTTACATAATTTAATTAGATTTTAT TAGAtaaattttgtaatattttcaaTGCATTTATATAAAGCttttttgta gatttatattttATCGTTTTTAACTTAAGCTAAAGTTTTCTGCTTTGGTG TTGGTTGATTCGGTTTTAAGgtgtgttttgattttttagagTTTTCTTGA GACTCTTGAGTATTATTTAGACATCGTTTGTCCTTTCGGTGAACCATCAG TTGGAATCTCTTGTTAACCTTTTCGCAGTACATTGAGCAAGTTTCACAAC TAttctcttatttttttcctcgtagataaaaaacaaatcttagGCCAACC AAACACCAACAATGAAGCCACTTTTTCTTGATGGCGAACAAGTAGAACAA CACTTACCATTACTCGATTTGTTGGATGGCATTGAGAAAAGTTTTGTCAA CTATTCCAATAAAATCGAAGGACTTATTCATCCTCAACGATTAGTTCTTA ACGTCCAAAACAATGATTTATTTTTCGTCAAACCAGTTGTATCAACACCC GACAAAACAATTTGTACCAAACTCCTGACTCTATTTCCCGAGAACGAGGC CAAATACCAAGTACCGTCACACCAAGCAATCGTTACTGTTTTTGATTCAG ACACAGGTTCACTCCAAGCTGTCATGGATGGTGTTGCAGTGACCGATTTG AGGACAGCTGCTGCAAGTGCAATAGCTCGAAAGCACTTAGCACCTCGGGG TGATTCAAATATTCTAGCTATAGTGGGTACAGGGCATCAAGCTGTCAGTC ATGTCAAGTTATTCCGTGCTGTCTCAGGTTACAAAGAGATTCGCGTGTGT AGTCGGAGTAATCCTCAGAGAGCGCAACAATTTGCAAAGCAATGGGGGAT CAAAGCTGCTTCCAGCGTACAGGAAGGTGTTCGAGACGCAGATATAGTTG TCACTGTCACCAAATCTTCGGCACAGCCTGTTGTCTTATACGAATGGCTC AAACCTAACGCCTTAGTTGTCATCGTCGGTTCACCCATATCAAGTCAACG TGATGTTGACAGTTCTACAATGTTGAACTCAATAGTGGTTGCTGATTCTA AACCGGGTGCTATGGAAACGAGTGGTGACGTAATCCAATCAGGATGTGAA GTTCATGGGGAACTTGGGGAAGTCATTGGTGGAAAAATGAAAGTTGGTTT CGATAAAATGAGAGTTTTTAAGTCTTCTGGTCTAGCTGTGCAGGATTTAG TTGCTGGTAAAATAGTTGTACAGAATTACAGGAAAGCAATTGGAGAATGT TAATGGgaaatatattttctgattcacAGTGGGTATCTCTTGTTGGAGCC CAAGTATGGGAATGTAGTGTTTTACATCTATAGACTTTAGTAATAATAAg tatgtttttcttcttttcgaCCATATTACTTTTTAGATATTGttataaaa gtgaaatttttttattagctGAATTTTTTATACATTTAAAATCATAGCGA TTATGCGAAGCTCGACACTTATTGTTTGTGCACTCTGGGGACAATAGCAG TCTATGCTAAAGACGAAACAAGTGTCTGCGGATAGAtacatttaaaatta tacattctACCAGTTTATGAACCAATTCAATtactttctttagaaaaagc tgTTAACGATGAGCACATCGGTTTCGTTTGATTAAAATAATTCGGGTCCG CAGATCCCCTTTTGTTTGATTGCTCTGTTATCTGTATTTCGGGTCTTTCA GATAATGTTGAAACGATATCGCCTGACACCAGC

