Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00073268 (transcript) - C. hemisphaerica

Overview
NameTCONS_00073268
Unique NameTCONS_00073268
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1734

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00073268 ID=TCONS_00073268|Name=TCONS_00073268|organism=Clytia hemisphaerica|type=transcript|length=1734bp
CAAGCTTCTGTCTCTTGCAGTTAAAGGAAATAAAACTCTGCTCTAAAGTC
AAAATTATAATCAAAAcatgagaattaaaaaaaaaaaggttcagTTGAAG
GGTGCAAAGGTTTGGTTGCTGACCATCcatttaaaaacatgaaatatttt
tatagaaaagggTAAAAGTAAAGTTTTGTCACACTCATAGAGAAGTCATC
TCGTCAACACAAATCGCGTTATTTTAACAAactaatgttaatttttcttt
ctccatTAACAtccagtattttttgaaaaacatttacGTTTTGTGTGTTT
TTGAACTATCGGTGTGGTacgatttttattttcattcataaaaagatttt
ttctttcgttACTACGACACATCACCTTGAAAATAAACACAGGACATCTT
TAGCGATTAGtcaaatttattcatttatGCTGTATATCAACATTGTAAGA
AGTAACAAGATGGTTGTTCGAAGACAAGGATACCTTCTtctctttgttgt
tgttgtcaaATTATGTCAAAGCGTTCCCATAGCAACCACAACCCAACAAC
CAATCACAAGTCGTCCTCACAAAGATTGTTTTCCTTCGGGATTTGAATTT
GCttataatgacgtcatcgatcgtgggaatttccctaatgGTGAAACATG
TTGGCAAATTACTTGTGGTCCGTCGGGTAGATTGATCAAGTCTTTAACAC
CTTGTGAAAAAGTGATGACTCAGCGAAAACCTACAGCAAAACCTTCAGAA
GAAAAACAAGTAGAAAACCAATGCATTTTCAATGCAAGAAAATTCAACCC
AGGGGAAGACATTCAGACGCTCTCTGATTGGCAATCTGACCGTTGCTATG
GTACCCGATGCAGTAAAGATGGTACCATAGTTGCATGGGAAAACATCAAT
TGTTATTCCACACCTTACTACAGCACTACGGAGAAGGGTGGTAGTGTCCA
AACTCCCGAGTTTATTACCACTCCATCGCAGGTAGAATTTTCAACAACTG
AAGCTTCTGGATGTTATGAAAATAGTGTGATTTACCAACCCGGTGAAGAG
ATTAGTTTCCAGTACTTTACGGAGAACTCAACATGTTGTGGACGCTATTG
TAATTATAGCAATAAAATTGTTTCTTGGGAAAAATCCGAGTGTGAACAAG
GAAAATCGACTGTCGAGCCTACTTCAACGCAAATTACTACATTTGGTTCA
ACCACAGATACAGATCAAGGATGTTATACAAATGGCAGAGCGTACAAGCC
AGGAGCACACATCGATTCAGGTAATGATGGTTCAAGTTGGTGTTTCGGTC
GATATTGTAATGAAAACTCTGTCATTGTCTATTGGGATGATTTCAATTGT
GACGTTAAATCTTCTAAAAAACCGTCACTGATTACATCAAAATATGACTT
CACAAAAACACCGTGGACATCAGAATATGACGTCACAAAGCAACCAGTAA
CGTCAACTAGTGACTTAACAACGACTTTGATCACATCgacaaattttgat
gaaatttcaacattaGATCCTAACCATTTGAGTACATCAAGTGGAGGCCT
TTCTACTACTACAGAGGAGGAGGTTACGACTGAACAGCCACCAGTGGAAG
GTTCTCTATGGGAGCAACTTCagtttttagtgaaaaacaAACTATACTCA
ACTGTAGTCGAGGATTCTGGTTTAACGAAATCAAAGGATGGGAAATATCA
AGTGAAACtgtctattttcaaaaaaaaatcatag
Run BLAST on NCBI

protein sequence of TCONS_00073268-protein

