Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00073302 (transcript) - C. hemisphaerica

Overview
NameTCONS_00073302
Unique NameTCONS_00073302
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length2581

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00073302 ID=TCONS_00073302|Name=TCONS_00073302|organism=Clytia hemisphaerica|type=transcript|length=2581bp
gtCAGTACTTTGCAAGTTTATAAACGGAACTCTTAAGTTCCGGCATTGTT
CCGGATGATCACAATGCTGACATCATCTGTttggaaaatgaaagtgattt
ccATGAATTTCCAACTGTTTTTTTCCTGAGTTTTTGTTGTGTCAGCCAGA
CGTGAATGACCacattattttttattcaaataaagAGTTGGTGCATCATT
CCAAACTGAAAGATGGCTACAAAAAGAAATATGATTTTACGGATTCAAAC
ACCTGAAGGGATGAGGCGAATTCAAGTTGGTGGAGCTGATACTGTTAATA
CACTATACGAAAagGTCCAATCTTTTCTAAAACTCCAAACGAATGGCTGG
TCCATTTACAAAGACAGAGGCTTGAACGACGAATTGAGTAAAAGCTCCAG
GAAAACATTGAAAGGCCTTCAACTGAATCATGGTGATGTTATTTACATGA
AAGAAACTGGCCATTTTGTATCCAACAGTCCTACCTCTATGGACGATCGA
CCCTCATCCAGTCAAAGCACTGACTCGACAACAGTGCAAACAGAGAAGGA
AGACAACACTTCAAAACTGGATGTTGTAGAAGACGAAATCGATGTCTTAT
TATCGCATCAATCAGGTCTCATCAAACGAGATCGGCATCCTCTTCTATGC
CGGCACGGTAaacaaggacaatgtttaaatTGTGCGCCACTGGAACCTTA
CAACGAAGACTACCTCAAAAGTTTGAAACCACCTGCAAAACATCTCTCAT
TTCACGCATACTTGAAGAAAATGAAATCTGGCGTCGCGAAAGGCAAATAT
ATATCGTTAGAAGACGTAAATTGCAAAATCAAACCAGGCTGTACGGAGCA
TCCACCCTGGCCTAAAGGAATTTGCACCAAATGCCAGCCTGGCGCTGTCA
TGCTAAATAGACAGACATACAGACATGTGGACAATATCATGTTCGAAAAT
CCTGTCATCATGGATCGATTTTTGAATTACTGGCGAAAGACAGGAGGGCA
GAGGATAGGTATATTATATGGTAAATATGAGAAACACGAGAACGTTCCTT
TGGGCATCCGAGCGACAGTAGCTGCCATTTATGAACCTCCTCAAGACAGT
AATAAAGATCGTATTCAACTCCTCCCCAACCCACAACAAGAGAGTGTTGA
TATACTGGCATCTTACTTTGGTCTCAAACAGGTTGGATGGATAGTTACCG
ACCTAATACCGGACACCGAGAAAGCCGGACTGGTCAAACACTTACGTCAC
GCCAAAACACATTTCCTGAGCGCACAGGAATGCATGATGGCGGCCGACTA
TCAAAACAAACATCCCAATCCTTCCAAGGAGTCCAAAACGGGCCGCTTTG
GTTCGAAATTCGTCACTGTCGTAGTGTCAGGTGACGAAGAGCAACACATT
CATTACGAAGGATGGCAGGTATCGAACCAATGCATGGCGTTAGTACGTGA
CCAATGTCTTGTTCCCACGGTCGACGATTCAGCCCTGGGTTATATCAAAG
AGTCATCCAGTGAACAGTTTGTACCTGATGTTTTCTATAAAGTGAAAGAT
GAATACGGAAATGAAGTGACGAAAATTGGTCGACCCATGCCCATCGAATA
CTTTCTCATCGAGGTACCAGCAGGCTTCCCAATGGAACCTCAATCCACTT
TCATTTCAAGCGACCCAACAAATTTATTTCCCATCGAAAACAGAACGCAA
ATGATGGAAAACCAGAACTTCGAGACATTAACGCAACATTTGAATCGTTT
GAAATCAAGTGACGTGAATCTGTTGGAACATTTCTTAGATTTCCATTTTC
TTCTCTTCATCATGACCAATGAATTCATATCCATAAGGCACAAAATGAGC
GATCTGTGTAAAGCATTAAAACAAAGAGATCAAATGTTGTTTCATCAATG
GTTGGAATCTGACGAATGGAAAACCGTTGAAACTATGGTACAAACTCACG
CACCCATGGCAACGGACAGCCCGATGGACGGAAGTGATGCTGTTCCCATG
GAAACAGACAATAGTGTGACTATTACTGGTTGGACGTGTCCGCATTGCAC
TTTTATCAACAAAAATCCAACTTCAGACACATGTGATATGTGCACACTAC
CAAAAAGTTAATTACTTTGAATTAGACTTTgtggtatattttttacaatc
tGACTTCTCTTCAATATCGCTGCTCtttagatttttaaaagaataaaaat
ttaaCTGAGATTTTGGACTTTGTTTTCTTCCGAAACTTTGCAATCTTTTA
TACATCGGTGGGTCTTTGGCAGAAAATTTCATCCCAACTCAAGAAATGGG
AGTTTGTTTTTAAGAGTCAACTACAATTCTAACAGCTTTGCGATAATTTT
GCTGCACTTgatttttgttggtttgttggCCTGCGTTTTGTTAGCAAGTA
AGAATTAGTGTGTTTTCAATTGttcaatttttgttgatttttcgtAAAAT
AGTAGGACcaatatcaataattttttataagaactttaaatatttattaa
gttttattttgaaaatatcaaaaaagatTCTCAACATTTTTGGACGATTC
TACTTAATCTTCAGTTCAAGATATGTTCTGT
Run BLAST on NCBI

transcript from alignment at scaffold_9:112670..134111+

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00073302 ID=TCONS_00073302|Name=TCONS_00073302|organism=Clytia hemisphaerica|type=transcript|length=21442bp|location=Sequence derived from alignment at scaffold_9:112670..134111+ (Clytia hemisphaerica)
gtCAGTACTTTGCAAGTTTATAAACGGAACTCTTAAGTTCCGGCATTGTT CCGGATGATCACAATGCTGACATCATCTGTttggaaaatgaaagtgattt ccATGAATTTCCAACTGTTTTTTTCCTGAGTTTTTGTTGTGTCAGCCAGA CGTGAATGACCacattattttttattcaaataaagAGTTGGTGCATCATT CCAAACTGAAAGATGGCTACAAAAAGAAATGTAAGTTTGGTTcccttttt ttgcttttcattTCATTAGCCCAGGCCAGGCCCAGAAGTGAGAAGAGAAG GGAACCCTTCAAACACCTTTGTATTTGTCATCAGGGCTGTGAGTCTATTT TAGTAGACTCAAAAACAAGTTTAatatgtaccgtcaactgctctaactcg GGAGAAAGTTGGTCGAAATATGGGATTATTGATATCTGGACTGTATTTTT ACTTACTGTTattaaggggtcactcacaaatcaattttaggttagaagaa cgtcaattgacgtatattacagtcagggaaatccctcaattgcggtatac tgcaattcttgaatatactgcaattgcggtatatgaaaaatttaaaagtg acgtttataccgcaattgcagtaagaaattactaccgcaattgagggatt tccctgactacTGTATTATATGAGTGGGTGGGTTAAAGGTTGTTGATGTT