Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00073274 (transcript) - C. hemisphaerica

Overview
NameTCONS_00073274
Unique NameTCONS_00073274
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length2604

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00073274 ID=TCONS_00073274|Name=TCONS_00073274|organism=Clytia hemisphaerica|type=transcript|length=2604bp
CGGATCCTCTCATATCAAATACGTGAAAAGTTCAAGCGATTGCTTTGCTT
TCTCTTACTAAAAACAGAGAAAAATTGTAACTGTTTAACAATAAACAAAA
GGGGAATAAAGTTTTGTTACATGATGCTGGTTGATACGGTTTTTCTTGTA
GTCATGGTTTTGGCTTGCCAATGTTTATGTAAGCCATGGCCCAAACGGAG
GACATTTAGAAGTACAATGCTCCTGGAGAGGGCAAGCAAAGATAGAATGC
AGGCTTTATACAATAGTAGATCGTCAGGGTTGGCTTCAGAAATCAATAAC
CTTGGATCACACATTGAAAAGACTAAGTTATCCAATTTCCACGGAATCGA
CAATTTGAATGGGTTTGAAACATCAACTAACACCGAGACGCAACAATCAC
CGCAAGTCGTTCAAGAGCTAAATAACCAATTACCAGAATTCACCCATGAA
GTCAACAGACATATACAATATAAATCATTACGGCGGAATGTACACAAGAG
ACAGAAACGCACAGTACCTTTGCTATCACCTTCAAAGACAATGTACATCA
TTGGGGAAACTGAAGACAGACCTCTAATTATGATCGAGAAGCAGCATAAT
AAGCTGATTATAAAGGTCGAAGAGCAACAGATCATTGACACAGACATACA
AGAACAAGATAGAGCTCCAGAAGAATCTATGACAACACAATCAAATCCAG
ATGAACAAAAGAATGGGATTGAAATCAAAACACAATCGCGAGTACCATAC
TTGAAAAATTTACAACAACAAGCTAGAGCGCGATCAGCTGCAAGCAATCA
TCATATACCTTCATATTTAGCCGGTGGAGATGTTGGGCATGGTATTAATT
TTTTCGACAAAGATGGAACATTCAATAAAGAAATCAGGTCATCCAGTAGA
AAGACTAATAAAAAACCGACACATTCGTTTGACGATAAAGATGGCGTTTT
TATACATGACGTTGACAGCCACGGTGACGGTAGTAAACATAAAGACGACA
TACAGATACcagcaaaatttctttatcTCTACGATAAAGGGGAAACCAAT
TACAACAGGGAGTCGAGATTAACAACCATCTCCATCAACTTGACAACGAT
ACATGACGTAATAGAAGGAGCCAAACTCAACCTACGGATATTTAACAACA
CCAAAATCAAAGCATTCTATTTAACAAATGTtgcaaagtctttcaaagtt
caTCTCAGAAGAAGTTTATACGATGTTACACAGATATTTAACACTAAATG
GTTGACCATTGATTTTTCGAGGCAGTTGAAAGAATTGGTTAAGAAACATG
GAAACAGtATGCTGTTACGTATCCAAATCACGTCGTCTGATCGAGTAACG
TCACTCAAGCAACGTAAAGAAACTTACGTCAAGTTAGCTATCAAGCCACC
GAAAACTCGTACTAAAAGACATAAAGATACCGATTGTGCGCTTAAATCCT
CCTATTTGAATCTTAGCGACCTTGGTCTAAAATCTTTAACACTTTGGGAT
AATAAACTAGCGATACGATATTGTGTTGGCAAGTGTAATGGTAAAAATGG
CCAGGGTGACGTAAAATGTTGCGTGCCAAGTAAATGGGGTATACGTGAGG
AGCATACGGTGCAGATAGGTGGGGTGCACGGTATAATGACAgacattttt
attgaaaaaaatgttttagaaTGTGAATGTAGGTGATAGACCTTAGCGTT
CATACAGTGTCCATGATAAACGTTTTATGGACGTTGAGTGGAGACCATGT
CAACATCTTCTGGAGGGAAATCCCTTTTTTTGCGGGACTTGCGGAGCTTA
CATGTGTACTGTCCTGGAAAGCGACAACATCGCCAGATCCTGATGACCCA
AATGTGACGTTACTAATAAACTGAGAAGAAGGCATGACGCATCCAGCAGA
AAACATGAAAAGCACCTTTAACCCTTTTTCTTATCAAGCTGCATATAATT
GAGCTACAGTATTAGAGAAAAGTTCGGTTGACAGACTTTCTTCAACGAAA
CCGAGGCTACATCACTATTTGCAATGGTTCAAAGGTGACCAACCCGGAGA