>TCONS_00073268-protein ID=TCONS_00073268-protein|Name=TCONS_00073268-protein|organism=Clytia hemisphaerica|type=polypeptide|length=435bp
MLYINIVRSNKMVVRRQGYLLLFVVVVKLCQSVPIATTTQQPITSRPHKD
CFPSGFEFAYNDVIDRGNFPNGETCWQITCGPSGRLIKSLTPCEKVMTQR
KPTAKPSEEKQVENQCIFNARKFNPGEDIQTLSDWQSDRCYGTRCSKDGT
IVAWENINCYSTPYYSTTEKGGSVQTPEFITTPSQVEFSTTEASGCYENS
VIYQPGEEISFQYFTENSTCCGRYCNYSNKIVSWEKSECEQGKSTVEPTS
TQITTFGSTTDTDQGCYTNGRAYKPGAHIDSGNDGSSWCFGRYCNENSVI
VYWDDFNCDVKSSKKPSLITSKYDFTKTPWTSEYDVTKQPVTSTSDLTTT
LITSTNFDEISTLDPNHLSTSSGGLSTTTEEEVTTEQPPVEGSLWEQLQF
LVKNKLYSTVVEDSGLTKSKDGKYQVKLSIFKKKS
Run BLAST on NCBI

transcript from alignment at scaffold_89:193169..197099-

Legend: exonfive_prime_UTRCDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00073268 ID=TCONS_00073268|Name=TCONS_00073268|organism=Clytia hemisphaerica|type=transcript|length=3931bp|location=Sequence derived from alignment at scaffold_89:193169..197099- (Clytia hemisphaerica)
CAAGCTTCTGTCTCTTGCAGTTAAAGGAAATAAAACTCTGCTCTAAAGTC AAAATTATAATCAAAACATGAGAATTAAAAAAAAAAAGGTTCAGTTGAAG GGTGCAAAGGTTTGGTTGCTGACCATCCATTTAAAAACATGAAATATTTT TATAGAAAAGGGTAAAAGTAAAGTTTTGTCACACTCATAGAGAAGTCATC TCGTCAACACAAATCGCGTTATTTTAACAAACTAATGTTAATTTTTCTTT CTCCATTAACATCCAGTATTTTTTGAAAAACATTTACGTTTTGTGTGTTT TTGAACTATCGGTGTGGTACGATTTTTATTTTCATTCATAAAAAGATTTT TTCTTTCGTTACTACGACACATCACCTTGAAAATAAACACAGGACATCTT TAGCGATTAGTCAAATTTATTCATTTATGCTGTATATCAACATTGTAAGA AGTAACAAGATGGTTGTTCGAAGACAAGGTAAGATTTTGTCTAAACACCC CTGTCTCACAGTCACGGTAAGAATTTTTCCAAGAGAGGGGGTTAAAATTT CTATATGGAAGTCCCAATGGGAATAGAAATCCTATTGTTCGAAAGATCTA GTGGGGTGGGTTTGGAGGCCGATTTTCTCCTTGAATTTCAATAAGGATGG AAGGAAATTCAATGTCCCAGTGGGTCTATGACACAGGGGTGTGTCAAAGA TTGTCAATAAATTCCAAATATGGCGTTTGCCTTTATATATAGCTCTGTAT CGTATTAACTTTACCTCGCTGATTCACTGAGACAGGGGTGTCAAAGATCC TTTGCACAATAAATTCCAGGGCGAAAGGTAAAATCAACGGCGAAAGAATA CCTATCTGACACTCATCGTAGTCCGATAATGTGGTTTGGTTTTTCTAATC ACACCTAGCAGTTTGTCTTTCGTAAACTATGCTATGAAAACACCATAGGG CATTGTCGTAGAAAGCTGTTTAAAATTTGAAGTCAAATATCTTTTTCCAG GATACCTTCTTCTCTTTGTTGTTGTTGTCAAATTATGTCAAAGCGTTCCC ATAGCAACCACAACCCAACAACCAATCACAAGTCGTCCTCACAAAGATTG TTTTCCTTCGGGATTTGAATTTGCTTATAATGACGTCATCGATCGTGGGA ATTTCCCTAATGGTGAAACATGTTGGCAAATTACTTGTGGTCCGTCGGGT AGATTGATCAAGTCTTTAACACCTTGTGAAAAAGTGATGACTCAGCGAAA ACCTACAGCAAAACCTTCAGAAGAAAAACAAGTAGAAAACCAATGCATTT