TTTCAgaaacatcgatttttcattccatgccaaacttctcgccatgtttc tgtttgatcgctttgtttgttttgaaaaccaaaacaaacggcccgatgtt tatgtcttttctttgtttgaggaggaccctgccgacgcaccggactgtcc ggtgtatttgtctggtggcaaaaagtatcctttcactacaccggacgcaa tacgGTGTTTTGATTACTCCGGTGGAAAAAAGCATCcctctccgacaccg gacatctgacttccttaagtccggtgtagagatggtctggtggtaaaaaa gttctcattttacaccggactttcgcgtgtccggtgttcgttaaatccgg tgcgtcgacagggcccttttgttcttttgtttgaCGGCCTGAACGGCCCT TCAATTTTTGCAGATGGCAGTTCTTACTGTCGCTACACAtactacggaga taattaatatcgggaattttgtgaacaagtttagaaattatctctgtttc ttcttttttaaatataaactatgcgagccgtagtgaaaatcaagatgACT GACGCATaggttcagccccccccccttattttttggggggggctaagaaa tattttggcctttaaagagcctgggggctaaaattaccaaaatatttggg gggacctagattgttggggggNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTGACTTCTCTCTA CGGGGgcgggagaacaatgtttttgtttttgtttatcttgggacctgaag tgttaggggacctagcacaatgcaattttttggggggagttaaattgttg gggggaccttactttgttggggggagctagaaacctggctgaagctatgt gACGGAACAGAGCGATGAAGgcagtttttatcgattttcggggatatcaa ggtgtttgacgtttttgggtgtgggtgggtgggtcagcttttaaaacgtc aattgacgttcttttaacctaaaatcgatttgtgagtgacccctaaatCC CAGACGGTACTATCTAATCGAATGTTCGATTATTGTGATCGAAGCCAGAC GGTACTATCAAACATTCGATTGTGattgaagtaatcaataatgatcgata aCAATCGAAGGTTATCAGTGACCacttatcgattctatcggtgatcgaat actcactcAACTCCAAATTATGGCATTTTTATCGACCATTTTTGATTCGT TCGATCGtttcgattactgttcgattactttcaatcactttcgatcatat tgaataccttcaattttatcaaatatattcCCAGTAgcagagcatcaaaa taatcttAAACCGAGTATATCTCGGCCAATTAAAACACATGATTCACGCg cgaaaaccactttcgttttctccgaccaatcagaacgcgcaaaaaccact ttcgttttctccgaccaatcagaacacgcgatatgagttacttgaggaaa cccagggcaAAGGCACACAAAATGGTGGGCGAAAAGGGTGGGAAATAAGG AGGTCAATCTTTATGGCGGgtcttctttttgtgctttggttttaggtcag tttttttggtttttcttaaagatatatcatagtaattggttatcgaagca atcaattggttatcgaagttgtcaaagttatcgaaagtaatcaataacaa tcaaagtattCAAACGGTAATCGATTCGTCGAAGgtttgttaagaaagtg atttcaaaatttttttgaaattttggtactcaaaTTTGATTGTTAATCGA TAAATGGTTGTTCAATTGCttcgatcattatcgattatttcgataatcga atttatcgattagtacTGTCTGgtcgaagtaatcaataatgatcgataat aatcgaaggtGATCAGTAATAATCGAAGGTGATCAGTGACCacttatcga ttctatcggtgatcgaatactcactcAACTCCAAATCATTGCATTTTATT TGaccattttcgatttgttcgatCGTTTCGATTACTGTTCAATTACTTTC AATCACTTTCGATCATGTTGAATACCGTCGATTATGTCGGATATGTTTCC TGTAGCAAAGCGCCCAATGAAATATGAGACTGAGTTTATTTCGTCCAATA AAAACACAGGATTTACGTGTGaaaccactttcgctttctccgaccaatca gaatgcgCGATATGTGTTATTTGAGAAAACCCTGGGCGAACACACTCAAG ATGGCGGGGAAGTATTGAAGGTGGTTCTTACGGCTTCGTTTTGTGTTTTG GTTTTAagtcaatgtttttggtttttccaaGGTATCTATGTAATCAACTG GTTATCAAAGAAATCAATAgttatcgaagtaatcaattaGTTAtcaaagt tatcgaaagtaatcaataacaatcaaagtacttgAACGGTTATCGAGTCT TTGAACGGGTTTACCGTCGCATTGGAAAGAATATTTGATGCGGCAAaagt tcattattcattatttttcaatacaCATCGGCCCGAACCTTCAGTGTAAA GAAAGTTGCCTTTTTGCCACTTTTAcccattgaaaacaaaaaaccttTGG ATATTTAGACTCCCAAAACATTGTAGAGTCTTTTGATTATCAAactaaga gaaaaataaaaagttttaacctTTAAATCTAATCATATTTCCTTTGTGTT TAAACTGTCAAAGTCATGTTCCCTCATgcgccgccatcttgaatttagaA TTAGAAGCATGTCGGAAACTAGAACCGAGTTTACAATAAAAACGCACGAT TCACATAggaaaaccactttcgttttctccaaccaatcagaatgccAATG TGAGTTATTGTGGAACAACTGCAATGGAACGACTTCAAAATCAATCAGCG GGCCGAGAGGGCACAAAAAAGCCGAcgatcagcgttttgattggtctttg gaaaaaaattatgtcaTGGCGCAACAATTTGTCCGCCGGATTAATTAAAA GTCTGGCTACTTTCTTCTGTCCATGCGGGAATGCGCCCGCTCCCTTGTGG GACCGACCTTTACTCAGTTATGTTGTGGATCATCGTCGATCGAAAACCAA AGGTGACTTTAAAGAGGGTTGTGAATGTGAAAGGTGATTGTAGATACTGG AACTGGaaatatttctggaaaaaaaaaaattatgaacttttattaaaata atgaacttttttgagtgGCAGCTCGAGGGCATGCGGGCGGTCGACGGTAA ACCCGTTCATTAATTCCCCTCGCCTTAGCGCCCCGCCGAAATTCATATCA AAgactgactctcaagcaaaaaaaatgtgccgcaaaacttctagaaaggg aatcatgaaaaaataacctggcgctttttaatgaaattaacattctcaaa aactatgagaaattacctaaaatttgagccatagatgaaaaaatttgtac caagccaaccttgagaactaatttgaagatcaaattcccaagaaaaagat taaCGGCAacgggagacggaacccacctagatccgcgcactgcagAATAG GCTATTTTccggaaattttgccagacctcaaacactgacccatttacatg tgcgaaattgtttttaatttagcgtcataaacaaggccttaaaaatcgaa gtgcTATCTCAGGaataggctgcacgcatcccctctgatatgatttgata taggggatgcgtattgtctaaaatatttctgtcccaacttacccccgtct tttcttgtttcttttttgattatgcgtcatagcaatacaatgacttcttt ttttctttgttcaatgaatgaaaattgataattatgaaaacaacagcaca atgacttcctttttttctttctttgatttgatgtgacgaaattatgtaaa ttttttagcttcaaatttcctagtgtgactaactgtcctTGTTGTtacaa atacatcctgtaggtgactgatgttgttttttctgaaagcttgatttcct