Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00073284 (transcript) - C. hemisphaerica

Overview
NameTCONS_00073284
Unique NameTCONS_00073284
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length4093

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00073284 ID=TCONS_00073284|Name=TCONS_00073284|organism=Clytia hemisphaerica|type=transcript|length=4093bp
GATAATATAAGAAGATGAATTGAAAAATCATTCACGAATTCATTCatatt
gaaagaaattttttcaccgGTTATTTTTTTACATCAAATTTTACCGTTAT
GTGTTTATTTGGTTACCAAGTTGACAAAGCGATTGCTTCTTGCtgtttta
agcatttttaaCATATAGTTATTGGTGACTAAAAAACGGAGAAGAAGCAA
ATTTATATGACTTTATATAAACGAAAagatacgagaaatattttattatg
tTGTCAGTACAGAAGAAAGAAATGACTGTTAAACAGCAACCAACGAAAAC
GAAATCTATTCGCAAAAGTACAGTTGCCAGTAATGCTAAAGCAACCACGA
ATAAAAAACCAAAGAAGACATCAACAGCAGCGAAAAAAGATGTTGGCATT
GTGGGAATCactaaaaccaaaaaaaaatctgacCGTAAAATAACACGAAC
ATTATCTGGGTCTTCggacaaatcaaaaaaagatgAGAAAACAACGGCAA
ATAAAACGAAAACTTCGACAACAAAAACGACAAAGAAAGCTAACAAATCA
GTAACTGTTTCAAAGAAAGAAACCACGACGAAAAATGAGGAGCTGATCAA
AATTCCGTCAAAGCCGACACAGGAAGAGGACTCTCGTGAAAAAGAAATAG
CCGAGGAGCCAATCACCAAAAATACTCCCATCCAGACAGCTGTATCAATC
AGTAATCAACCATTAGCAAAAAAGCCCCCACGACCTGTTGGACCTCCCAC
CGACCACAAGAAAGTAGCATTAGTTAAAACAACCGGTTTAAGACACCAAG
ATAGCGTTAGTTTATACCGCAACGGATGGGGACCTGCCGGTCAAAATAAT
CTCGTCGTTACAAAGAGCAGCACTGAAGTTGACCCGGCGCCAAATCAAAG
AAATCCAAACAGGCCTATATTTCATCTACCGCTAAACTTAAATGACAGTA
CCGCAAGTTTCCAAGGGACAAGTCCGAGTTATCTTGAAATGAGTTCCGGA
TTAGTTCCGCACCATCCacaaaataaatacaatttcCGTATTTCACTTGA
CGAAACAAATGATATGTCGCAAACAGCGAATATGTTACGTAATTATATCT
TCAACAATAATAACGAGTGGAACTCAGATCGTACTGAATCTTCACACCGT
ACCAAACAGCCGGAAAATGAACAACAATATAACCTACCAGACGGATTCGA
TGAAAAAGATTCCAGTTTCATTATTCCCAGTACCGAAACAACCAATCGTA
GTTTCATGGCTAACATGGGAGGACGAACATCTACCAGACtttcatttttg
tataataAGAGCACAGGACTTTTGTGCAAGAATTGTTTTTCATCGACTTG
CAACCATATGGATAAATTCGATACGCTTGCTACACCTAAGCTTAAGAAAG
TATTCAGAAGTTCGTCCTCTGTTGATAAACTCGAAGCTGACTCTTCGGAT
GTTAGTCAAAAACATATCTCGTTTGAAGATCTTTTAGAGGAGTCTGAGGC
GAGTAATAAAATGACAGAAAGCATGCGCTTGTTGGAGGTGAATGATTTTT
ACCATCATGATGTCAGTTCGGGAGAACGTGTCCCGTTTCGTGAAATCAGT
ATGGAGTATGAGAATTCTGATTCCATGATAAAGTTCGAGACCTCCACACC
GAATGATGATAGCCCACGCAAAAGCACCGATACAAGCAAAATGAGTATGT
CAGACAGTATGTTGCGCTACACACCCGCCATTATGAATCAACCAGGTCTC
