Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00073285 (transcript) - C. hemisphaerica

Overview
NameTCONS_00073285
Unique NameTCONS_00073285
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1260

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00073285 ID=TCONS_00073285|Name=TCONS_00073285|organism=Clytia hemisphaerica|type=transcript|length=1260bp
AGAACTTTGATGagcaaacaaaaaattgatgatgaatTTAAAagcgattt
ttttctggattaTTTCGTTGCAATTGGTTAGAACAGAAGAAATTTTTGGT
AACATGAAACAAGATTTTTTCGCATGTGATAGAGTAAAGAATGTTACGAT
TGTTccttttatgaagcaaaatattcGCTCAACAATCTTCAGCTTTAGAG
TGCCACAACTGACGTATCTTATAAAATCCTTGTTAGATACTCCTTGTACT
ACAGTTTGGGTTTACTCCCCATTGGAAAATAGATCTATTGCACAGAACAA
AGAcaattcaaacatttttttagaGACAAAGATTCAAGCAATGGATCTAC
CTGATACAAACGTACTTATCGATTTTCTAAATGAGGTTAAAAAATTAGCT
GTTGAAGAAAACCAACACACATTATTGTTTATTGCTCTTAACTTTCAGTA
TGACTTATCTGAGCAAGAAATATCACTAATTGTAGATTGTTTGAAGGAGT
CGATGGAATATATGAGCGTGGTAATGCAGTGCTCGAATGAAAACGACATA
TGTAGTCAATCAGAAAAGTTCATACCTCTACCAAAAATAATATATGATGT
TAGATCAAAAGTTTTCAATCCACACGTGCACAAAGTCTTACTTGATGGGA
TAATCGATAAAGATTATGACCGATTCAAAGAATATGATGATCTTGATTGC
CGAAATAAATCCCGACGACTTCATCTATTGTTTACTCCAATGCTAGGTCG
GATGGGTTCCGAACCAAACATGGttaaatttttccaatttaaaTTCAAAG
TACGTGTTGATTTCTTCTGGCAATTACAATTGTTCCTTTTTTTCGGTACT
GATGATGGCTTGATGGCTGATGATGGCTTTATTGATTTAAACGAAGCGAA
AGCAATTCTTATGAAAGCTAATGGTGATGACATCATAAACATAATTATAA
AACTTAAAGGGGAAAGTTTTCCCATTCCAGAAGAGCTGAAACCTTTAAGT
AAATGGGTGATAGTGATCGTCGACAATTCAATCCATGATTCGCCGAGAAT
CGAAAAAGACGGAACAATAACTATATGGGAGGAAGATATAGCAAGTCCCT
TATTGTTTCATATGTTGATTAAGAAATTCAAAGAGTTGATTTGTTAAGTC
ATTTATCATCActcaaaatcttataaaaattattttttataaaagtaaaT
CATTTTTTGTGACGAAGCCACGTAAATATCTCTAAGGTTACTCAAATGGA
GATAATTTAG
Run BLAST on NCBI

protein sequence of TCONS_00073285-protein

>TCONS_00073285-protein ID=TCONS_00073285-protein|Name=TCONS_00073285-protein|organism=Clytia hemisphaerica|type=polypeptide|length=372bp
MMNLKAIFFWIISLQLVRTEEIFGNMKQDFFACDRVKNVTIVPFMKQNIR
STIFSFRVPQLTYLIKSLLDTPCTTVWVYSPLENRSIAQNKDNSNIFLET
KIQAMDLPDTNVLIDFLNEVKKLAVEENQHTLLFIALNFQYDLSEQEISL
IVDCLKESMEYMSVVMQCSNENDICSQSEKFIPLPKIIYDVRSKVFNPHV
HKVLLDGIIDKDYDRFKEYDDLDCRNKSRRLHLLFTPMLGRMGSEPNMVK
FFQFKFKVRVDFFWQLQLFLFFGTDDGLMADDGFIDLNEAKAILMKANGD
DIINIIIKLKGESFPIPEELKPLSKWVIVIVDNSIHDSPRIEKDGTITIW
EEDIASPLLFHMLIKKFKELIC
Run BLAST on NCBI