GATacgtgaaaaaaattcttttacagtttcgaaattgggaaaaaaacaaa
acagatagAACGTGATATTTTCAGACGCCGCATACTATAAGAGGAAAAAA
AAACTCCGACGCAACAAATATAACGTTTTGATAATaacattcaaatttca
aaatatgatgattgtctattcaaaatttgaaatagcttGAAGCTTAAGGC
ATCTATAACTTGACAGAAATAGAAAGATTGGTGACGAACAAGAAATACAT
ACTCAGACAAGTGAATCGATTCTTGATAAGATAATTTTAACCATATGAAG
CGTCAAATTACGTGAACTTGCTATGTGGACttttactctttttttataag
aactagtagACTTTTTATGAGGCTCGGCagttcttattttttagcacttt
gagcctcaaattgttcttatggtgtttttatttttattttttaagcgTAG
AATTGAGGTATTTAAGGCTTTATACACAATTTTTACCACTTTGACCCCCT
ATATTGCTTGATgtattgttcttaacttgttctaattttttggcgatttt
gagc
Run BLAST on NCBI

protein sequence of TCONS_00073274-protein

>TCONS_00073274-protein ID=TCONS_00073274-protein|Name=TCONS_00073274-protein|organism=Clytia hemisphaerica|type=polypeptide|length=561bp
RILSYQIREKFKRLLCFLLLKTEKNCNCLTINKRGIKFCYMMLVDTVFLV
VMVLACQCLCKPWPKRRTFRSTMLLERASKDRMQALYNSRSSGLASEINN
LGSHIEKTKLSNFHGIDNLNGFETSTNTETQQSPQVVQELNNQLPEFTHE
VNRHIQYKSLRRNVHKRQKRTVPLLSPSKTMYIIGETEDRPLIMIEKQHN
KLIIKVEEQQIIDTDIQEQDRAPEESMTTQSNPDEQKNGIEIKTQSRVPY
LKNLQQQARARSAASNHHIPSYLAGGDVGHGINFFDKDGTFNKEIRSSSR
KTNKKPTHSFDDKDGVFIHDVDSHGDGSKHKDDIQIPAKFLYLYDKGETN
YNRESRLTTISINLTTIHDVIEGAKLNLRIFNNTKIKAFYLTNVAKSFKV
HLRRSLYDVTQIFNTKWLTIDFSRQLKELVKKHGNSMLLRIQITSSDRVT
SLKQRKETYVKLAIKPPKTRTKRHKDTDCALKSSYLNLSDLGLKSLTLWD
NKLAIRYCVGKCNGKNGQGDVKCCVPSKWGIREEHTVQIGGVHGIMTDIF
IEKNVLECECR
Run BLAST on NCBI

transcript from alignment at scaffold_89:299982..307849-

Legend: exonCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00073274 ID=TCONS_00073274|Name=TCONS_00073274|organism=Clytia hemisphaerica|type=transcript|length=7868bp|location=Sequence derived from alignment at scaffold_89:299982..307849- (Clytia hemisphaerica)
CGGATCCTCTCATATCAAATACGTGAAAAGTTCAAGCGATTGCTTTGCTT TCTCTTACTAAAAACAGAGAAAAATTGTAACTGTTTAACAATAAACAAAA GGGGAATAAAGTTTTGTTACATGATGCTGGTTGATACGGTTTTTCTTGTA GTCATGGTTTTGGCTTGCCAATGTTTATGTAAGCCATGGCCCAAACGGAG GACATTTAGAAGTACAATGCTCCTGGAGAGGGCAAGCAAAGATAGAATGC AGGCTTTATACAATAGTAGATCGTCAGGGTTGGCTTCAGAAATCAATAAC CTTGGATCACACATTGAAAAGACTAAGTTATCCAATTTCCACGGAATCGA CAATTTGAATGGGTTTGAAACATCAACTAACACCGAGACGCAACAATCAC CGCAAGTCGTTCAAGAGCTAAATAACCAATTACCAGAATTCACCCATGAA GTCAACAGACATATACAATATAAATCATTACGGCGGAATGTACACAAGAG ACAGAAACGCACAGTACCTTTGCTATCACCTTCAAAGACAATGTACATCA TTGGGGAAACTGAAGACAGACCTCTAATTATGATCGAGAAGCAGCATAAT AAGCTGATTATAAAGGTCGAAGAGCAACAGATCATTGACACAGACATACA AGAACAAGATAGAGCTCCAGAAGAATCTATGACAACACAATCAAATCCAG ATGAACAAAAGAATGGGATTGAAATCAAAACACAATCGCGAGTACCATAC