CAACAGCAACGACCCAAGACAAACGAATCTTTAAAATATGATTCTGATTA
CGACGATGATAGTTACCTACAAGCTGCATGTCAAACAACATCCGCTAATA
ATACATTTGAAACACTTGATATCAATAGCGGTGTCTTCTTCTCAAACATT
GAACCAAATGAGAGCTCTGATGCTCCCATCCAGACCTCTACACCAACACC
GACAACGAACTTTAATAATTCAGGACCAGGACCATCTAATAAACTCAAAA
CTAGACGAAAGTCTTTGATTACAATGCCAGAGCTTCCGACAGTGTTTGAG
GAAAAGTCAGCTCCGAATTCAGCTATTAAATCAGACAGAAGTGAAACTCA
AGAGAACAAGGACACTGATGGCGGATTGGAAGAGATTCTTCAAACAGTGA
CAGGAAACTTAGCTAACATGTCTGTTTACGAAGAACCAACGCCACTTGCA
TCGGGCGAGCTAGTGAAATCAGAGAAAGACGAAACAGataaaaacaatgt
ttccaAATCAAATGAAATAGAAACAGAAGCGAACAAGACTGGTAACAGAG
AGCTTTTACATAAGGAAAAAGAAGTTGTTACGGAAGAAGAGACCAATTCA
CCAGAATTAAACGACGCTCTCCAACAAAATGAAGAAGCTCTTCATGATAG
TttagatgaagatgaagaaaaggAAGTTTCAGATGTTGATCAAGAATCAA
AACAAGACTCCAAACCTACCAGTGGAGATTGTATGACGCCCTTAGAAAGC
CAAGGAATCTTCAAACGAATTAAAACGGAAGATGAAGTTTCAGGGACACC
AGTAGCTGATGCGGACCTACAAGCTGTTCTACAGGAAAATCGCAAACATA
CCTTCGAAAGacaatatttttataacaaAGTAAGAGAAAATACAAGCTCA
GTCGAACTTGACGTGTACGACCGTGAAGTCTTGGAAATCAATACGCCAGA
ATGGGccgaaaaacaaaaacaaaaggacACTCAAAATAATACACAACAGT
TGCAACCGACAGTCCCACTTAAAGAGCCTTTAACGGTTGATGCAGCAACC
CAATCTGATGATTTACCAATCCAACTATCACCACCCAAAAATCAAACACC
ACAAACAGGGGAATCCTCTGATACACTCAAAACACAAGGATCCTACCGGC
AGATTGATTTATTAGTTCTGGATCGCGGAAGACAGCAGCAACAACAAATC
CAACCACAATTTGACCCGCATCTTCTGGATCCCTTAGAAACGCGGGATAC
AGATTCAGGCGTCCATAGTGATCACACTAACAGAAGCTACCACAGTGAGG
GTACCATTTTGAATTACCCGAACAACAATGTAAACAACAATTACAACATT
CTTAGAGGAGAGGAAACTCCTGAGTATGAGCATCAAGACGATAATATGAG
CAGTGCTTCACAAAATATTCGGACAGAGAGTGGAAATTCCGGACAGTCTC
CGAGACAAATGTACGAGAGCCGACAACCACAACGAGTTTATGAAAATGAA
CGCGTATATTTACCGGCAATTGAGGAACGATATNGAGCCGACAACCACAA
CGAGTTTACGAAAATGAACGCGTCTATTTACCGGCAATTGGGAAACGATA
CTTCAATCCTTTATCAGGAGTCGAGAACGATATGTATTTCAGTGAAGGCT
ATAATAACAGGCTTGTAATCAACAGAAGACTTACTTCTCCTTACTATTCA
TCCGAGTTCGGTGAAGGGGACATTATGGCGCAGCCACATCGCGACGTCGT
ATCGCCGATACTTGAACATCACATCAAAATGGCGCATTATCATAGAGAAA
GAGTGGCTTTACTTACTCCTTTATATAGCACCCCAAATTTGTATTCGAAA
AGAAACACTCAAGAACCACACCCACCCGATACAAGATCTCATGCTTTTAA
CCACAACTTCCGAAGAAGATTTTCTGCAACGAGAAACATGTTTTATGACA
ATACCACAAAAAGATCCGACTACCTAGAAACTTTATCGGACATTTCGCCT
CGGACACGCCCTTTCCAGCCACACCCACCTTCTTATAAACGTTTCCAACA
TTCAAAACATCAACGTCACCATTCAGAGGATTTGCCTATGGAGGAGGAAC