agtgtgactaactgacttcTTCTGTTATTCATATATCACAAAAATAGATA TGTCTAAAAAAGCTGCATCCGACAAAATTAATTAACCATTAGCGTCGTCT TTTAATGTCTTGTTCAAGGGGCTTTTATCTAACAGGCTGTGCGATGAGAT GAATATATGTCAGCAAGAGCCTGTTTTCTTAGTTGATGTAAGCAAACTTG AATCGCTCAATAAAATTTAGCGCATAGAAAATACAAGAGAGAAATTTTCA ATACGCTGTTCATTATctgaaatcaaatgactttggaggttcggtaaaat ggtggctgaattgccatcccatgttttgtcagataatagtcccaagttag agtagTTGACGGTAGCTTATTTTCTTGCTAGACTCACTCGATCTAAAGAT CTATaaagtttcacttttttacaGGTTTGAATTAAAGGCAACCCTGCTGA GACACCAGACTGCCCAGTGTTTTGTCCGGTGCCTTAAAGTATCATTAAAT TCATTATTAACTCATTTGCTGAGTAGGTGGTGACTGGGgaacaatcccac aatcctgAGATTGTAAGGCAAATGTGCTACCCACCTGAGCTACCCAGCCA TTTAAATAAACCCAGCTACAAACAATTATACAAAAAGaacatattgaaaa ttttatacaACACAAAAGCAGAATGTTTTGTGTAGACAACTATGCaatta gtagggggccaagcctggggtttTGCAACATCTTTTTTTACGACCTAACC ATTTTTATTCTATTCCAAAgtacagtatattacaagatatttttgagagg gaggacgggGATTAGGCCcaggaaaactttttgtgaccaaaatagtgacg tctTAGGCAAAACTGCTGTTGTGCACGGAAATAAACTGACAAAGTTTGGA ACTTCGATTGAAGTGAATAATACgattgttcaaactgaaaattaactgac aaaatattaaacgaaaaatataaattttcaaatattaacaaaatatgAAT TTGGTTTTCTCCTCTCTTTGACCAACCATAAGAAAACAAGGGTATAGCCA GGTATATATagcttttttaatgtttacaatCCCTACACAAAAAAGGATAG AAAAAATCCCAAGCATAGAATATCTCCTAAATTTAAGGGATCTAGCctgg aaataaacaaaaaagcttCTAAATGGACCAAATAAATGCGCTGAAAAGGA aagggaaaaatgaaaaaatccaaaaGATACTACCCTGAAATATATACACT AGGAAATATTACCAACAATGTAATGACCAATATGTATATGTCCCAAAAAT GGGACTAAAGGTTCAAGGGACTGATAAATGGAAAGACTGTATGTCATGAA ATGTCATGaaataatgttttgttttaaataagtTTTCTACAGttaatttt ggtttttgttcTATTAGGCAaacccaaaaaatatttttgtttctggTCCA CTGGCtgggtgaaaattttttttttcacacattCTCTTGCAAAGGGCAGA AAGGAATTGAGGAGAGGACCCTTTTGAAAGAAGTCTTCCAAAACCTGTTG AATCGTTTTTCGTTTTTGTATATAGATGTCTGTACCTTTAAGTTTATGTT ATTGAAAAAGGTGAACCTTTGTTTGAAAGACATTGCTGATTACGGTTTCC TTACATAAGTTAAACTAGTACTGGTATCAAATTACTgcaattttaattca aaaagaCCATTTTTTAAACTTCTATGAGTACTTCAAAAAATTGTGTAAAT GAGTTTTGCtattgaaattcagaaaataaattttgcgaCAGGCCAAGAGA GTTTTTCCTTTGTCACCTGGTGGACCGCAAACGAAAATGTTTTTCAGATT TGCCTAACAAAAAATGTCTAGgtaatttcctttgtttcattTCTTTTAAA TCCTTTTGTAATCAACTCAACATCGTACATTCTGAGTCAGTTTATAGCCT GACAGCATGGAGTTGAGCATAGTTTGTGGGCCCAATGTACATAGTAGGTG GAAATTTGTTAGATTTTTTTAGGTCCtttgacttttttagtcaaaccACT TGATATACGTATTTTCGGAAAGcaaaggggtaggggaatcaaaataacat gGGTGGGTGCCAATTTTCTTCCGGACACTTTGGTAcgtttttcggacaaa tatgacagtctcaggcaaaaatcatagggtcaaaatttaatgaaaatttt atctTGAGAAAACAGAgatctgttgtatatttttggaaagctctcaaaaa attaagattagagatgtATTgtgagtataggtgatttctgtacctagaTA TtgacgattttttatttttgatcacaTTTTTACTTAATAACGTGTGCTTT TGGGAAAATATAAATCTCAAAATATCATCCCTCTATTAAAAGTTTGTGAT TACTACCATTTGAAAAGTAACGCACACTCTAAGGTGTGAGAAGGGGTCCT CGAGAAACTTGTGTGCCAAAAGGGTCacaaatttgttgtttttttagagA GAGCCTTGATGATAACATTTATCTTCAGAAAGAAAGTCATAGAAGTAATT AGCCTACAGAAATTTATGTTACACTTTTATGTAATTTAGATGATTTTACG GATTCAAACACCTGAAGGGATGAGGCGAATTCAAGTTGGTGGAGCTGATA CTGTTAATACACTATACGAAAaggtaaaatttatattattttgaaatgga tattttttcaatttgctACTCTTGTCCCCTCTCCCTGTCGACTTTATTTA AACTTTCCGATATTAATAGCAGTGAAAGAAAGAAACAGGAGACTTCAGTG TGCTCAAGCGCTAAGCAGTCCAAGCCCCCTGGCGCAAAAGTTTCTGGTGC TACTTCTGCCACTTGGGTAAGCAAAGCACCAGCTAGTAATAGATCAGGGA GCACATTCAATCTTTTGCCCTATTCTGTAGTTGTCAAGGACATTTCTACT CTTCTTCtattctattttttctttttcttacatTCTTTTACTCTTAACCA ACAAAAAAAAGACCGAGCAAACCTCGTCCAATGGAATGTCAAGTGgttct gaaagatttctgaaatCACGTACTAATTCTGACTTGGAGGAGTTTAATAG CTAAATGTGGAGAGGCTCAGTGATATTTGACCAACTCattgtacaatcat ggtcgaaatagaatgagaattccggttattttaacgtttttcaagattta aagttctggcgagaaagtcgattttgggctatctctttaacttaatcgaa tatttcaatttgggaggagttggcagacttccaggctatattctgagtct tattggactatttttgagtttttggatcctgagatcctaaggtcctaagt cttaagtctagtgttaaaactcagagttaaaactctacccttcaaaccta ctttagagcacttacaaatcgattgtggtttcaaaacttcccggtggatt tcccttttttctcaaatattacgtccatgattgtagttagTACCTTAGCA CATCATATAACTCAATTTGAAAACATCTCACCAATCTTTCAGGTCCAATC TTTTCTAAAACTCCAAACGAATGGCTGGTCCATTTACAAAGACAGAGGCT TGAACGACGAATTGAGTAAAAGCTCCAGGAAAACATTGAAAGGCCTTCAA CTGAAGTAAGTGAATTCTCTAGCTCTCCCAAGGGAGTAACTACTACATGA TTTGTTGATTCTGTGCAATACCTGTTTTGCTAACAATCATTCCTCCCAAT TAAGGCACTGTGGGTGGAAAAGGTTCGAAGTAGATATTAACAACAATCAA CCCTCTATCTATTACATTTGTTATTAAATAACTTTTGTAAATATGGTTAC AGACAAAGGAAGAAAAGGCAAATGACcataaaagaaaattgtttgttcAT TATGCACAAATAGATCACGTTCCATTTTGTTCTTCTCTTGTCTGTTAATA