TCAATGCAAGAAAATTCAACCCAGGTACATACATAATGTTTAATTACATG CTTTTCATATAAGGAAGATTTGAGCTGTTTTAGGTTAAAAATGTTCGTAG TATTACTTTATTTATTTAGCGACTTAAAATCAGTATTTTCTTGATAATTT CTGAAATCTTTAGGCTGAAATTGTTTTTAACACACACAACGAGTATATTC GTACTAGAGAAATCAATGAATATATATTTTGGAGCCTACGTAAAATTTGT GAAAACTTGTAGTCAGAAAGTCTCCCACCTGGCTGTCCGCAAGAAAAGGA GACGTATTAGAATAATGAGGCAGGGACTTTTGGACACACCAGGGTTGTTC AGACATGTATTTAAATTCAACTTAGCAGCTGACTTCAATGCAAACATAAC TGTTACACGTTTTTTTATAAGAACATCCAAAACTTTTGAACCCTTTGAAT GTTCATAACTTTTTGAATTTCAAGCCTAAAATTATTCTTAAATTCTTAAC ATGCTCTAATTTTTGCCATTTTTTAAATACTTTTGACCATTTTCCAAAGA AATTGGGTTTGGGTGTTTTTAGAGCCCGCGAAGCCTTAAAATGTTCTTAA CTTATTCTTAAGATTTTGGCCATCGAAGCCTTATGTTCTTATAAAAAAAC GTGTATGCCATATGAAGGGGGTATTTGACCTTGTAAAAATATTTAAGATT ATCAATCTAATGGTTTCAAGTTACATCTGAATAAAGGTCCCAGTATTGTG CTAAAAAGACCTTTTGTCGTCATCAGATAGAAACTGAAAATAATTTTGAT ACCTATTGTAGTTCAATTTACAAACATTTTATACAACTTTTTGAATGTAG CTGCCAATTGCCGCGCGGGCATTTTTTTGTCCGTTTTACCACCCTAAACA GGGCCCCGGTTTGAGGGCTGCAGTGAGGGGGCCAAATATTGGGGCAAATT GGCGTTACCCAATTTTGAGTTTTGAGTTTTGAGGGGTTAAACTCTTTCAG GACGGCCTCAGCTAATTTCGTTCCATTTGGAACGATACTTTTCGGCTGCC GTAATATTTTGTAAGGACCTACATTTAGTACGCTGAATAAATAGAGCATA AAAAGAGCTTTCCAACGAACTCAAACATGACCTATTTAGATTGTTTTAAA GCTGAGATAATTGCATCTGAAGTTGGAACTTCTAATGAAAAGTAACTGAA AGTTTTCAAAATAGATTTTCTCGGAAAAAAAGTGAGGAGCCATGCCCCTG CCCCCCCCCCCTATTCTAAAACCGATCCCAGTCTTTTTTCGCACCTAAAG ACAATAGAAAATAGAAAAAAGTGTAAAAAAAGGATTGGATCACCTGACCA CGCGACTATGGTCGAAAAGGTGTATTACATAACATTAGAAAGATAAGCTA TTTTCCTTAAGAAATACCCGCCAAGTTACCGAGATCCTAAACTAGTAGTT TAAATCATAAGGGTTGAAAACGTTACTTAAATTTACATTCTAAATCTTAA TCATCGGGTGTGTGATCATTAAAAAACTAGTTTGCTACTTTGAGGAACTT AGAAAAAGCCTTCCAAAATCTGGCTGTGACACTCACTTTGCACCAATCCA ATAATGTTGGGGTCGTACCTACATGCCATTTTTGTATCGATTAGAAATGT TGAAAAATCGTCCGATTGAGCTCTTAAAAGTCGTTTGTTTGTTTTCTAGG GGAAGACATTCAGACGCTCTCTGATTGGCAATCTGACCGTTGCTATGGTA CCCGATGCAGTAAAGATGGTACCATAGTTGCATGGGAAAACATCAATTGT TATTCCACACCTTACTACAGCACTACGGAGAAGGGTGGTAGTGTCCAAAC TCCCGAGTTTATTACCACTCCATCGCAGGTAGAATTTTCAACAACTGAAG CTTCTGGATGTTATGAAAATAGTGTGATTTACCAACCCGGTGAAGAGATT AGTTTCCAGTACTTTACGGAGAACTCAACATGTTGTGGACGCTATTGTAA TTATAGCAATAAAATTGTTTCTTGGGAAAAATCCGAGTGTGAACAAGGAA AATCGACTGTCGAGCCTACTTCAACGCAAATTACTACATTTGGTTCAACC ACAGATACAGATCAAGGATGTTATACAAATGGCAGAGCGTACAAGCCAGG AGCACACATCGATTCAGGTAATGATGGTTCAAGTTGGTGTTTCGGTCGAT