transcript from alignment at scaffold_89:274969..276228

Legend: exonthree_prime_UTRCDSfive_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00073285 ID=TCONS_00073285|Name=TCONS_00073285|organism=Clytia hemisphaerica|type=transcript|length=1260bp|location=Sequence derived from alignment at scaffold_89:274969..276228 (Clytia hemisphaerica)
CTAAATTATCTCCATTTGAGTAACCTTAGAGATATTTACGTGGCTTCGTC ACAAAAAATGAtttacttttataaaaaataatttttataagattttgagT GATGATAAATGACTTAACAAATCAACTCTTTGAATTTCTTAATCAACATA TGAAACAATAAGGGACTTGCTATATCTTCCTCCCATATAGTTATTGTTCC GTCTTTTTCGATTCTCGGCGAATCATGGATTGAATTGTCGACGATCACTA TCACCCATTTACTTAAAGGTTTCAGCTCTTCTGGAATGGGAAAACTTTCC CCTTTAAGTTTTATAATTATGTTTATGATGTCATCACCATTAGCTTTCAT AAGAATTGCTTTCGCTTCGTTTAAATCAATAAAGCCATCATCAGCCATCA AGCCATCATCAGTACCGAAAAAAAGGAACAATTGTAATTGCCAGAAGAAA TCAACACGTACTTTGAAtttaaattggaaaaatttaaCCATGTTTGGTTC GGAACCCATCCGACCTAGCATTGGAGTAAACAATAGATGAAGTCGTCGGG ATTTATTTCGGCAATCAAGATCATCATATTCTTTGAATCGGTCATAATCT TTATCGATTATCCCATCAAGTAAGACTTTGTGCACGTGTGGATTGAAAAC TTTTGATCTAACATCATATATTATTTTTGGTAGAGGTATGAACTTTTCTG ATTGACTACATATGTCGTTTTCATTCGAGCACTGCATTACCACGCTCATA TATTCCATCGACTCCTTCAAACAATCTACAATTAGTGATATTTCTTGCTC AGATAAGTCATACTGAAAGTTAAGAGCAATAAACAATAATGTGTGTTGGT TTTCTTCAACAGCTAATTTTTTAACCTCATTTAGAAAATCGATAAGTACG TTTGTATCAGGTAGATCCATTGCTTGAATCTTTGTCtctaaaaaaatgtt tgaattgTCTTTGTTCTGTGCAATAGATCTATTTTCCAATGGGGAGTAAA CCCAAACTGTAGTACAAGGAGTATCTAACAAGGATTTTATAAGATACGTC AGTTGTGGCACTCTAAAGCTGAAGATTGTTGAGCgaatattttgcttcat aaaaggAACAATCGTAACATTCTTTACTCTATCACATGCGAAAAAATCTT GTTTCATGTTACCAAAAATTTCTTCTGTTCTAACCAATTGCAACGAAAta atccagaaaaaaatcgctTTTAAattcatcatcaattttttgtttgctCA TCAAAGTTCT

Coding sequence (CDS) from alignment at scaffold_89:274969..276228

>TCONS_00073285 ID=TCONS_00073285|Name=TCONS_00073285|organism=Clytia hemisphaerica|type=CDS|length=1119bp|location=Sequence derived from alignment at scaffold_89:274969..276228 (Clytia hemisphaerica)
TTAACAAATCAACTCTTTGAATTTCTTAATCAACATATGAAACAATAAGG
GACTTGCTATATCTTCCTCCCATATAGTTATTGTTCCGTCTTTTTCGATT
CTCGGCGAATCATGGATTGAATTGTCGACGATCACTATCACCCATTTACT
TAAAGGTTTCAGCTCTTCTGGAATGGGAAAACTTTCCCCTTTAAGTTTTA
TAATTATGTTTATGATGTCATCACCATTAGCTTTCATAAGAATTGCTTTC
GCTTCGTTTAAATCAATAAAGCCATCATCAGCCATCAAGCCATCATCAGT
ACCGAAAAAAAGGAACAATTGTAATTGCCAGAAGAAATCAACACGTACTT
TGAAtttaaattggaaaaatttaaCCATGTTTGGTTCGGAACCCATCCGA
CCTAGCATTGGAGTAAACAATAGATGAAGTCGTCGGGATTTATTTCGGCA
ATCAAGATCATCATATTCTTTGAATCGGTCATAATCTTTATCGATTATCC
CATCAAGTAAGACTTTGTGCACGTGTGGATTGAAAACTTTTGATCTAACA
TCATATATTATTTTTGGTAGAGGTATGAACTTTTCTGATTGACTACATAT
GTCGTTTTCATTCGAGCACTGCATTACCACGCTCATATATTCCATCGACT
CCTTCAAACAATCTACAATTAGTGATATTTCTTGCTCAGATAAGTCATAC
TGAAAGTTAAGAGCAATAAACAATAATGTGTGTTGGTTTTCTTCAACAGC
TAATTTTTTAACCTCATTTAGAAAATCGATAAGTACGTTTGTATCAGGTA
GATCCATTGCTTGAATCTTTGTCtctaaaaaaatgtttgaattgTCTTTG
TTCTGTGCAATAGATCTATTTTCCAATGGGGAGTAAACCCAAACTGTAGT
ACAAGGAGTATCTAACAAGGATTTTATAAGATACGTCAGTTGTGGCACTC
TAAAGCTGAAGATTGTTGAGCgaatattttgcttcataaaaggAACAATC
GTAACATTCTTTACTCTATCACATGCGAAAAAATCTTGTTTCATGTTACC
AAAAATTTCTTCTGTTCTAACCAATTGCAACGAAAtaatccagaaaaaaa
tcgctTTTAAattcatcat
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_045468XLOC_045468Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073285-proteinTCONS_00073285-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073285-exon-scaffold_89-1491911889:274969..276228TCONS_00073285-exon-scaffold_89-1491911889:274969..276228Clytia hemisphaericaexon
TCONS_00073285-exon-scaffold_89-1510915933:274969..276228TCONS_00073285-exon-scaffold_89-1510915933:274969..276228Clytia hemisphaericaexon
TCONS_00073285-exon-scaffold_89-1575043694:274969..276228TCONS_00073285-exon-scaffold_89-1575043694:274969..276228Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_89supercontigscaffold_89:274969..276228 .
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0.101269 0 0.0764409 0 2.92188 2.41651 5.07918 5.21065 2.55369 2.46574 2.76815 2.74111 7.88989 6.88182 2.54676 6.05093 0.152044 1.44304 2.22256 2.07912 0 0 0.132722 0.121126 0.0362425 0 0 0 0.1124 0.0763453
Blast
The following BLAST results are available for this feature:
BLAST of TCONS_00073285 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 0
Match NameE-valueIdentityDescription
back to top