TTGAAAAATTTACAACAACAAGCTAGAGCGCGATCAGCTGCAAGCAATCA TCATATACCTTCATATTTAGCCGGTGGAGATGTTGGGCATGGTATTAATT TTTTCGACAAAGATGGAACATTCAATAAAGAAATCAGGTCATCCAGTAGA AAGACTAATAAAAAACCGACACATTCGTTTGACGATAAAGATGGCGTTTT TATACATGACGTTGACAGCCACGGTGACGGTAGTAAACATAAAGACGACA TACAGATACCAGCAAAATTTCTTTATCTCTACGATAAAGGTAAGTAAAGA AAGTTTTTATCATCTCCCTTGAATACGAGTTTCCCAATGAGGGTAGACAT AGGTATAAATGTTTTTGGTATGTGCAAGCGGTAAGGGCTTCTCTCTCACA CCTCAAAATCTCCTGAGGTTGTTTTAAAAACCAATCTTCTTTCTTAAAGG GTCTCACATTTATGAAAATTGAAAATTTCTGAAACACCCAGATCACTAAT TTCAAAAAGTTGTGACCAGAATTCAACAGAAATGGACCGAAAATTTGAAC AAAATCCCTCTGAAGGACCCAAAAACATCAACATATTCGGCAAAATCTTT TATGTATATTTTCTAATTTCCCTCTTATAATACCTCTTTAAACATACAAA CAGGAAAAAAATAAAATCAGAATAGAATATTTAAAAATATAATCAAAGCC GTGCTAGAAGCCTCAGGAGCCAAGAAAGACAAGAAAAGAGAACTTTGCAG AGTTCAGGAAAACAATCTAAATTTCTTAAGAGGGCCCTATTAAACGGATT GAAGAGAGAAGCAGCCCACTACTCGAAAAATGACAATCAAAATGTACGCT CTATTTTGATTACAAATACCACGAATTTGTTGTATGTTTTGAATTTAGAA TTAAAGGTTTAGCAATACTTTATCACGTTTTCATGTATTGTAAATAATAA ACTAGATTTCAAAGTGAAAAATTAGCAAAACGTTATACGTTGGAGACCAT GTTCACACGTTACTGTTTCATCTCGCTCCGGTATGACTTTCGTTACAGAT CGAGAGTGTTCATATTGGTTTCGGAACGTTTCGGAGCAAGAAAACGGAGC AGTTCCGTTCCGATGAAAAAAGAGCAAAACCATTTTGATCTGTTTTGCTT TGTTTTTTGACATTTCGAATTTTGACGTTCACACTTGTTTTTGGAACCGT TTCGTTTCGTTTCGTTTCGTTTCGTTTCGTTTCGTTTCGTTTCGTTTCGT TTCGTTTCGTTTCGTTTCGTTTCGTTTCGTTTCGTTTCGTTTCGTTTCGT AACGTCTGAACATTGTCTAAGTAGTTGACCTTTTCTAAAAAACACATTAG CGTTTATAGTATACCCATAGTATGATAGTTAATAGAAACCAATTATAAAA TGCTTATAATATATTATTATAGGGGAAAACCAATTAAGCCGAAATTGTAT TTTTTTTTCAAGCAAGCCGCCAATGTAGTTACGCATTTTCAGAGTCTAGA GGTTATTTTTTTGTTGCTTATTGTCAGTTTTACTATAAATCTCAGTTTTT CTGATTTTTCGAAAAGAATAAGGTGCAATTATTAGAAAAAAGCCTGGGTT GTCAAAATAATTGAAAAAAATGGCTCCGAAGAATTTAAAAGGCCTTGGAA AATCAAAATTTATCGGCAATTTTTGCACGCACGAAAAGAATGATTCGGTA GCAAACGTTTTTAAAGAATGTCGTTACTATAGACATAATCTTTGATGCCA AAAACCAAAGTATCACTTTAGATTGATTATTTGGCATGTGACAGAAAACG TTGGCGTGTGGTGCCTGTCATACGAAAGTAAAAACCTCAAATAATGAAGC TTTCTTTATGTTTATTCCTTAAGGCCGGTCTCCACTTGCACGCGCTTCAA TCGCCCTTTTTATAGCAAAACTTCCACGTTAATGATCGTCTACGTTATTG GTCAAAAGAAAAATGAAGCTACTCCTTTAGCGCGAGCTGACGTAACGGTT GAAAACAGCTGAAATGTGTCAAACTTTTTTTTCGAGAACACGCTACATTT TTATGACGTAATCTTTTCCCAAGCAAAAAGGATTGAAGCCAAAAAGTGCG ATCCCAGCAGGAGCAAGTGGAGACCGGCCTTTAGTATTTCTTTGATGTAT TGAGGTTCATTTAGGTCAAGTAAAGGAGGTTAAAAAAAATCATTCGTGAA GAAAATATATTGCGCCTTCTCTATCATCACTACACAATATTGGAGAAAAC TAGATTTTGATATAATTTTTTACTAGTGACGAACAAAACTGAGATAGAAA TTTCGGGCTGAGGAGTTATTGTTCGTAACGGGAGACAAGCAGATCACGCG TGACTCTTCTTAGTCCTTTTGGGAATGTTATTGCACCTTAACCCCGCGTG TTCTTCCTTTTTTGACCCATGCAGTGCTTGGTCGTGTTTTTCATACCCTC