ATTGTAATGAAAACTCTGTCATTGTCTATTGGGATGATTTCAATTGTGAC GTTAAATCTTCTAAAAAACCGTCACTGATTACATCAAAATATGACTTCAC AAAAACACCGTGGACATCAGAATATGACGTCACAAAGCAACCAGTAACGT CAACTAGTGACTTAACAACGACTTTGATCACATCGACAAATTTTGATGAA ATTTCAACATTAGATCCTAACCATTTGAGTACATCAAGTGGAGGCCTTTC TACTACTACAGAGGAGGAGGTTACGACTGAACAGCCACCAGTGGAAGGTT CTCTATGGGAGCAACTTCAGTTTTTAGTGAAAAACAAACTATACTCAACT GTAGTCGAGGATTCTGGTTTAACGAAATCAAAGGATGGGAAATATCAAGT GAAACTGTCTATTTTCAAAAAAAAATCATAG

Coding sequence (CDS) from alignment at scaffold_89:193169..197099-

>TCONS_00073268 ID=TCONS_00073268|Name=TCONS_00073268|organism=Clytia hemisphaerica|type=CDS|length=3924bp|location=Sequence derived from alignment at scaffold_89:193169..197099- (Clytia hemisphaerica)
GGGAAGACATTCAGACGCTCTCTGATTGGCAATCTGACCGTTGCTATGGT
ACCCGATGCAGTAAAGATGGTACCATAGTTGCATGGGAAAACATCAATTG
TTATTCCACACCTTACTACAGCACTACGGAGAAGGGTGGTAGTGTCCAAA
CTCCCGAGTTTATTACCACTCCATCGCAGGTAGAATTTTCAACAACTGAA
GCTTCTGGATGTTATGAAAATAGTGTGATTTACCAACCCGGTGAAGAGAT
TAGTTTCCAGTACTTTACGGAGAACTCAACATGTTGTGGACGCTATTGTA
ATTATAGCAATAAAATTGTTTCTTGGGAAAAATCCGAGTGTGAACAAGGA
AAATCGACTGTCGAGCCTACTTCAACGCAAATTACTACATTTGGTTCAAC
CACAGATACAGATCAAGGATGTTATACAAATGGCAGAGCGTACAAGCCAG
GAGCACACATCGATTCAGGTAATGATGGTTCAAGTTGGTGTTTCGGTCGA
TATTGTAATGAAAACTCTGTCATTGTCTATTGGGATGATTTCAATTGTGA
CGTTAAATCTTCTAAAAAACCGTCACTGATTACATCAAAATATGACTTCA
CAAAAACACCGTGGACATCAGAATATGACGTCACAAAGCAACCAGTAACG
TCAACTAGTGACTTAACAACGACTTTGATCACATCGACAAATTTTGATGA
AATTTCAACATTAGATCCTAACCATTTGAGTACATCAAGTGGAGGCCTTT
CTACTACTACAGAGGAGGAGGTTACGACTGAACAGCCACCAGTGGAAGGT
TCTCTATGGGAGCAACTTCAGTTTTTAGTGAAAAACAAACTATACTCAAC
TGTAGTCGAGGATTCTGGTTTAACGAAATCAAAGGATGGGAAATATCAAG
TGAAACTGTCTATTTTCAAAAAAAAATCATAGGATACCTTCTTCTCTTTG
TTGTTGTTGTCAAATTATGTCAAAGCGTTCCCATAGCAACCACAACCCAA
CAACCAATCACAAGTCGTCCTCACAAAGATTGTTTTCCTTCGGGATTTGA
ATTTGCTTATAATGACGTCATCGATCGTGGGAATTTCCCTAATGGTGAAA
CATGTTGGCAAATTACTTGTGGTCCGTCGGGTAGATTGATCAAGTCTTTA
ACACCTTGTGAAAAAGTGATGACTCAGCGAAAACCTACAGCAAAACCTTC
AGAAGAAAAACAAGTAGAAAACCAATGCATTTTCAATGCAAGAAAATTCA
ACCCAGATGCTGTATATCAACATTGTAAGAAGTAACAAGATGGTTGTTCG
AAGACAAGGGGAAGACATTCAGACGCTCTCTGATTGGCAATCTGACCGTT
GCTATGGTACCCGATGCAGTAAAGATGGTACCATAGTTGCATGGGAAAAC
ATCAATTGTTATTCCACACCTTACTACAGCACTACGGAGAAGGGTGGTAG
TGTCCAAACTCCCGAGTTTATTACCACTCCATCGCAGGTAGAATTTTCAA