TGAGGTGGAAGAGAGGCGTGGGAAACGCCCGGCGCCCGTTTCAAATTGAT
ACAGAGCATGACCTTTATCTAACGGCGCCATATCGTTCGTTATATCGTAA
ATAAAACTACTgacatttttgttgaaattcacacaaaaaaatttattgat
aatttATTTTATGAATTCTTTTGTAAATATGAGCCCCATGATAATGTTTT
TATTGTCATTTTATTTGGTATATTTTTattctaaaacaagaaa
Run BLAST on NCBI

protein sequence of TCONS_00073284-protein

>TCONS_00073284-protein ID=TCONS_00073284-protein|Name=TCONS_00073284-protein|organism=Clytia hemisphaerica|type=polypeptide|length=1056bp
MLSVQKKEMTVKQQPTKTKSIRKSTVASNAKATTNKKPKKTSTAAKKDVG
IVGITKTKKKSDRKITRTLSGSSDKSKKDEKTTANKTKTSTTKTTKKANK
SVTVSKKETTTKNEELIKIPSKPTQEEDSREKEIAEEPITKNTPIQTAVS
ISNQPLAKKPPRPVGPPTDHKKVALVKTTGLRHQDSVSLYRNGWGPAGQN
NLVVTKSSTEVDPAPNQRNPNRPIFHLPLNLNDSTASFQGTSPSYLEMSS
GLVPHHPQNKYNFRISLDETNDMSQTANMLRNYIFNNNNEWNSDRTESSH
RTKQPENEQQYNLPDGFDEKDSSFIIPSTETTNRSFMANMGGRTSTRLSF
LYNKSTGLLCKNCFSSTCNHMDKFDTLATPKLKKVFRSSSSVDKLEADSS
DVSQKHISFEDLLEESEASNKMTESMRLLEVNDFYHHDVSSGERVPFREI
SMEYENSDSMIKFETSTPNDDSPRKSTDTSKMSMSDSMLRYTPAIMNQPG
LQQQRPKTNESLKYDSDYDDDSYLQAACQTTSANNTFETLDINSGVFFSN
IEPNESSDAPIQTSTPTPTTNFNNSGPGPSNKLKTRRKSLITMPELPTVF
EEKSAPNSAIKSDRSETQENKDTDGGLEEILQTVTGNLANMSVYEEPTPL
ASGELVKSEKDETDKNNVSKSNEIETEANKTGNRELLHKEKEVVTEEETN
SPELNDALQQNEEALHDSLDEDEEKEVSDVDQESKQDSKPTSGDCMTPLE
SQGIFKRIKTEDEVSGTPVADADLQAVLQENRKHTFERQYFYNKVRENTS
SVELDVYDREVLEINTPEWAEKQKQKDTQNNTQQLQPTVPLKEPLTVDAA
TQSDDLPIQLSPPKNQTPQTGESSDTLKTQGSYRQIDLLVLDRGRQQQQQ
IQPQFDPHLLDPLETRDTDSGVHSDHTNRSYHSEGTILNYPNNNVNNNYN
ILRGEETPEYEHQDDNMSSASQNIRTESGNSGQSPRQMYESRQPQRVYEN
ERVYLPAIEERYXADNHNEFTKMNASIYRQLGNDTSILYQESRTICISVK
AIITGL
Run BLAST on NCBI

transcript from alignment at scaffold_89:210927..215019

Legend: exonthree_prime_UTRCDSfive_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00073284 ID=TCONS_00073284|Name=TCONS_00073284|organism=Clytia hemisphaerica|type=transcript|length=4093bp|location=Sequence derived from alignment at scaffold_89:210927..215019 (Clytia hemisphaerica)