TTCCGACCCTTGCATAAACTCGATTATTTTACCCATACGGGTCTCTCGTC TCACCGTCGGAATTTATCAATTAAATTGTTGAAGGTCGCTTCACTTAGCT TTTTAGATTTATAGAGAACTATGATTTCGGGGTAAAATTCTCATAATTTA TCCTTAACATAGCAGCTATAGAATTGTAGTAGCTCAATAAAAACCATGTC AAAATTAACCTCAATATATTTTTTCTATAGGGGAAACCAATTACAACAGG GAGTCGAGATTAACAACCATCTCCATCAACTTGACAACGATACATGACGT AATAGAAGGAGCCAAACTCAACCTACGGATATTTAACAACACCAAAATCA AAGCATTCTATTTAACAAATGTTGCAAAGTCTTTCAAAGTTCATCTCAGA AGAAGTTTATACGATGTTACACAGATATTTAACACTAAATGGTTGACCAT TGATTTTTCGAGGCAGTTGAAAGAATTGGTTAAGAAACATGGAAACAGGT AAAAACATTTATGGCGATTTATGGCCTATTTCATAGGATTCGTGAATCTG TTACATGCTATTTTTTGTTCAATTTAAAGGGGAAAATACACATATCGGTG CAGAGTTCCCCATCGGGAAATTTGTGTTTAATTACTACAATGGCGTAGAA AAATATCATGTACTAAAAACACGTATCCTATGAAATAGGCTAATTATGTC TTAAATAAATCTATACATAATCCATGTGTACAAATTAGTATTTAGGCTAC ACACATCCCCCCTGATATGTTTTGATATAGGGGTTACGTATCGTCCGAGA GAGTTGTTTTTCAGGGCTATATTTCAACAGGCTGGTTGAACGTTACGCTT TCTGTGTGTATTTTCTTAACAAACGAACGAGATTCGTATCAGTCTTATCA AATTCGTATCAATCAAAAAACAGATTACCACAAGGAAATTTTATACACGA TACACATCTTCTTTATATCAAAATCAATCTCTGGGCCAAATTAATAGTCT TTTCTTTTGGCATAAGCACAAGAAAAAATCAAAAGAATCACTGTGACGGC TTCCTAAGTAAAATCGGGTTAAAAAGCTTTAGTCTCCATAACTCGAACCT CTATAACTCGAATTTCGCCTTAACTCAAACAAGTCTGTTTGTCCCTAAGG ACTAGGTATTTCAATTTGTACATGTAGAATCTGTCCGTATAGAAAATAAT TTTTATGCACATCTGCTGATAGCCTTATGCGTGAAACACCGTGTAATGGC TGTTTTTAATTTTTGAAGAGAAATATATTAAATTGAAGTATGCTTGTATC TTCAGTTAACCAGACCTTATAAACTAGTCTCGAATTTTCCATAGATCGAA CAAATTTGCGCCCTCCCCTAGGCTATCGAGTTATGGAGGTTTCTCACCGT GAATTATTACTAGAATGTAGAAATTAACAAAAATTTGATTTTTTAGAACA GTTGAAAACAATCGATTATATGAAAGTAATCAATTGTAAATAATGGATTC CATCGGAAATTTGATGTAATATTTTACCCCCTTCGTTAATTGCGTAGAAA AAATGCGGGTGACGTCTAATGTAGGCTAATTCTACCCCCGTCCCTTTGAA TGAATTTAGTTGGCCCAAGTGATCGTATATCTGTTTCACATTTGCTTTAT ACAGTCAACTCTCTATAATTCGAACCTCTATTATTTGGATTTTTCTGTAA TTCGAACTCAAGTATTGGTCTCCTCAGCTGGAAAGATGTGTATAAGGCTC CCTGTAATTCAAATCTTTGTCTCGTTCAAATAAAATTGATGAGCTATGTA AAACAATTTCGAATATACAGTCAACTCTCTCTAATTCGAATTTATAAATG AATTTTTCTGTAATTCGAACTTAAGTATTTGTCCCATTAGGCTAGAAAGT GGTTTGAATTATTTCCATAAATCGAATCTTTCTATAATTTGAACAAAATT TTAAGCACCTTGAACATCGTATTAGATATGGATATCAATGGTATGATAGT TGAACAAAAGGAAACATAAGACTTGTTCGAGTTAAGGAAACATTCGATTT ATAGAGGTTCAAGTTATAGGACTGCAACATTGTATGATATGGCATGACTG AAACCATGATTTAATGCACGCTTTACAATATATTATCCACCCAAAATACA CACTTTTAGATAAGAACTAGCATATTTGACTGCGAGAGATCCAGATGTTC TTATTTTTGCATATTCCTAGGGTCAAATGTTCTCAATTTATTCTTACTTT CTTTGAGAACTTTATAATACCTTTCAATTTTTAAACATTTTCAAAATCAT ACAGCCTCAAATTATTCCTAAAACCTTTTAGCTTTAAGCAAAAATTGAGG TTCGTGTTCTTATAAAAAGCATGTATAATTAATAGGCTTAGATAAACAAG