Coding sequence (CDS) from alignment at scaffold_9:243986..248068+

>TCONS_00073309 ID=TCONS_00073309|Name=TCONS_00073309|organism=Clytia hemisphaerica|type=CDS|length=942bp|location=Sequence derived from alignment at scaffold_9:243986..248068+ (Clytia hemisphaerica)
ATGAAGCCACTTTTTCTTGATGGCGAACAAGTAGAACAACACTTACCATT
ACTCGATTTGTTGGATGGCATTGAGAAAAGTTTTGTCAACTATTCCAATA
AAATCGAAGGACTTATTCATCCTCAACGATTAGTTCTTAACGTCCAAAAC
AATGATTTATTTTTCGTCAAACCAGTTGTATCAACACCCGACAAAACAAT
TTGTACCAAACTCCTGACTCTATTTCCCGAGAACGAGGCCAAATACCAAG
TACCGTCACACCAAGCAATCGTTACTGTTTTTGATTCAGACACAGGTTCA
CTCCAAGCTGTCATGGATGGTGTTGCAGTGACCGATTTGAGGACAGCTGC
TGCAAGTGCAATAGCTCGAAAGCACTTAGCACCTCGGGGTGATTCAAATA
TTCTAGCTATAGTGGGTACAGGGCATCAAGCTGTCAGTCATGTCAAGTTA
TTCCGTGCTGTCTCAGGTTACAAAGAGATTCGCGTGTGTAGTCGGAGTAA
TCCTCAGAGAGCGCAACAATTTGCAAAGCAATGGGGGATCAAAGCTGCTT
CCAGCGTACAGGAAGGTGTTCGAGACGCAGATATAGTTGTCACTGTCACC
AAATCTTCGGCACAGCCTGTTGTCTTATACGAATGGCTCAAACCTAACGC
CTTAGTTGTCATCGTCGGTTCACCCATATCAAGTCAACGTGATGTTGACA
GTTCTACAATGTTGAACTCAATAGTGGTTGCTGATTCTAAACCGGGTGCT
ATGGAAACGAGTGGTGACGTAATCCAATCAGGATGTGAAGTTCATGGGGA
ACTTGGGGAAGTCATTGGTGGAAAAATGAAAGTTGGTTTCGATAAAATGA
GAGTTTTTAAGTCTTCTGGTCTAGCTGTGCAGGATTTAGTTGCTGGTAAA
ATAGTTGTACAGAATTACAGGAAAGCAATTGGAGAATGTTAA
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_045478XLOC_045478Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073309-exon-scaffold_9-1491911889:243986..244697TCONS_00073309-exon-scaffold_9-1491911889:243986..244697Clytia hemisphaericaexon
TCONS_00073309-exon-scaffold_9-1510915933:243986..244697TCONS_00073309-exon-scaffold_9-1510915933:243986..244697Clytia hemisphaericaexon
TCONS_00073309-exon-scaffold_9-1575043694:243986..244697TCONS_00073309-exon-scaffold_9-1575043694:243986..244697Clytia hemisphaericaexon
TCONS_00073309-exon-scaffold_9-1491911889:244957..245154TCONS_00073309-exon-scaffold_9-1491911889:244957..245154Clytia hemisphaericaexon
TCONS_00073309-exon-scaffold_9-1510915933:244957..245154TCONS_00073309-exon-scaffold_9-1510915933:244957..245154Clytia hemisphaericaexon
TCONS_00073309-exon-scaffold_9-1575043694:244957..245154TCONS_00073309-exon-scaffold_9-1575043694:244957..245154Clytia hemisphaericaexon
TCONS_00073309-exon-scaffold_9-1491911889:245845..248068TCONS_00073309-exon-scaffold_9-1491911889:245845..248068Clytia hemisphaericaexon
TCONS_00073309-exon-scaffold_9-1510915933:245845..248068TCONS_00073309-exon-scaffold_9-1510915933:245845..248068Clytia hemisphaericaexon
TCONS_00073309-exon-scaffold_9-1575043694:245845..248068TCONS_00073309-exon-scaffold_9-1575043694:245845..248068Clytia hemisphaericaexon
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073309-proteinTCONS_00073309-proteinClytia hemisphaericapolypeptide
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_9supercontigscaffold_9:243986..248068 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
41.9957 41.0054 16.6279 14.2721 27.3778 19.2291 18.9572 19.5202 15.4334 15.5945 9.58551 9.38731 7.60343 8.5325 14.5473 19.2971 19.3688 16.3557 5.12271 5.74648 12.166 11.9158 30.5685 27.9857 15.9393 14.3207 15.2865 11.9751 20.6905 21.3942
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR003462ODC_Mu_crystall
IPR023401ODC_N
IPR016040NAD(P)-bd_dom
Blast
BLAST of TCONS_00073309 vs. Swiss-Prot (Human)
Match: BPHL (Valacyclovir hydrolase OS=Homo sapiens GN=BPHL PE=1 SV=1)

HSP 1 Score: 223.787 bits (569), Expect = 2.643e-65
Identity = 108/251 (43.03%), Postives = 165/251 (65.74%), Query Frame = 1
Query:  451 SGYVAVDNGTLFYERHGLGSEAVLCIPGALGSTQSDFSYQLSEMSKD-FTMVSFDPRGYGKSKKVFRDLSKNFYEDDAKDAVKVMEKLGFEKYSILGWSDXXXXXXXXXXXXPHVVNNLVVWGSNAFLTEKDKALGVSMRDLNKWSERMRKPMEDIYGKEGLEKLWHGWCDGYSAID-----DVCCDSLPKIKCPTFILHGMKDPMLDSCHYKYLHDNIKGSELYIFENGKHNIHMRYHAEFNELVTDFIK 1185
            S  VAV+   L Y++ G G  AVL +PG LGS ++DF  QL  ++K  FT+V++DPRGYG S+   RD   +F+E DAKDAV +M+ L F+K S+LGWSDGG+  +I A   P  ++ +V+WG+NA++T++D  +   +RD++KWSER RKP+E +YG +   +    W DG          ++C   LP+++CP  I+HG KDP++   H  ++H ++KGS L++   GKHN+H+R+  EFN+L  DF++
Sbjct:   41 SAKVAVNGVQLHYQQTGEGDHAVLLLPGMLGSGETDFGPQLKNLNKKLFTVVAWDPRGYGHSRPPDRDFPADFFERDAKDAVDLMKALKFKKVSLLGWSDGGITALIAAAKYPSYIHKMVIWGANAYVTDEDSMIYEGIRDVSKWSERTRKPLEALYGYDYFARTCEKWVDGIRQFKHLPDGNICRHLLPRVQCPALIVHGEKDPLVPRFHADFIHKHVKGSRLHLMPEGKHNLHLRFADEFNKLAEDFLQ 291          
The following BLAST results are available for this feature:
BLAST of TCONS_00073309 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
BPHL2.643e-6543.03Valacyclovir hydrolase OS=Homo sapiens GN=BPHL PE=... [more]
back to top