tttcttgttttagaatAAAAATATACCAAATAAAATGACAATAAAAACAT TATCATGGGGCTCATATTTACAAAAGAATTCATAAAATaaattatcaata aatttttttgtgtgaatttcaacaaaaatgtcAGTAGTTTTATTTACGAT ATAACGAACGATATGGCGCCGTTAGATAAAGGTCATGCTCTGTATCAATT TGAAACGGGCGCCGGGCGTTTCCCACGCCTCTCTTCCACCTCAGTTCCTC CTCCATAGGCAAATCCTCTGAATGGTGACGTTGATGTTTTGAATGTTGGA AACGTTTATAAGAAGGTGGGTGTGGCTGGAAAGGGCGTGTCCGAGGCGAA ATGTCCGATAAAGTTTCTAGGTAGTCGGATCTTTTTGTGGTATTGTCATA AAACATGTTTCTCGTTGCAGAAAATCTTCTTCGGAAGTTGTGGTTAAAAG CATGAGATCTTGTATCGGGTGGGTGTGGTTCTTGAGTGTTTCTTTTCGAA TACAAATTTGGGGTGCTATATAAAGGAGTAAGTAAAGCCACTCTTTCTCT ATGATAATGCGCCATTTTGATGTGATGTTCAAGTATCGGCGATACGACGT CGCGATGTGGCTGCGCCATAATGTCCCCTTCACCGAACTCGGATGAATAG TAAGGAGAAGTAAGTCTTCTGTTGATTACAAGCCTGTTATTATAGCCTTC ACTGAAATACATATCGTTCTCGACTCCTGATAAAGGATTGAAGTATCGTT TCCCAATTGCCGGTAAATAGACGCGTTCATTTTCGTAAACTCGTTGTGGT TGTCGGCTCNATATCGTTCCTCAATTGCCGGTAAATATACGCGTTCATTT TCATAAACTCGTTGTGGTTGTCGGCTCTCGTACATTTGTCTCGGAGACTG TCCGGAATTTCCACTCTCTGTCCGAATATTTTGTGAAGCACTGCTCATAT TATCGTCTTGATGCTCATACTCAGGAGTTTCCTCTCCTCTAAGAATGTTG TAATTGTTGTTTACATTGTTGTTCGGGTAATTCAAAATGGTACCCTCACT GTGGTAGCTTCTGTTAGTGTGATCACTATGGACGCCTGAATCTGTATCCC GCGTTTCTAAGGGATCCAGAAGATGCGGGTCAAATTGTGGTTGGATTTGT TGTTGCTGCTGTCTTCCGCGATCCAGAACTAATAAATCAATCTGCCGGTA GGATCCTTGTGTTTTGAGTGTATCAGAGGATTCCCCTGTTTGTGGTGTTT GATTTTTGGGTGGTGATAGTTGGATTGGTAAATCATCAGATTGGGTTGCT GCATCAACCGTTAAAGGCTCTTTAAGTGGGACTGTCGGTTGCAACTGTTG TGTATTATTTTGAGTgtccttttgtttttgtttttcggCCCATTCTGGCG TATTGATTTCCAAGACTTCACGGTCGTACACGTCAAGTTCGACTGAGCTT GTATTTTCTCTTACTttgttataaaaatattgtCTTTCGAAGGTATGTTT GCGATTTTCCTGTAGAACAGCTTGTAGGTCCGCATCAGCTACTGGTGTCC CTGAAACTTCATCTTCCGTTTTAATTCGTTTGAAGATTCCTTGGCTTTCT AAGGGCGTCATACAATCTCCACTGGTAGGTTTGGAGTCTTGTTTTGATTC TTGATCAACATCTGAAACTTccttttcttcatcttcatctaaACTATCAT GAAGAGCTTCTTCATTTTGTTGGAGAGCGTCGTTTAATTCTGGTGAATTG GTCTCTTCTTCCGTAACAACTTCTTTTTCCTTATGTAAAAGCTCTCTGTT ACCAGTCTTGTTCGCTTCTGTTTCTATTTCATTTGATTtggaaacattgt ttttatCTGTTTCGTCTTTCTCTGATTTCACTAGCTCGCCCGATGCAAGT GGCGTTGGTTCTTCGTAAACAGACATGTTAGCTAAGTTTCCTGTCACTGT TTGAAGAATCTCTTCCAATCCGCCATCAGTGTCCTTGTTCTCTTGAGTTT CACTTCTGTCTGATTTAATAGCTGAATTCGGAGCTGACTTTTCCTCAAAC ACTGTCGGAAGCTCTGGCATTGTAATCAAAGACTTTCGTCTAGTTTTGAG TTTATTAGATGGTCCTGGTCCTGAATTATTAAAGTTCGTTGTCGGTGTTG GTGTAGAGGTCTGGATGGGAGCATCAGAGCTCTCATTTGGTTCAATGTTT GAGAAGAAGACACCGCTATTGATATCAAGTGTTTCAAATGTATTATTAGC GGATGTTGTTTGACATGCAGCTTGTAGGTAACTATCATCGTCGTAATCAG AATCATATTTTAAAGATTCGTTTGTCTTGGGTCGTTGCTGTTGGAGACCT