GAGAATAACCACTTCTTGGCTTCTTCAAGTACTTTTGGAACCATCAATTC GTGTCCCCTCCCAATTCCAAATTTCATCTTTAGTAAAAACCACTTTGCAC TTTCCTATTCATAATATAACATTACAATTTAAAACTCAAACGGTCAAATT TCATAAAATTTACCCAATTAAAGCGAAAAACAAAGATATTTCACCAAGCT CTTGAATGAATAGGTTTTTGACTCGAAAGTTTTTATCCAGCTTTCACAAT ACCGATTGAAAGGCAGTCACTTCTCTCTAACTCGAATCACTTTTATTTGA ATCTTTCTGTAATTGAACTAAAATATTGGTCCCCCTCAGCTGGTTAGCAG TTTGAAATACTCTCTGTAATTCGAATCTTTCTCTATATCAAATAAAACTT TTAGTCCCTTAAAGATCGAATTAGAAAGATAAAATTGTAACTTAAACTAA TTAGCCGACCTGCGTCTTCTTCAATAATGTGCGTATTCAAACGCATGTTC CACAAATATGAAAATCTGCTCGATAATGAAAAAAAGTCACGGTGATAGTT TAAAGTTCATGGCGAACGGCAATGATTGTACATACACGTCTTTTAGGAAA AACACTTTTAAGAAACATGAGGCTCAGAATGCCTAAAAACTAAGAAACAT CTAAGAAACATGCTCAGGCTGAGAATGAGAAAATAACATTTTTTAATTCG GTTTTTTATAAGAACCTTCCAATCAAGGCTAATTATGTCAAAAAGTTTAG AAACATTTAAGGCTCAAAAGGCCGATTTCTTAAGAAACATTGAGGCTGCT TGGTAAAACTAGTTTCTTAAAAAAAAAAAACGTGTATAGTCAATATTCTT ATCAAAAGTTTAAATCCTCTATAATTCGAAATTGTCAATCGTAAAAGATT ATTGGCCCGTTAAGGATTGAATTAGAGAGAGAGAAGTTTAACTGTAGCTT TCTTTCACTTTCATTTTTCAGTATGCTGTTACGTATCCAAATCACGTCGT CTGATCGAGTAACGTCACTCAAGCAACGTAAAGAAACTTACGTCAAGTTA GCTATCAAGCCACCGAAAACTCGTACTAAAAGACATAAAGATACCGATTG TGCGCTTAAATCCTCCTATTTGAATCTTAGCGACCTTGGTCTAAAATCTT TAACACTTTGGGATAATAAACTAGCGATACGATATTGTGTTGGCAAGTGT AATGGTAAAAATGGCCAGGGTGACGTAAAATGTTGCGTGCCAAGTAAATG GGGTATACGTGAGGAGCATACGGTGCAGATAGGTGGGGTGCACGGTATAA TGACAGACATTTTTATTGAAAAAAATGTTTTAGAATGTGAATGTAGGTGA TAGACCTTAGCGTTCATACAGTGTCCATGATAAACGTTTTATGGACGTTG AGTGGAGACCATGTCAACATCTTCTGGAGGGAAATCCCTTTTTTTGCGGG ACTTGCGGAGCTTACATGTGTACTGTCCTGGAAAGCGACAACATCGCCAG ATCCTGATGACCCAAATGTGACGTTACTAATAAACTGAGAAGAAGGCATG ACGCATCCAGCAGAAAACATGAAAAGCACCTTTAACCCTTTTTCTTATCA AGCTGCATATAATTGAGCTACAGTATTAGAGAAAAGTTCGGTTGACAGAC TTTCTTCAACGAAACCGAGGCTACATCACTATTTGCAATGGTTCAAAGGT GACCAACCCGGAGAGATACGTGAAAAAAATTCTTTTACAGTTTCGAAATT GGGAAAAAAACAAAACAGATAGAACGTGATATTTTCAGACGCCGCATACT ATAAGAGGAAAAAAAAACTCCGACGCAACAAATATAACGTTTTGATAATA ACATTCAAATTTCAAAATATGATGATTGTCTATTCAAAATTTGAAATAGC TTGAAGCTTAAGGCATCTATAACTTGACAGAAATAGAAAGATTGGTGACG AACAAGAAATACATACTCAGACAAGTGAATCGATTCTTGATAAGATAATT TTAACCATATGAAGCGTCAAATTACGTGAACTTGCTATGTGGACTTTTAC TCTTTTTTTATAAGAACTAGTAGACTTTTTATGAGGCTCGGCAGTTCTTA TTTTTTAGCACTTTGAGCCTCAAATTGTTCTTATGGTGTTTTTATTTTTA TTTTTTAAGCGTAGAATTGAGGTATTTAAGGCTTTATACACAATTTTTAC CACTTTGACCCCCTATATTGCTTGATGTATTGTTCTTAACTTGTTCTAAT TTTTTGGCGATTTTGAGC

Coding sequence (CDS) from alignment at scaffold_89:299982..307849-