CAACTGAAGCTTCTGGATGTTATGAAAATAGTGTGATTTACCAACCCGGT
GAAGAGATTAGTTTCCAGTACTTTACGGAGAACTCAACATGTTGTGGACG
CTATTGTAATTATAGCAATAAAATTGTTTCTTGGGAAAAATCCGAGTGTG
AACAAGGAAAATCGACTGTCGAGCCTACTTCAACGCAAATTACTACATTT
GGTTCAACCACAGATACAGATCAAGGATGTTATACAAATGGCAGAGCGTA
CAAGCCAGGAGCACACATCGATTCAGGTAATGATGGTTCAAGTTGGTGTT
TCGGTCGATATTGTAATGAAAACTCTGTCATTGTCTATTGGGATGATTTC
AATTGTGACGTTAAATCTTCTAAAAAACCGTCACTGATTACATCAAAATA
TGACTTCACAAAAACACCGTGGACATCAGAATATGACGTCACAAAGCAAC
CAGTAACGTCAACTAGTGACTTAACAACGACTTTGATCACATCGACAAAT
TTTGATGAAATTTCAACATTAGATCCTAACCATTTGAGTACATCAAGTGG
AGGCCTTTCTACTACTACAGAGGAGGAGGTTACGACTGAACAGCCACCAG
TGGAAGGTTCTCTATGGGAGCAACTTCAGTTTTTAGTGAAAAACAAACTA
TACTCAACTGTAGTCGAGGATTCTGGTTTAACGAAATCAAAGGATGGGAA
ATATCAAGTGAAACTGTCTATTTTCAAAAAAAAATCATAGGATACCTTCT
TCTCTTTGTTGTTGTTGTCAAATTATGTCAAAGCGTTCCCATAGCAACCA
CAACCCAACAACCAATCACAAGTCGTCCTCACAAAGATTGTTTTCCTTCG
GGATTTGAATTTGCTTATAATGACGTCATCGATCGTGGGAATTTCCCTAA
TGGTGAAACATGTTGGCAAATTACTTGTGGTCCGTCGGGTAGATTGATCA
AGTCTTTAACACCTTGTGAAAAAGTGATGACTCAGCGAAAACCTACAGCA
AAACCTTCAGAAGAAAAACAAGTAGAAAACCAATGCATTTTCAATGCAAG
AAAATTCAACCCAGATGCTGTATATCAACATTGTAAGAAGTAACAAGATG
GTTGTTCGAAGACAAGGGGAAGACATTCAGACGCTCTCTGATTGGCAATC
TGACCGTTGCTATGGTACCCGATGCAGTAAAGATGGTACCATAGTTGCAT
GGGAAAACATCAATTGTTATTCCACACCTTACTACAGCACTACGGAGAAG
GGTGGTAGTGTCCAAACTCCCGAGTTTATTACCACTCCATCGCAGGTAGA
ATTTTCAACAACTGAAGCTTCTGGATGTTATGAAAATAGTGTGATTTACC
AACCCGGTGAAGAGATTAGTTTCCAGTACTTTACGGAGAACTCAACATGT
TGTGGACGCTATTGTAATTATAGCAATAAAATTGTTTCTTGGGAAAAATC
CGAGTGTGAACAAGGAAAATCGACTGTCGAGCCTACTTCAACGCAAATTA
CTACATTTGGTTCAACCACAGATACAGATCAAGGATGTTATACAAATGGC
AGAGCGTACAAGCCAGGAGCACACATCGATTCAGGTAATGATGGTTCAAG
TTGGTGTTTCGGTCGATATTGTAATGAAAACTCTGTCATTGTCTATTGGG
ATGATTTCAATTGTGACGTTAAATCTTCTAAAAAACCGTCACTGATTACA
TCAAAATATGACTTCACAAAAACACCGTGGACATCAGAATATGACGTCAC
AAAGCAACCAGTAACGTCAACTAGTGACTTAACAACGACTTTGATCACAT
CGACAAATTTTGATGAAATTTCAACATTAGATCCTAACCATTTGAGTACA
TCAAGTGGAGGCCTTTCTACTACTACAGAGGAGGAGGTTACGACTGAACA
GCCACCAGTGGAAGGTTCTCTATGGGAGCAACTTCAGTTTTTAGTGAAAA
ACAAACTATACTCAACTGTAGTCGAGGATTCTGGTTTAACGAAATCAAAG
GATGGGAAATATCAAGTGAAACTGTCTATTTTCAAAAAAAAATCATAGGA
TACCTTCTTCTCTTTGTTGTTGTTGTCAAATTATGTCAAAGCGTTCCCAT
AGCAACCACAACCCAACAACCAATCACAAGTCGTCCTCACAAAGATTGTT
TTCCTTCGGGATTTGAATTTGCTTATAATGACGTCATCGATCGTGGGAAT