GTCATGGTGATGTTATTTACATGAAAGAAACTGGCCATTTTGTATCCAAC AGTCCTACCTCTATGGACGATCGACCCTCATCCAGTCAAAGCACTGACTC GACAACAGTGCAAACAGAGAAGGAAGACAACACTTCAAAACTGGATGTTG TAGAAGACGAAATCGATGTCTTATTATCGCATCAATCAGGTCTCATCAAA CGAGATCGGCATCCTCTTCTGTACGTCCTTTAGCCCTACCTTCCTTTATA TAGCactagtttaggtataaacttatttctttttttatgatttttgttgg cgaaaacaaaaatcataaaaaaagaaataagtttatacctaaactaatAT AGCACCGCCTTTTATCTAAAATCAAGAACGCTGAGTTCTTATCAACATCT CACCAAAAAACGAGGCTTATTATTAGACTTTGATAAGCTTACTGTTAACG TAGCCCTGAATATCTACCAACCACCACAGTGCTAAGGATATATTATCTGT TAGCCCTTTCATTTCCCGTTTGTTTAGTTTTAAGCCACTGCCTCCATCGT TGCATTTTCAACAGAAACAGCTATTTATAGAGAGAGACCTGCAACATACA ATTTTTCCACTCCTTTTTTTTAAGATGCCGGCACGGTAaacaaggacaat gtttaaatTGTGCGCCACTGGAAGTAAGTAACAacattttttacaagttt gCTTTCTTAAGAAGGAAAAAAGAACTCTGATGTACTACTGGACGTAGGGT TGTAGGTTTGATTTCCCAATATTTCACAATGATTATTTcatttctctctc ttttttgaaaatctaacaACCCACTCACGTGCATCATACGTCACAAATTT TGTTGCCATGGTTATATAAGGGAATTTTTAATTGTCTATTATTCGGTATA GAAAAAAGTAAACCACTAtgaattatatatttttggaatcgtGTTAATGA GCTCTTTAAGAATATAATCataagtttcattgaaaatcacACATATTAAT TCCCCTTTAAACAGGTTAATAACATCGCTCAATCAAACCAATATTctatt tttaccctcaaaatgaTAGATGTACCCAATCTTTCTCTTTTCAGCCTTAC AACGAAGACTACCTCAAAAGTTTGAAACCACCTGCAAAACATCTCTCATT TCACGCATACTTGAAGAAAATGAAATCTGGCGTCGCGAAGTAAAATAATC TTctatttcttcattttattcATGCGTGACTTTTTTCATAACTGCCTGCT TGTCATGCGATTTCCAATCAATAATGTTTGTCTAAACATGGTATAGTTAA ACCCGATTGGTATTAATTCATCTAAGGGTGACTACTCAACCTCTTTAATA GTGTATTAGCCTGCTCTTTTAAAGCTTTATTTATCATGGGTGGCCAGGAC GCCATCAGAATATGAGATTATCCATTTTTAAGAAGTTACCTTCGTCCAAC TACAAATATTATTGACTTATATATTTATCTGTATTCGAAAAGTGTCTTAA TGTTCTGTCTTTAGATGGAAACCAGTCACAGAGTCACAAAACTCATAGTA ATGGACCTGTAAACTTTTAACTTTGAACCTGCTGTTAAAAGCATTGAAAT TTTTTGCCGCGCACATGATTAGGATCATGAAATCTAAActtattttactt tcttttatCAGAGGCAAATATATATCGTTAGAAGACGTAAATTGCAAAAT CAAACCAGGCTGTACGGAGCATCCACCCTGGCCTAAAGGAATTTGCACCA AATGCCAGCCTGGCGCTGTCATGCTAAATAGACAGGTTTGATTGGTTCAA AATATACATGCATGCTTTTTTAAACCTTCTTTTTTAACCAAGAATGggac cattccattttatatccatacaggggggtggacgaacctttccagagggt aatctgAGAAAAGTTTTAGTTCGTCCTCCCTCACttaaaggtatgaaaag aatctttccaagggtatttttgctaattttgccTTTTTCCAGGGCGTATC CacatattttcaataatttttttttgaaaaggttcgtccacacCCTCTGT ATATTTAATGAAACAGCCCATTGTTCTACATTACTACATTTCTTAACTTT ATCTACAGACATACAGACATGTGGACAATATCATGTTCGAAAATCCTGTC ATCATGGATCGATTTTTGAATTACTGGCGAAAGACAGGAGGGCAGGTATG CTCATAGTTCTTTGTTGCCATAACcataaaaaaatcagcaaatcttGATT GAAAACATCTTGACTCAAACACTCACCATTCTTTCAAATACACCCTTACT GATTAAGATAgttaaaaagatttctttcatcTCCAGTTGAATGATAAAAC CCTGTTCTGGTCCtaaaatttatatatttaaCTTCAAAGCGTTCTGAATT AATGTGCAGGTGTAGACATATCATATAATCTTagaaagaaaacattcgaa attgtCAAACAATCAACTGACGAAACGTACGCTGTTTGGTTTTGATGATT CGATTTGAAAGTTGCAAATGTTCTGGCAAGATCAGTGTTCTCATCATAGC CATTCAGATCTCACTTTTTAAAAACtctcaaatcaaatttttattctgTT TCAGAGGATAGGTATATTATATGGTAAATATGAGAAACACGAGAACGTTC CTTTGGGCATCCGAGCGACAGTAGCTGCCATTTATGAACCTCCTCAAGAC AGTAATAAAGATCGTATTCAACTCCTCCCCAACCCACAACAAGAGAGTGT TGATATACTGGCATCTTACTTTGGTCTCAAACAGGTGAATAGAGAATTAT TTAAGGTCTTCGATTATTTTTTGGTCCAATTGTATTATTTACACGTTTAA CCCTTTGCTGTGCGCTCAGCCTCTAAGGAGACTGGTaacgaaaatacaag aaaaattctGTTCAACGGCGGTATCAATTACCCAATGTAGGAGTGCTTGT GAAAAATGTAAGATACTCTTGCATTGAGGTGTTAAATTAACGTCGAATTG ACACCCTTAATGGAGGGTTTTGAAAAGAATAAGGCCCTACcttttaattc aaaaggggcctaagtccattttagtcattttgagaaaatcgcaattaaag tttttccttgattctgaaaccatttttaatggtaaagctttgaagtaaat gttttctgaaagccaTAGCTATAAGTTGATTTTCTAATGAAAAGGCATTC GTTTGGAAAGTAGATATTTTTGTACGTAACAGGTGCAACTTAGTAAATCT TGCagaatggacttaggccttttttgaattaaagatgaattttgaaaaat gtgtgaGGGTTAATTTCTGCCTTTTAAAGTTCAAAACCTGCACATATGAC ATTCCAAAATAAAGCCACTTACACCTAGATTCaagataaagaaaaaagac aatcttagtaaaataaagaaaaacccaattaaactttttaggaagcatgg acttaggcccattTGCAATTCAATTGGACTTAAGCCTCTTCAAAACTTAA CAAACTTATTTTtgtggacttaggcccttttaTTGTAAAAAGATGATGGG CTTAGGCCTCTTTTGATTTAAACATCACTTTTATCAGAGCTTCAGTACGA AACTTTCAgcctttttaactttaaaaactaCTTGTTATGTACATCAAAAG AAAGCAAACGAGccagagattgagaaaaaccaaagatctcaaatttcata aaaatggacttaggccccttttgaactgGGGGGTActtggacttaggccc cttttgaattaaggtagcgaaGGGTTCCTGTTTGATCTGATTTTATTTTC CAACTGAAAGAAAACTTGCTCTCTCTTCACTTACCACTAGGTTGGATGGA TAGTTACCGACCTAATACCGGACACCGAGAAAGCCGGACTGGTCAAACAC TTACGTCACGCCAAAACACATTTCCTGAGCGCACAGGAATGCATGATGGC