Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00073264 (transcript) - C. hemisphaerica

Overview
NameTCONS_00073264
Unique NameTCONS_00073264
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1966

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00073264 ID=TCONS_00073264|Name=TCONS_00073264|organism=Clytia hemisphaerica|type=transcript|length=1966bp
TTGTAAACACGACTGATTGAACAGATATAAAATCACATTCGAGCAGGTAG
AAACTCTACTATTATTCAAAGACTGGGAAATTGAAATCGTACAAAGAGAG
ACGATGGAATGGGTCCTACTGAAAGTATGTCTTTTACTTGCAACCCGCAT
GTGTCAAGAAACCTTAGCTGCCGTAATATCGCCGAATCATGATGGTAAAA
AAATAGATTTAGAGAATAATGTTAGACAGAATTCAACAAAGGATCTTCGA
AGTTCACTACCAAGGCAACtaagaataaacaaaaatcagGCAATCATTGT
GAAGGAACCACGAGATTTTAATATCATTTATGTTGAAAATCGAACCGCTA
TCGTTGAAAGGTtcgaaaatgaaacaaaaacaattgtTGATAGCAATGAA
GTCAAAACAAGATTATCTTTGAAAGATAAGTTACAATCCTTGGTTAAGAG
AAAAGGTATCACTATATCTTTACTAAATCAAGACCAAGAAAGCATGCTTA
ACCTACGGACGAAAGATTGTATTTTACCAACCACGTTTGATGTTCTGATC
GAAATTGTAACAAGATTTGAGCCAAAAGAACTAATTCTCATCTACCATTC
GAAGATTTTAAGTCAGGTAGATATAATAGactggaaagaaaaaacctcAA
AACACAAAGAATTTAAATTTATCGATTTTAAAATCAAAGAAGATGATCTT
TATGACCATACAGGGAAGATTCTAAAAGAAATAAGTCGCTCCACGGATGT
TAAGCTGATTATCTTATTCACACCTTTGGAAATCACGAATCTCATTTTCC
GGTTACGCTCAGAAAAGTTCCGGATGATTACTGGAGGAACTTGGATTGTT
GATAAGGGAATATATCCTGAAGCTGATCGGCCACCAAAAATGGCggaatt
tgaatattttaaatacCGTGTAGTGTTGAACTCAGCTTCCATGCGCTATG
GAGGCTCAATTTGTGATTTGGCAACTAAAATGGCAAGgAAAGTAATCGAA
GAAAAGCTATTGGCAGATGAAATACGAATGATCAGGCTTTGGCAACTCCA
GACTTGGCGAACTGTATACAAAGTCTCATATTTGAACCAGCAGTATCAAC
TTTCATCTCAAAGTATTTTCGGTAAAAACCAAAAGATCTCAGTAGTATCA
AGACTCGATGAGCCTTTTTTGATGGAGAATTACATACCGTGTGAGCATTT
CCAATGTCAAAAACATATCATGTCTTGTCGACTTCCTTTTCATAACAAAA
CAACTCATATCCGTGAGTGGAGGTCTTCTAAATGTAGTGGATACGTTGTA
GACCTATTGTATGAGTTATCAGTAGAAATGCATACAGAATTCGAACTTTA
CGTCGCCTTTGATGGGGAGTTCGGAAGATGCGTCAATCGTTCCACCAATG
AATGGACAGGGATGATTGGAGATGTCCTGAGGCGAGAAGCTGATTTAGCT
ATCCAGGGAATCACCATAACAGAAGAACGATTAAAAGTTGTCGATTTCAC
TTTACCATATTTGCAGAGTCGGATCGAGATTCTAACATTAAAGGAAATGC
CAAAAGAACAGTTGTTCTCCATGTATTTTCTTGAGTTATATGACTTAGAG
GCAAGATATGTTTTGGTGCCATTGTTTTTACTATCCATCTTATCAGTATA
TGTATCTGAAAACATAATCATCTTCAAATCTAATATAACAAAACGAAAAC
AGAAGCGTAGAAACAAAATGGAGCTCAGAGATCTAGGTTTATATTTTGCA
GGATCGGTGTTCCAAAAAGGTGATTTAGGAGCAGCAAACCCGAAGACTTA
TAGTGGGCGTTTTGTAAGCTTGTCATGGTCATTTTGTTTCTTGGTGTTGA
CATCACTGTATACTGCTCTTTTAACAGCTGATCGTGTGGTGACTGGTGGA
TATAGCTCATTCCATGGCATGAAAGATCAGCGGATCTTAAACCCAACATC
AGCTTTCAAGTTTGGT
Run BLAST on NCBI