TTCCCTAATGGTGAAACATGTTGGCAAATTACTTGTGGTCCGTCGGGTAG
ATTGATCAAGTCTTTAACACCTTGTGAAAAAGTGATGACTCAGCGAAAAC
CTACAGCAAAACCTTCAGAAGAAAAACAAGTAGAAAACCAATGCATTTTC
AATGCAAGAAAATTCAACCCAGATGCTGTATATCAACATTGTAAGAAGTA
ACAAGATGGTTGTTCGAAGACAAG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_045453XLOC_045453Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073268-proteinTCONS_00073268-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073268-exon-scaffold_89-1575043694:196622..197099TCONS_00073268-exon-scaffold_89-1575043694:196622..197099Clytia hemisphaericaexon
TCONS_00073268-exon-scaffold_89-1575043694:195776..196099TCONS_00073268-exon-scaffold_89-1575043694:195776..196099Clytia hemisphaericaexon
TCONS_00073268-exon-scaffold_89-1575043694:193169..194100TCONS_00073268-exon-scaffold_89-1575043694:193169..194100Clytia hemisphaericaexon
TCONS_00073268-exon-scaffold_89-1510915933:196622..197099TCONS_00073268-exon-scaffold_89-1510915933:196622..197099Clytia hemisphaericaexon
TCONS_00073268-exon-scaffold_89-1510915933:195776..196099TCONS_00073268-exon-scaffold_89-1510915933:195776..196099Clytia hemisphaericaexon
TCONS_00073268-exon-scaffold_89-1510915933:193169..194100TCONS_00073268-exon-scaffold_89-1510915933:193169..194100Clytia hemisphaericaexon
TCONS_00073268-exon-scaffold_89-1491911889:196622..197099TCONS_00073268-exon-scaffold_89-1491911889:196622..197099Clytia hemisphaericaexon
TCONS_00073268-exon-scaffold_89-1491911889:195776..196099TCONS_00073268-exon-scaffold_89-1491911889:195776..196099Clytia hemisphaericaexon
TCONS_00073268-exon-scaffold_89-1491911889:193169..194100TCONS_00073268-exon-scaffold_89-1491911889:193169..194100Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_89supercontigscaffold_89:193169..197099 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0 0 0 0 0.350861 0 0.0497189 0.221228 0.190343 0.290322 0 0.0491519 0.762027 1.14699 0.198509 0.265604 2.8823 2.69034 1.26556 1.17273 3.2424 3.18127 0.728019 0.910078 0.429465 0.648605 0.877311 0.758841 3.30211 2.16005
Blast
The following BLAST results are available for this feature:
BLAST of TCONS_00073268 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 0
Match NameE-valueIdentityDescription
back to top