GGCCGACTATCAAAACAAACATCCCAATCCTTCCAAGGAGTCCAAAACGG GCCGCTTTGGTTCGAAATTCGTCACTGTCGTAGTGTCAGGTAAACCTCAT TTCTCAATGATAAACTCAAaccaaaaaattcaacttttgatttcttCACG AGCTTCAAAAATGGTAGAATTTCAAGGCGTGCGCCAtattttaagagcca ttttttgtAAGGGCCATCAGGTTTTGAAACATGAAGTCtcagattttctt gaaatttcaacCAGAGCTTCATATTCGGATCTTGGGATCTTTCAACTTTG CCTTTGATGCTAGTCGGGTCAGGGGGGgttgaaaagatttttaaaatcga TATCGAATCGAATTTCACTCTGCACTATGCGATAACTAATACTTAGAGCT GAGAAAGGGCATCTGAAAACCCTATTTTGAAAagaataaatatttgaaaa agttggttttgaatctttcataaattttgaaaaaagcaagTTATTTGGAT ATTCCAATCAATAATTATAAGTGCTTGAAGTTAGACTCTCATTTAATTAC CAGGTCTAAAATGGCTAAATAATTTGAAACTTTAACAAGCCGTATCTCAA GAACCGCTTCGAATTAGATGATGAAATTGTGTCTCACAAGATCTggttaa aatttcaagaaaatctgaGACTTCATGTATTTTAATAATCTGATATATAC AGGACGNaaaaaattcaacttttgatttcttCACGAGCTTCAAAAATGGT AGAATTTCAAGGCGTGCGTCAGGACAGGTACGAGCTGTGAGGCCTCAAAA GATTTACAGTgtgaaattcgaatttagcgctgttctcacttactaaaata aaaaccaaatttcggaacttgcgttttctctaagaaagtgtgaccactga aagaaaaacagaattgtgttttcaaccgtcattaggatctgggaaattca aattcTCAGCTGtaaccatgctatatatttcgccatcagtatataaaata agaaatcatagcatggatctccaggctagtctcaaaattgatttttccta aaggtttttataaaaaatgactCTTAATGTTAGTCTTACTCAGGACGGGC TAGATTTATTGTTTGGCTACgattctttttgtttgttttaccaGGTGACG AAGAGCAACACATTCATTACGAAGGATGGCAGGTATGTAGTTGTTACAAA GCCGCCAAGGGATCGGCTGGTGATCACAAATATCATATTCCTTCACACAC TCGATAGGATAACTGCTCACAGATTTCCCGTGAAAGTGTCTCCAGTTTTG GGGTCGGCCAGACCGCCATGTTGTTTTCTGTTTTACACTAGAttatcgaa cgttcgaatttcaaaacatccGAATCTCGCTGTTGACGACCAGATTAGAC TAAAATATTACAGACTAATTATCTTAGCTAAACAGCTGGACATCCTTTTA CGTGGGAAGCCCGATCCAGTCAGTAGTTAGAGACCAGTGGTGGCGACGAT CCATTGGTGCGCTatgaattagtatatgtaatcacatgataacgagtgca attcgagaataattgcacgagtgattttttgttattaattttccgaggaa aattcgaaacaaaaaaatcaccagtgcaattttcgaattgtacgagttat tatgtgattacaaGCTAATCGCACAATTGGTGTCACTGCTTTTTCCCCGT CAGGAAGAAAAATATACTGaactgttttatatttttctcttctctttatt ttttttctttcattgttgcttacagattttctttctcacaaaataaattt cgaatgcaattaaaccGTTCGATaataaaaatgtaagaaaaaacattaaa atttattttgtaaacattggcccGTCgatgaagagtgtgattaacgatta attgctctctttgaaagggaaccaaatgaaaaaaataactcatcgtgcga ttacaTTCGTAATTCTAGTAAACCGGCGAACTGAATCCTTCTTTGGGTTT GTTGATGTAGtataattaaaactttcaaatctGTGCCCGGTCTCAATTCT TATGGTAATACAATAATAGTAAAATAATAGTTTTAAAAACTTCCTTCGTC CTATCTCTAGGTATCGAACCAATGCATGGCGTTAGTACGTGACCAATGTC TTGTTCCCACGGTCGACGATTCAGCCCTGGGTTATATCAAAGAGTCATCC AGTGAACAGTTTGTACCTGATGTTTTCTATAAAGTAAGTATATTTGGTTG AGACGCTCAATCCATGTCTGCCGAATGTATAATCAGCTGTTTTCTTGCAG CAAAGATTTGACATTCATTCAGACCTGAGCATTAAAATTGATAACAGTTT TATGAATATATATTTAAGTTATATTCGAAGCATACTCAATTTGAAGCGAT GCTCATATTAGTTGAGCCAAACTTCAGATGTTCCTATGTTTTTTTTTGAA AAATCAATTTCGATTTAGCAAAACATTGAAGCAGTTTCATTTTTACGCAG GTCAAAGATGAATACGGAAATGAAGTGACGAAGATTGGTCGACCCATGCC CATCGAATACTTTCTCATCGAGGTACTGTTTTTTCAATCAGACTTACCAT ATATAGTCCTTGGATGGTCTTTAAACGTTTTTCATGTTTTGTCAAGTTAC GTAACTTCTTCCATCATGCATCAAACAGCgtgaaattacgtaacttaata AAACACAATAGATCAGAACTAAAATGCTCACCGTAAATGATTTGAGAATT AATACAGTATATAAAGAAATCTGTCATTGAATGTTTATAAGTACTTAAAT GTGGAATTTGAATGTTTGAAGTTTTCTACTCAATTTGCAGACCTNATGTG TGCCGAATGTATAATCAGCTGTTTTCTTGCAGCAAAGATTTGACATTCAT TCAGACCTGAGCATTAAAATTGATAACAGTTTTATGAATATATATTTAAG TTATATTCGAAGCATATTCAATTTGAAGCGATGCTCATATTAGTTTTCTG AAAGTTTTCACCCAAAACTCTCGAGCCAAACTTCAGACGttcctatgttt ttttttgaaaaatcaatttcgaTTTGGCAAAACATTGAAGCAGTTTCATT TTTACGCAGGTGAAAGATGAATACGGAAATGAAGTGACGAAAATTGGTCG ACCCATGCCCATCGAATACTTTCTCATCGAGGTACTGTTTTTTTCAATCA GACTTACCATATATAGTCCTCGGATGGtctttaaagattttcatgttttg ttaagttactcttaggttccaaataaacgcccccccccccNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCGAGGCAGAATC CTATTCTGCCGAGGCAAACAGCAAATTTAGCCATTTGCCTCGGCAAAAAA ATGCcgaggcaaaaaaaattgaattgccAGGGCTGATTTGCCATCGTTAT AGTTAAATCACCCTCCGTATTTGTCTTCAAAGATTGTCCTACTTATATTC CCCTTATATTCCTTTACAGAAAAAGGATATCTGAATAAGCttctaatttt ttgttaaatttattACTAGGTACCAGCAGGCTTCCCAATGGAACCTCAAT CCACTTTCATTTCAAGCGACCCAACAAATTTATTTCCCATCGAAAACAGA ACGCAAATGATGGAAAACCAGGTAGAATGGAAAGAAAATTCTTCGGTTGG CAATATTTGAAGGCATATAATAACCCTTCTCTCCCCTTTTatgtttttcg aatattttgcTGGCATTGTTGCATTATTGATAATCCCGTGAAATAGATTG TTGATGAAATTCGCTTTATAGTGGAGTCTTCAAatctcgaacacgcacgg ggaatgcaaatttgttcaagttaaggaaatttcgagttatggaatttATA ATGCATGGttacaaaataatataaaacttgaaaaaatttcttgctgggcc agataaatttgataacaagtatagtaaaaaaaaattcaaaacgaatttca