GGTTGATTCATAATGGCGGGTGTGTAGCGCAACATACTGTCTGACATACT CATTTTGCTTGTATCGGTGCTTTTGCGTGGGCTATCATCATTCGGTGTGG AGGTCTCGAACTTTATCATGGAATCAGAATTCTCATACTCCATACTGATT TCACGAAACGGGACACGTTCTCCCGAACTGACATCATGATGGTAAAAATC ATTCACCTCCAACAAGCGCATGCTTTCTGTCATTTTATTACTCGCCTCAG ACTCCTCTAAAAGATCTTCAAACGAGATATGTTTTTGACTAACATCCGAA GAGTCAGCTTCGAGTTTATCAACAGAGGACGAACTTCTGAATACTTTCTT AAGCTTAGGTGTAGCAAGCGTATCGAATTTATCCATATGGTTGCAAGTCG ATGAAAAACAATTCTTGCACAAAAGTCCTGTGCTCTtattatacaaaaat gaaaGTCTGGTAGATGTTCGTCCTCCCATGTTAGCCATGAAACTACGATT GGTTGTTTCGGTACTGGGAATAATGAAACTGGAATCTTTTTCATCGAATC CGTCTGGTAGGTTATATTGTTGTTCATTTTCCGGCTGTTTGGTACGGTGT GAAGATTCAGTACGATCTGAGTTCCACTCGTTATTATTGTTGAAGATATA ATTACGTAACATATTCGCTGTTTGCGACATATCATTTGTTTCGTCAAGTG AAATACGgaaattgtatttattttgtGGATGGTGCGGAACTAATCCGGAA CTCATTTCAAGATAACTCGGACTTGTCCCTTGGAAACTTGCGGTACTGTC ATTTAAGTTTAGCGGTAGATGAAATATAGGCCTGTTTGGATTTCTTTGAT TTGGCGCCGGGTCAACTTCAGTGCTGCTCTTTGTAACGACGAGATTATTT TGACCGGCAGGTCCCCATCCGTTGCGGTATAAACTAACGCTATCTTGGTG TCTTAAACCGGTTGTTTTAACTAATGCTACTTTCTTGTGGTCGGTGGGAG GTCCAACAGGTCGTGGGGGCTTTTTTGCTAATGGTTGATTACTGATTGAT ACAGCTGTCTGGATGGGAGTATTTTTGGTGATTGGCTCCTCGGCTATTTC TTTTTCACGAGAGTCCTCTTCCTGTGTCGGCTTTGACGGAATTTTGATCA GCTCCTCATTTTTCGTCGTGGTTTCTTTCTTTGAAACAGTTACTGATTTG TTAGCTTTCTTTGTCGTTTTTGTTGTCGAAGTTTTCGTTTTATTTGCCGT TGTTTTCTcatctttttttgatttgtccGAAGACCCAGATAATGTTCGTG TTATTTTACGgtcagatttttttttggttttagtGATTCCCACAATGCCA ACATCTTTTTTCGCTGCTGTTGATGTCTTCTTTGGTTTTTTATTCGTGGT TGCTTTAGCATTACTGGCAACTGTACTTTTGCGAATAGATTTCGTTTTCG TTGGTTGCTGTTTAACAGTCATTTCTTTCTTCTGTACTGACAacataata aaatatttctcgtatctTTTCGTTTATATAAAGTCATATAAATTTGCTTC TTCTCCGTTTTTTAGTCACCAATAACTATATGttaaaaatgcttaaaaca GCAAGAAGCAATCGCTTTGTCAACTTGGTAACCAAATAAACACATAACGG TAAAATTTGATGTAAAAAAATAACcggtgaaaaaatttctttcaatatGA ATGAATTCGTGAATGATTTTTCAATTCATCTTCTTATATTATC

Coding sequence (CDS) from alignment at scaffold_89:210927..215019

>TCONS_00073284 ID=TCONS_00073284|Name=TCONS_00073284|organism=Clytia hemisphaerica|type=CDS|length=3171bp|location=Sequence derived from alignment at scaffold_89:210927..215019 (Clytia hemisphaerica)
TTACAAGCCTGTTATTATAGCCTTCACTGAAATACATATCGTTCTCGACT
CCTGATAAAGGATTGAAGTATCGTTTCCCAATTGCCGGTAAATAGACGCG