>TCONS_00073274 ID=TCONS_00073274|Name=TCONS_00073274|organism=Clytia hemisphaerica|type=CDS|length=5058bp|location=Sequence derived from alignment at scaffold_89:299982..307849- (Clytia hemisphaerica)
TATGCTGTTACGTATCCAAATCACGTCGTCTGATCGAGTAACGTCACTCA
AGCAACGTAAAGAAACTTACGTCAAGTTAGCTATCAAGCCACCGAAAACT
CGTACTAAAAGACATAAAGATACCGATTGTGCGCTTAAATCCTCCTATTT
GAATCTTAGCGACCTTGGTCTAAAATCTTTAACACTTTGGGATAATAAAC
TAGCGATACGATATTGTGTTGGCAAGTGTAATGGTAAAAATGGCCAGGGT
GACGTAAAATGTTGCGTGCCAAGTAAATGGGGTATACGTGAGGAGCATAC
GGTGCAGATAGGTGGGGTGCACGGTATAATGACAGACATTTTTATTGAAA
AAAATGTTTTAGAATGTGAATGTAGGTGAGGGAAACCAATTACAACAGGG
AGTCGAGATTAACAACCATCTCCATCAACTTGACAACGATACATGACGTA
ATAGAAGGAGCCAAACTCAACCTACGGATATTTAACAACACCAAAATCAA
AGCATTCTATTTAACAAATGTTGCAAAGTCTTTCAAAGTTCATCTCAGAA
GAAGTTTATACGATGTTACACAGATATTTAACACTAAATGGTTGACCATT
GATTTTTCGAGGCAGTTGAAAGAATTGGTTAAGAAACATGGAAACAGCGG
ATCCTCTCATATCAAATACGTGAAAAGTTCAAGCGATTGCTTTGCTTTCT
CTTACTAAAAACAGAGAAAAATTGTAACTGTTTAACAATAAACAAAAGGG
GAATAAAGTTTTGTTACATGATGCTGGTTGATACGGTTTTTCTTGTAGTC
ATGGTTTTGGCTTGCCAATGTTTATGTAAGCCATGGCCCAAACGGAGGAC
ATTTAGAAGTACAATGCTCCTGGAGAGGGCAAGCAAAGATAGAATGCAGG
CTTTATACAATAGTAGATCGTCAGGGTTGGCTTCAGAAATCAATAACCTT
GGATCACACATTGAAAAGACTAAGTTATCCAATTTCCACGGAATCGACAA
TTTGAATGGGTTTGAAACATCAACTAACACCGAGACGCAACAATCACCGC
AAGTCGTTCAAGAGCTAAATAACCAATTACCAGAATTCACCCATGAAGTC
AACAGACATATACAATATAAATCATTACGGCGGAATGTACACAAGAGACA
GAAACGCACAGTACCTTTGCTATCACCTTCAAAGACAATGTACATCATTG
GGGAAACTGAAGACAGACCTCTAATTATGATCGAGAAGCAGCATAATAAG
CTGATTATAAAGGTCGAAGAGCAACAGATCATTGACACAGACATACAAGA
ACAAGATAGAGCTCCAGAAGAATCTATGACAACACAATCAAATCCAGATG
AACAAAAGAATGGGATTGAAATCAAAACACAATCGCGAGTACCATACTTG
AAAAATTTACAACAACAAGCTAGAGCGCGATCAGCTGCAAGCAATCATCA
TATACCTTCATATTTAGCCGGTGGAGATGTTGGGCATGGTATTAATTTTT
TCGACAAAGATGGAACATTCAATAAAGAAATCAGGTCATCCAGTAGAAAG
ACTAATAAAAAACCGACACATTCGTTTGACGATAAAGATGGCGTTTTTAT
ACATGACGTTGACAGCCACGGTGACGGTAGTAAACATAAAGACGACATAC
AGATACCAGCAAAATTTCTTTATCTCTACGATAAAGTATGCTGTTACGTA
TCCAAATCACGTCGTCTGATCGAGTAACGTCACTCAAGCAACGTAAAGAA
ACTTACGTCAAGTTAGCTATCAAGCCACCGAAAACTCGTACTAAAAGACA
TAAAGATACCGATTGTGCGCTTAAATCCTCCTATTTGAATCTTAGCGACC
TTGGTCTAAAATCTTTAACACTTTGGGATAATAAACTAGCGATACGATAT
TGTGTTGGCAAGTGTAATGGTAAAAATGGCCAGGGTGACGTAAAATGTTG
CGTGCCAAGTAAATGGGGTATACGTGAGGAGCATACGGTGCAGATAGGTG
GGGTGCACGGTATAATGACAGACATTTTTATTGAAAAAAATGTTTTAGAA
TGTGAATGTAGGTGAGGGAAACCAATTACAACAGGGAGTCGAGATTAACA
ACCATCTCCATCAACTTGACAACGATACATGACGTAATAGAAGGAGCCAA
ACTCAACCTACGGATATTTAACAACACCAAAATCAAAGCATTCTATTTAA
CAAATGTTGCAAAGTCTTTCAAAGTTCATCTCAGAAGAAGTTTATACGAT
GTTACACAGATATTTAACACTAAATGGTTGACCATTGATTTTTCGAGGCA