atttacaacattcaaaaaaaatcacaaaatttaaaaattactACCAGGTA ATTACAAGTTGTTAAATAATGTTAAATAACGTCaaataatgaataaaata aaatttttagttttcactttttttatcaaatataaaacttgttcgagata aggagacattcgatttatagaagttcgagttaaagagacttcaCTGTAGT TTAACTTTGACTTCTTTTTAGAACTTCGAGACATTAACGCAACATTTGAA TCGTTTGAAATCAAGTGACGTGAATCTGTTGGAACATTTCTTAGATTTCC ATTTTCTTCTCTTCATCATGACCAATGAATTCATATCCATAAGGGTGAGT TTACACTTTGTATTCCCTTGAATGAATTCCAGGGCAGTTTTTATTGTTAA CTTCTCTTAGCTTTGcgataagtaatagttatcggcaGTTGCAAGTACAA TATGAGGAATATTTTACGAATtgcgagatttttccgtactcGCCTAAAGG CTTGggaaatatacggaaaatccagaacgagtgaaatatttccatattgt acgagcaaatatctgataactggtttatcggtgacccaaaaaatgcactt tttttgttggaaaaagtACAGGGCACTTTGGTGTAGctaagtgacgttag attgctgctaccgctgTATATGTAAAGTACAATATATATTGTActgtttt taaccaatcagattgcagacaTTTTTTGGATTGCCGATAAAAATACAGAC CCAAAGTAATTTATGCTCATCTGGTTCTCTGAATGATACAATACTTGCTG AAAAGGACATAAGATTAGTAAACTAGTAGGTTTGGGGAGGAGTCTACGTC GCTTACGGGAGGGGGTAGATGTTTCTAGTTGAGTTCAGTGAATTTTGAGG TCAACAGGATTGATTCTTTAAGTAAGTTGCTTTTCATAATGGCTTTCTAC CTTCAATTGTAGCACAAAATGAGCGATCTGTGTAAAGCATTAAAACAAAG AGATCAAATGTTGTTTCATCAATGGTTGGAATCTGACGAATGGAAAACCG TTGAAACTATGGTACAAACTCACGGTAAGGTCTACAAGAGTTGACTTCTC AACCTCAGTTGATCTAGAATCTGaaaatgtctgtctgtctgtctgtctgt gtatCCGCCAAAAGAATTAGGGGCAtcctgaaatttggtacactcGTTCT TTGGTTGAACATCTgggagtatttttttcaattttctaaaacTGTAATTT TCTAAAGGCTTGGGTACTAATCTTTTGGTTTATTttgcctatgaataatt tgaagctactgaagttgagcccagtacGTTGCGCATGTTCGGCTTTTTAT TTTGGATAGTCCAAATGAAAGTTTCCATCAAATTTACATTTTGACGCAGT GCACTCTACTTTGATGGGATTCATTTGCGCGGGGATTACTTTTCGCGGAT TTCctaatggaattttgaaaaggTCTTATCTGcgaaatttttttgtaatt aaattccaaaaaaatgttaaaagaacACTCTTTTCATTTTCCACTTTTGT TTCCCTTTCAGCACCCATGGCAACGGACAGCCCGATGGACGGAAGTGATG CTGTTCCCATGGAAACAGACAATAGTGTGACTATTACTGGTTGGACGTGT CCGCATTGCACTTTTATCAACAAAAATCCAACTTCAGACACATGTGATAT GTGCACACTACCAAAAAGTTAATTACTTTGAATTAGACTTTgtggtatat tttttacaatctGACTTCTCTTCAATATCGCTGCTCtttagatttttaaa agaataaaaatttaaCTGAGATTTTGGACTTTGTTTTCTTCCGAAACTTT GCAATCTTTTATACATCGGTGGGTCTTTGGCAGAAAATTTCATCCCAACT CAAGAAATGGGAGTTTGTTTTTAAGAGTCAACTACAATTCTAACAGCTTT GCGATAATTTTGCTGCACTTgatttttgttggtttgttggCCTGCGTTTT GTTAGCAAGTAAGAATTAGTGTGTTTTCAATTGttcaatttttgttgatt tttcgtAAAATAGTAGGACcaatatcaataattttttataagaactttaa atatttattaagttttattttgaaaatatcaaaaaagatTCTCAACATTT TTGGACGATTCTACTTAATCTTCAGTTCAAGATATGTTCTGT
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_045473XLOC_045473Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073302-exon-scaffold_9-1491911889:112670..112899TCONS_00073302-exon-scaffold_9-1491911889:112670..112899Clytia hemisphaericaexon
TCONS_00073302-exon-scaffold_9-1510915933:112670..112899TCONS_00073302-exon-scaffold_9-1510915933:112670..112899Clytia hemisphaericaexon
TCONS_00073302-exon-scaffold_9-1575043694:112670..112899TCONS_00073302-exon-scaffold_9-1575043694:112670..112899Clytia hemisphaericaexon
TCONS_00073302-exon-scaffold_9-1491911889:120659..120742TCONS_00073302-exon-scaffold_9-1491911889:120659..120742Clytia hemisphaericaexon
TCONS_00073302-exon-scaffold_9-1510915933:120659..120742TCONS_00073302-exon-scaffold_9-1510915933:120659..120742Clytia hemisphaericaexon
TCONS_00073302-exon-scaffold_9-1575043694:120659..120742TCONS_00073302-exon-scaffold_9-1575043694:120659..120742Clytia hemisphaericaexon
TCONS_00073302-exon-scaffold_9-1491911889:121612..121724TCONS_00073302-exon-scaffold_9-1491911889:121612..121724Clytia hemisphaericaexon
TCONS_00073302-exon-scaffold_9-1510915933:121612..121724TCONS_00073302-exon-scaffold_9-1510915933:121612..121724Clytia hemisphaericaexon
TCONS_00073302-exon-scaffold_9-1575043694:121612..121724TCONS_00073302-exon-scaffold_9-1575043694:121612..121724Clytia hemisphaericaexon
TCONS_00073302-exon-scaffold_9-1491911889:122021..122239TCONS_00073302-exon-scaffold_9-1491911889:122021..122239Clytia hemisphaericaexon
TCONS_00073302-exon-scaffold_9-1510915933:122021..122239TCONS_00073302-exon-scaffold_9-1510915933:122021..122239Clytia hemisphaericaexon
TCONS_00073302-exon-scaffold_9-1575043694:122021..122239TCONS_00073302-exon-scaffold_9-1575043694:122021..122239Clytia hemisphaericaexon