TTCATTTTCGTAAACTCGTTGTGGTTGTCGGCTCNATATCGTTCCTCAAT
TGCCGGTAAATATACGCGTTCATTTTCATAAACTCGTTGTGGTTGTCGGC
TCTCGTACATTTGTCTCGGAGACTGTCCGGAATTTCCACTCTCTGTCCGA
ATATTTTGTGAAGCACTGCTCATATTATCGTCTTGATGCTCATACTCAGG
AGTTTCCTCTCCTCTAAGAATGTTGTAATTGTTGTTTACATTGTTGTTCG
GGTAATTCAAAATGGTACCCTCACTGTGGTAGCTTCTGTTAGTGTGATCA
CTATGGACGCCTGAATCTGTATCCCGCGTTTCTAAGGGATCCAGAAGATG
CGGGTCAAATTGTGGTTGGATTTGTTGTTGCTGCTGTCTTCCGCGATCCA
GAACTAATAAATCAATCTGCCGGTAGGATCCTTGTGTTTTGAGTGTATCA
GAGGATTCCCCTGTTTGTGGTGTTTGATTTTTGGGTGGTGATAGTTGGAT
TGGTAAATCATCAGATTGGGTTGCTGCATCAACCGTTAAAGGCTCTTTAA
GTGGGACTGTCGGTTGCAACTGTTGTGTATTATTTTGAGTgtccttttgt
ttttgtttttcggCCCATTCTGGCGTATTGATTTCCAAGACTTCACGGTC
GTACACGTCAAGTTCGACTGAGCTTGTATTTTCTCTTACTttgttataaa
aatattgtCTTTCGAAGGTATGTTTGCGATTTTCCTGTAGAACAGCTTGT
AGGTCCGCATCAGCTACTGGTGTCCCTGAAACTTCATCTTCCGTTTTAAT
TCGTTTGAAGATTCCTTGGCTTTCTAAGGGCGTCATACAATCTCCACTGG
TAGGTTTGGAGTCTTGTTTTGATTCTTGATCAACATCTGAAACTTccttt
tcttcatcttcatctaaACTATCATGAAGAGCTTCTTCATTTTGTTGGAG
AGCGTCGTTTAATTCTGGTGAATTGGTCTCTTCTTCCGTAACAACTTCTT
TTTCCTTATGTAAAAGCTCTCTGTTACCAGTCTTGTTCGCTTCTGTTTCT
ATTTCATTTGATTtggaaacattgtttttatCTGTTTCGTCTTTCTCTGA
TTTCACTAGCTCGCCCGATGCAAGTGGCGTTGGTTCTTCGTAAACAGACA
TGTTAGCTAAGTTTCCTGTCACTGTTTGAAGAATCTCTTCCAATCCGCCA
TCAGTGTCCTTGTTCTCTTGAGTTTCACTTCTGTCTGATTTAATAGCTGA
ATTCGGAGCTGACTTTTCCTCAAACACTGTCGGAAGCTCTGGCATTGTAA
TCAAAGACTTTCGTCTAGTTTTGAGTTTATTAGATGGTCCTGGTCCTGAA
TTATTAAAGTTCGTTGTCGGTGTTGGTGTAGAGGTCTGGATGGGAGCATC
AGAGCTCTCATTTGGTTCAATGTTTGAGAAGAAGACACCGCTATTGATAT
CAAGTGTTTCAAATGTATTATTAGCGGATGTTGTTTGACATGCAGCTTGT
AGGTAACTATCATCGTCGTAATCAGAATCATATTTTAAAGATTCGTTTGT
CTTGGGTCGTTGCTGTTGGAGACCTGGTTGATTCATAATGGCGGGTGTGT
AGCGCAACATACTGTCTGACATACTCATTTTGCTTGTATCGGTGCTTTTG
CGTGGGCTATCATCATTCGGTGTGGAGGTCTCGAACTTTATCATGGAATC
AGAATTCTCATACTCCATACTGATTTCACGAAACGGGACACGTTCTCCCG
AACTGACATCATGATGGTAAAAATCATTCACCTCCAACAAGCGCATGCTT
TCTGTCATTTTATTACTCGCCTCAGACTCCTCTAAAAGATCTTCAAACGA
GATATGTTTTTGACTAACATCCGAAGAGTCAGCTTCGAGTTTATCAACAG
AGGACGAACTTCTGAATACTTTCTTAAGCTTAGGTGTAGCAAGCGTATCG
AATTTATCCATATGGTTGCAAGTCGATGAAAAACAATTCTTGCACAAAAG
TCCTGTGCTCTtattatacaaaaatgaaaGTCTGGTAGATGTTCGTCCTC
CCATGTTAGCCATGAAACTACGATTGGTTGTTTCGGTACTGGGAATAATG