GTTGAAAGAATTGGTTAAGAAACATGGAAACAGCGGATCCTCTCATATCA
AATACGTGAAAAGTTCAAGCGATTGCTTTGCTTTCTCTTACTAAAAACAG
AGAAAAATTGTAACTGTTTAACAATAAACAAAAGGGGAATAAAGTTTTGT
TACATGATGCTGGTTGATACGGTTTTTCTTGTAGTCATGGTTTTGGCTTG
CCAATGTTTATGTAAGCCATGGCCCAAACGGAGGACATTTAGAAGTACAA
TGCTCCTGGAGAGGGCAAGCAAAGATAGAATGCAGGCTTTATACAATAGT
AGATCGTCAGGGTTGGCTTCAGAAATCAATAACCTTGGATCACACATTGA
AAAGACTAAGTTATCCAATTTCCACGGAATCGACAATTTGAATGGGTTTG
AAACATCAACTAACACCGAGACGCAACAATCACCGCAAGTCGTTCAAGAG
CTAAATAACCAATTACCAGAATTCACCCATGAAGTCAACAGACATATACA
ATATAAATCATTACGGCGGAATGTACACAAGAGACAGAAACGCACAGTAC
CTTTGCTATCACCTTCAAAGACAATGTACATCATTGGGGAAACTGAAGAC
AGACCTCTAATTATGATCGAGAAGCAGCATAATAAGCTGATTATAAAGGT
CGAAGAGCAACAGATCATTGACACAGACATACAAGAACAAGATAGAGCTC
CAGAAGAATCTATGACAACACAATCAAATCCAGATGAACAAAAGAATGGG
ATTGAAATCAAAACACAATCGCGAGTACCATACTTGAAAAATTTACAACA
ACAAGCTAGAGCGCGATCAGCTGCAAGCAATCATCATATACCTTCATATT
TAGCCGGTGGAGATGTTGGGCATGGTATTAATTTTTTCGACAAAGATGGA
ACATTCAATAAAGAAATCAGGTCATCCAGTAGAAAGACTAATAAAAAACC
GACACATTCGTTTGACGATAAAGATGGCGTTTTTATACATGACGTTGACA
GCCACGGTGACGGTAGTAAACATAAAGACGACATACAGATACCAGCAAAA
TTTCTTTATCTCTACGATAAAGTATGCTGTTACGTATCCAAATCACGTCG
TCTGATCGAGTAACGTCACTCAAGCAACGTAAAGAAACTTACGTCAAGTT
AGCTATCAAGCCACCGAAAACTCGTACTAAAAGACATAAAGATACCGATT
GTGCGCTTAAATCCTCCTATTTGAATCTTAGCGACCTTGGTCTAAAATCT
TTAACACTTTGGGATAATAAACTAGCGATACGATATTGTGTTGGCAAGTG
TAATGGTAAAAATGGCCAGGGTGACGTAAAATGTTGCGTGCCAAGTAAAT
GGGGTATACGTGAGGAGCATACGGTGCAGATAGGTGGGGTGCACGGTATA
ATGACAGACATTTTTATTGAAAAAAATGTTTTAGAATGTGAATGTAGGTG
AGGGAAACCAATTACAACAGGGAGTCGAGATTAACAACCATCTCCATCAA
CTTGACAACGATACATGACGTAATAGAAGGAGCCAAACTCAACCTACGGA
TATTTAACAACACCAAAATCAAAGCATTCTATTTAACAAATGTTGCAAAG
TCTTTCAAAGTTCATCTCAGAAGAAGTTTATACGATGTTACACAGATATT
TAACACTAAATGGTTGACCATTGATTTTTCGAGGCAGTTGAAAGAATTGG
TTAAGAAACATGGAAACAGCGGATCCTCTCATATCAAATACGTGAAAAGT
TCAAGCGATTGCTTTGCTTTCTCTTACTAAAAACAGAGAAAAATTGTAAC
TGTTTAACAATAAACAAAAGGGGAATAAAGTTTTGTTACATGATGCTGGT
TGATACGGTTTTTCTTGTAGTCATGGTTTTGGCTTGCCAATGTTTATGTA
AGCCATGGCCCAAACGGAGGACATTTAGAAGTACAATGCTCCTGGAGAGG
GCAAGCAAAGATAGAATGCAGGCTTTATACAATAGTAGATCGTCAGGGTT
GGCTTCAGAAATCAATAACCTTGGATCACACATTGAAAAGACTAAGTTAT
CCAATTTCCACGGAATCGACAATTTGAATGGGTTTGAAACATCAACTAAC
ACCGAGACGCAACAATCACCGCAAGTCGTTCAAGAGCTAAATAACCAATT
ACCAGAATTCACCCATGAAGTCAACAGACATATACAATATAAATCATTAC
GGCGGAATGTACACAAGAGACAGAAACGCACAGTACCTTTGCTATCACCT
TCAAAGACAATGTACATCATTGGGGAAACTGAAGACAGACCTCTAATTAT
GATCGAGAAGCAGCATAATAAGCTGATTATAAAGGTCGAAGAGCAACAGA
TCATTGACACAGACATACAAGAACAAGATAGAGCTCCAGAAGAATCTATG