TCONS_00073302-exon-scaffold_9-1491911889:122644..122692TCONS_00073302-exon-scaffold_9-1491911889:122644..122692Clytia hemisphaericaexon
TCONS_00073302-exon-scaffold_9-1510915933:122644..122692TCONS_00073302-exon-scaffold_9-1510915933:122644..122692Clytia hemisphaericaexon
TCONS_00073302-exon-scaffold_9-1575043694:122644..122692TCONS_00073302-exon-scaffold_9-1575043694:122644..122692Clytia hemisphaericaexon
TCONS_00073302-exon-scaffold_9-1491911889:123114..123208TCONS_00073302-exon-scaffold_9-1491911889:123114..123208Clytia hemisphaericaexon
TCONS_00073302-exon-scaffold_9-1510915933:123114..123208TCONS_00073302-exon-scaffold_9-1510915933:123114..123208Clytia hemisphaericaexon
TCONS_00073302-exon-scaffold_9-1575043694:123114..123208TCONS_00073302-exon-scaffold_9-1575043694:123114..123208Clytia hemisphaericaexon
TCONS_00073302-exon-scaffold_9-1491911889:123681..123804TCONS_00073302-exon-scaffold_9-1491911889:123681..123804Clytia hemisphaericaexon
TCONS_00073302-exon-scaffold_9-1510915933:123681..123804TCONS_00073302-exon-scaffold_9-1510915933:123681..123804Clytia hemisphaericaexon
TCONS_00073302-exon-scaffold_9-1575043694:123681..123804TCONS_00073302-exon-scaffold_9-1575043694:123681..123804Clytia hemisphaericaexon
TCONS_00073302-exon-scaffold_9-1491911889:124128..124214TCONS_00073302-exon-scaffold_9-1491911889:124128..124214Clytia hemisphaericaexon
TCONS_00073302-exon-scaffold_9-1510915933:124128..124214TCONS_00073302-exon-scaffold_9-1510915933:124128..124214Clytia hemisphaericaexon
TCONS_00073302-exon-scaffold_9-1575043694:124128..124214TCONS_00073302-exon-scaffold_9-1575043694:124128..124214Clytia hemisphaericaexon
TCONS_00073302-exon-scaffold_9-1491911889:124624..124803TCONS_00073302-exon-scaffold_9-1491911889:124624..124803Clytia hemisphaericaexon
TCONS_00073302-exon-scaffold_9-1510915933:124624..124803TCONS_00073302-exon-scaffold_9-1510915933:124624..124803Clytia hemisphaericaexon
TCONS_00073302-exon-scaffold_9-1575043694:124624..124803TCONS_00073302-exon-scaffold_9-1575043694:124624..124803Clytia hemisphaericaexon
TCONS_00073302-exon-scaffold_9-1491911889:125860..126058TCONS_00073302-exon-scaffold_9-1491911889:125860..126058Clytia hemisphaericaexon
TCONS_00073302-exon-scaffold_9-1510915933:125860..126058TCONS_00073302-exon-scaffold_9-1510915933:125860..126058Clytia hemisphaericaexon
TCONS_00073302-exon-scaffold_9-1575043694:125860..126058TCONS_00073302-exon-scaffold_9-1575043694:125860..126058Clytia hemisphaericaexon
TCONS_00073302-exon-scaffold_9-1491911889:127114..127151TCONS_00073302-exon-scaffold_9-1491911889:127114..127151Clytia hemisphaericaexon
TCONS_00073302-exon-scaffold_9-1510915933:127114..127151TCONS_00073302-exon-scaffold_9-1510915933:127114..127151Clytia hemisphaericaexon
TCONS_00073302-exon-scaffold_9-1575043694:127114..127151TCONS_00073302-exon-scaffold_9-1575043694:127114..127151Clytia hemisphaericaexon
TCONS_00073302-exon-scaffold_9-1491911889:128080..128202TCONS_00073302-exon-scaffold_9-1491911889:128080..128202Clytia hemisphaericaexon
TCONS_00073302-exon-scaffold_9-1510915933:128080..128202TCONS_00073302-exon-scaffold_9-1510915933:128080..128202Clytia hemisphaericaexon
TCONS_00073302-exon-scaffold_9-1575043694:128080..128202TCONS_00073302-exon-scaffold_9-1575043694:128080..128202Clytia hemisphaericaexon
TCONS_00073302-exon-scaffold_9-1491911889:129079..129150TCONS_00073302-exon-scaffold_9-1491911889:129079..129150Clytia hemisphaericaexon
TCONS_00073302-exon-scaffold_9-1510915933:129079..129150TCONS_00073302-exon-scaffold_9-1510915933:129079..129150Clytia hemisphaericaexon
TCONS_00073302-exon-scaffold_9-1575043694:129079..129150TCONS_00073302-exon-scaffold_9-1575043694:129079..129150Clytia hemisphaericaexon
TCONS_00073302-exon-scaffold_9-1491911889:131489..131590TCONS_00073302-exon-scaffold_9-1491911889:131489..131590Clytia hemisphaericaexon
TCONS_00073302-exon-scaffold_9-1510915933:131489..131590TCONS_00073302-exon-scaffold_9-1510915933:131489..131590Clytia hemisphaericaexon
TCONS_00073302-exon-scaffold_9-1575043694:131489..131590TCONS_00073302-exon-scaffold_9-1575043694:131489..131590Clytia hemisphaericaexon