AAACTGGAATCTTTTTCATCGAATCCGTCTGGTAGGTTATATTGTTGTTC
ATTTTCCGGCTGTTTGGTACGGTGTGAAGATTCAGTACGATCTGAGTTCC
ACTCGTTATTATTGTTGAAGATATAATTACGTAACATATTCGCTGTTTGC
GACATATCATTTGTTTCGTCAAGTGAAATACGgaaattgtatttattttg
tGGATGGTGCGGAACTAATCCGGAACTCATTTCAAGATAACTCGGACTTG
TCCCTTGGAAACTTGCGGTACTGTCATTTAAGTTTAGCGGTAGATGAAAT
ATAGGCCTGTTTGGATTTCTTTGATTTGGCGCCGGGTCAACTTCAGTGCT
GCTCTTTGTAACGACGAGATTATTTTGACCGGCAGGTCCCCATCCGTTGC
GGTATAAACTAACGCTATCTTGGTGTCTTAAACCGGTTGTTTTAACTAAT
GCTACTTTCTTGTGGTCGGTGGGAGGTCCAACAGGTCGTGGGGGCTTTTT
TGCTAATGGTTGATTACTGATTGATACAGCTGTCTGGATGGGAGTATTTT
TGGTGATTGGCTCCTCGGCTATTTCTTTTTCACGAGAGTCCTCTTCCTGT
GTCGGCTTTGACGGAATTTTGATCAGCTCCTCATTTTTCGTCGTGGTTTC
TTTCTTTGAAACAGTTACTGATTTGTTAGCTTTCTTTGTCGTTTTTGTTG
TCGAAGTTTTCGTTTTATTTGCCGTTGTTTTCTcatctttttttgatttg
tccGAAGACCCAGATAATGTTCGTGTTATTTTACGgtcagattttttttt
ggttttagtGATTCCCACAATGCCAACATCTTTTTTCGCTGCTGTTGATG
TCTTCTTTGGTTTTTTATTCGTGGTTGCTTTAGCATTACTGGCAACTGTA
CTTTTGCGAATAGATTTCGTTTTCGTTGGTTGCTGTTTAACAGTCATTTC
TTTCTTCTGTACTGACAacat
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_045467XLOC_045467Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073284-proteinTCONS_00073284-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073284-exon-scaffold_89-1491911889:210927..215019TCONS_00073284-exon-scaffold_89-1491911889:210927..215019Clytia hemisphaericaexon
TCONS_00073284-exon-scaffold_89-1510915933:210927..215019TCONS_00073284-exon-scaffold_89-1510915933:210927..215019Clytia hemisphaericaexon
TCONS_00073284-exon-scaffold_89-1575043694:210927..215019TCONS_00073284-exon-scaffold_89-1575043694:210927..215019Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_89supercontigscaffold_89:210927..215019 .
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0 0.00890741 0.0206847 0.0202368 0.0246363 0 0.0822054 0.0549712 0.538813 0.381375 0.379426 0.456256 5.33381 4.71906 0.78839 0.868328 0.87771 0.913681 13.4969 11.0854 2.16374 1.84802 0.722654 1.05691 1.9222 3.09843 0.400799 0.173771 0.0304152 0
Blast
The following BLAST results are available for this feature:
BLAST of TCONS_00073284 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 0
Match NameE-valueIdentityDescription
back to top