ACAACACAATCAAATCCAGATGAACAAAAGAATGGGATTGAAATCAAAAC
ACAATCGCGAGTACCATACTTGAAAAATTTACAACAACAAGCTAGAGCGC
GATCAGCTGCAAGCAATCATCATATACCTTCATATTTAGCCGGTGGAGAT
GTTGGGCATGGTATTAATTTTTTCGACAAAGATGGAACATTCAATAAAGA
AATCAGGTCATCCAGTAGAAAGACTAATAAAAAACCGACACATTCGTTTG
ACGATAAAGATGGCGTTTTTATACATGACGTTGACAGCCACGGTGACGGT
AGTAAACATAAAGACGACATACAGATACCAGCAAAATTTCTTTATCTCTA
CGATAAAG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_045457XLOC_045457Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073274-proteinTCONS_00073274-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073274-exon-scaffold_89-1575043694:306811..307849TCONS_00073274-exon-scaffold_89-1575043694:306811..307849Clytia hemisphaericaexon
TCONS_00073274-exon-scaffold_89-1575043694:304152..304419TCONS_00073274-exon-scaffold_89-1575043694:304152..304419Clytia hemisphaericaexon
TCONS_00073274-exon-scaffold_89-1575043694:299982..301278TCONS_00073274-exon-scaffold_89-1575043694:299982..301278Clytia hemisphaericaexon
TCONS_00073274-exon-scaffold_89-1510915933:306811..307849TCONS_00073274-exon-scaffold_89-1510915933:306811..307849Clytia hemisphaericaexon
TCONS_00073274-exon-scaffold_89-1510915933:304152..304419TCONS_00073274-exon-scaffold_89-1510915933:304152..304419Clytia hemisphaericaexon
TCONS_00073274-exon-scaffold_89-1510915933:299982..301278TCONS_00073274-exon-scaffold_89-1510915933:299982..301278Clytia hemisphaericaexon
TCONS_00073274-exon-scaffold_89-1491911889:306811..307849TCONS_00073274-exon-scaffold_89-1491911889:306811..307849Clytia hemisphaericaexon
TCONS_00073274-exon-scaffold_89-1491911889:304152..304419TCONS_00073274-exon-scaffold_89-1491911889:304152..304419Clytia hemisphaericaexon
TCONS_00073274-exon-scaffold_89-1491911889:299982..301278TCONS_00073274-exon-scaffold_89-1491911889:299982..301278Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_89supercontigscaffold_89:299982..307849 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0.0148133 0.0144453 0.0167723 0 5.65335 3.8675 0.457075 0.35659 0.112346 0.0463861 0.0150078 0.0394622 0.561554 0.255781 2.10286 1.99492 3.90321 2.1542 0.0629873 0.0329558 0.0143223 0.0628732 0.0849229 0.0463244 0.0159043 0.0425827 0.0406238 0 0.0328831 0.0335027
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR029034Cystine-knot_cytokine
Blast
The following BLAST results are available for this feature:
BLAST of TCONS_00073274 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 0
Match NameE-valueIdentityDescription
back to top