TCONS_00073302-exon-scaffold_9-1491911889:132141..132263TCONS_00073302-exon-scaffold_9-1491911889:132141..132263Clytia hemisphaericaexon
TCONS_00073302-exon-scaffold_9-1510915933:132141..132263TCONS_00073302-exon-scaffold_9-1510915933:132141..132263Clytia hemisphaericaexon
TCONS_00073302-exon-scaffold_9-1575043694:132141..132263TCONS_00073302-exon-scaffold_9-1575043694:132141..132263Clytia hemisphaericaexon
TCONS_00073302-exon-scaffold_9-1491911889:132882..132993TCONS_00073302-exon-scaffold_9-1491911889:132882..132993Clytia hemisphaericaexon
TCONS_00073302-exon-scaffold_9-1510915933:132882..132993TCONS_00073302-exon-scaffold_9-1510915933:132882..132993Clytia hemisphaericaexon
TCONS_00073302-exon-scaffold_9-1575043694:132882..132993TCONS_00073302-exon-scaffold_9-1575043694:132882..132993Clytia hemisphaericaexon
TCONS_00073302-exon-scaffold_9-1491911889:133481..134111TCONS_00073302-exon-scaffold_9-1491911889:133481..134111Clytia hemisphaericaexon
TCONS_00073302-exon-scaffold_9-1510915933:133481..134111TCONS_00073302-exon-scaffold_9-1510915933:133481..134111Clytia hemisphaericaexon
TCONS_00073302-exon-scaffold_9-1575043694:133481..134111TCONS_00073302-exon-scaffold_9-1575043694:133481..134111Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_9supercontigscaffold_9:112670..134111 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
39.0674 36.5946 29.0435 24.1399 22.8563 17.6044 22.9691 24.7017 13.5296 20.277 17.8304 11.3753 12.6481 15.9465 21.7166 23.4147 28.0365 26.1126 15.7087 16.8706 17.874 18.008 43.6106 40.5994 28.6927 23.7903 22.7648 21.0778 34.2478 35.2314
Blast
BLAST of TCONS_00073302 vs. Swiss-Prot (Human)
Match: NPL4 (Nuclear protein localization protein 4 homolog OS=Homo sapiens GN=NPLOC4 PE=1 SV=3)

HSP 1 Score: 589.341 bits (1518), Expect = 0.000e+0
Identity = 289/628 (46.02%), Postives = 414/628 (65.92%), Query Frame = 3
Query:  228 NMILRIQTPEGMRRIQVGGADTVNTLYEKVQSFLKLQTNGWSIYKDRGLNDELSKSSRKTLKGLQLNHGDVIYMKETGHFVSNSPTSMDDRPXXXXXXXXXXXXXEKEDNTSKLDVVEDEIDVLLSHQSGLIKRDRHPLLCRHGKQGQCLNCAPLEPYNEDYLKSLKPPAKHLSFHAYLKKMKSGVAKGKYISLEDVNCKIKPGCTEHPPWPKGICTKCQPGAVMLNRQTYRHVDNIMFENPVIMDRFLNYWRKTGGQRIGILYGKYEKHENVPLGIRATVAAIYEPPQDSNKDRIQLLPNPQQESVDILASYFGLKQVGWIVTDLIPDTEKAGLVKHLRHAKTHFLSAQECMMAADYQNKHPNPSKESKTGRFGSKFVTVVVSGDEEQHIHYEGWQVSNQCMALVRDQCLVPTVDDSALGYIKESSSEQFVPDVFYKVKDEYGNEVTKIGRPMPIEYFLIEVPAGFPMEPQSTF-ISSDPTNLFPIENRTQMMENQNFETLTQHLNRLKSSDVNXXXXXXXXXXXXXIMTNEFISIRHKMSDLCKALKQRDQMLFHQWLESDEWKTVETMVQTHAPMATDSPMDGSDAVPMETDNSVTITGWTCPHCTFINKNPTSDTCDMCTLPKS 2108
            ++I+R+Q+P+G++RI     +T  T  +KV      Q NG+S+Y +R    E++ SS K+L  L++ HGD++++  +     +S       P                      +VVEDEID  LS Q G I R R P LCRHG  G+C++C PLEP++EDYL  L+PP KH+SFHAY++K+  G  KGK+++LE+++CKIK GC  H PWP GICTKCQP A+ LNRQ YRHVDNIMFEN  + DRFL++WRKTG Q  G LYG+Y +H+++PLGIRA VAAIYEPPQ   ++ ++LL +P+ E VD +A+  GL++VGWI TDL+ +  + G V++ R+  T+FLS++EC+ A D+QNKHPN  + S  G FGSKFVT V +G  +  +H+EG+QVSNQCMALVRD+CL+P  D   LGY KESSSEQ+VPDVFYK  D++GNE+T++ RP+P+EY +I++   FP +P  TF IS +P   FPIENR  + E Q+F +L  +L++  SS    L+   DFH LLF++TNE + ++  +S L +A++ R++ L   W  S++W T+E +  T   +    P          + ++ T   W C HCTF+N+ P +  C+MC+LP++
Sbjct:    4 SIIIRVQSPDGVKRITATKRETAATFLKKVAKEFGFQNNGFSVYINRNKTGEITASSNKSLNLLKIKHGDLLFLFPSSLAGPSSEMETSVPPGFKVFGAP--------------NVVEDEIDQYLSKQDGKIYRSRDPQLCRHGPLGKCVHCVPLEPFDEDYLNHLEPPVKHMSFHAYIRKLTGGADKGKFVALENISCKIKSGCEGHLPWPNGICTKCQPSAITLNRQKYRHVDNIMFENHTVADRFLDFWRKTGNQHFGYLYGRYTEHKDIPLGIRAEVAAIYEPPQIGTQNSLELLEDPKAEVVDEIAAKLGLRKVGWIFTDLVSEDTRKGTVRYSRNKDTYFLSSEECITAGDFQNKHPNMCRLSPDGHFGSKFVTAVATGGPDNQVHFEGYQVSNQCMALVRDECLLPCKDAPELGYAKESSSEQYVPDVFYKDVDKFGNEITQLARPLPVEYLIIDITTTFPKDPVYTFSISQNP---FPIENRDVLGETQDFHSLATYLSQNTSSVF--LDTISDFHLLLFLVTNEVMPLQDSISLLLEAVRTRNEELAQTWKRSEQWATIEQLCST---VGGQLPGLHEYGAVGGSTHTATAAMWACQHCTFMNQ-PGTGHCEMCSLPRT 608          
The following BLAST results are available for this feature:
BLAST of TCONS_00073302 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
NPL40.000e+046.02Nuclear protein localization protein 4 homolog OS=... [more]
back to top