transcript from alignment at scaffold_89:160455..169414-

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00073264 ID=TCONS_00073264|Name=TCONS_00073264|organism=Clytia hemisphaerica|type=transcript|length=8960bp|location=Sequence derived from alignment at scaffold_89:160455..169414- (Clytia hemisphaerica)
TTGTAAACACGACTGATTGAACAGATATAAAATCACATTCGAGCAGGTAG AAACTCTACTATTATTCAAAGACTGGGAAATTGAAATCGTACAAAGAGAG ACGATGGAATGGGTCCTACTGAAAGTATGTCTTTTACTTGCAACCCGCAT GTGTCAAGAAACCTTAGCTGCCGTAATATCGCCGAATCATGATGGTAAAA AAATAGATTTAGAGAATAATGTTAGACAGAATTCAACAAAGGATCTTCGA AGTTCACTACCAAGGCAACTAAGAATAAACAAAAATCAGGCAATCATTGT GAAGGAACCACGAGATTTTAATATCATTTATGTTGAAAATCGAACCGCTA TCGTTGAAAGGTTCGAAAATGAAACAAAAACAATTGTTGATAGCAATGAA GTCAAAACAAGATTATCTTTGAAAGATAAGTTACAATCCTTGGTTAAGAG AAAAGGTATCACTATATCTTTACTAAATCAAGACCAAGAAAGCATGCTTA ACCTACGGACGAAAGATTGTATTTTACCAACCACGTTTGATGTTCTGATC GAAATTGTAACAAGATTTGAGCCAAAAGAACTAATTCTCATCTACCATTC GAAGATTTTAAGTCAGGTAGATATAATAGACTGGAAAGAAAAAACCTCAA AACACAAAGAATTTAAATTTATCGATTTTAAAATCAAAGAAGATGATCTT TATGACCATACAGGGAAGATTCTAAAAGAAATAAGTCGCTCCACGGATGT TAAGCTGATTATCTTATTCACACCTTTGGAAATCACGAATCTCATTTTCC GGTTACGCTCAGAAAAGTTCCGGATGATTACTGGAGGAACTTGGATTGTT GATAAGGGAATATATCCTGAAGCTGATCGGCCACCAAAAATGGCGGAATT TGAATATTTTAAATACCGTGTAGTGTTGAACTCAGCTTCCATGCGCTATG GAGGCTCAATTTGTGATTTGGCAACTAAAATGGCAAGGTAAGAGAGTTTG AAATAAAAATGGCCCCAACCAGCTTACTCTGTAATTTGTACCAGAGTGTA TCTCACGTTTATCGCTTCGTAGTACACTCTGTGCGCATTGTCTGTTTGAT AAAAAAATTCCCGTACGGAGACCCCTGCGATGAATTTTGATTTATAAATA ACAACACTTCTCTCCTCTCTCACCAACACTCCATCGCAGCGGTCGGTTTA AAAAATCTCAAATGAGAAAAAACAATGACAACAGACCCTCTACGGCCTCT ATGGGTTTATGTACAGACAACAACCGGCTCGTCCAATGTCTATCAAGCAA ATCGTCTAAATAGCATTCGAAATTTTCGAGAAAAGACAACAGATTAAGCT TATGTAGGAAATATCTTCACTGTCCCCAATTTATCTCAAACATCCTTTTG GAAAACCCGTAGTCGTGACCCACAAAATTGAGGACGATAAAAAAGTTGAT TTACCGTCGTCCTCAGTTGATCAGGATCTAGACAAATTAGAGATTTACCG TCTCCGTCGTGTTAATAGCGAGTTTATGTATTTGCACTTTTGAGGACGGT AAAGTCCTGAAGCGATTTGGAATAACCCGCAGTTCTGATCCGCAATATCG AGGACGGTAAAAGTGCTGATTTACCGTCGTCCTCAGCTGGTCAGGATCTA GTCAAATTAGAACCTTACCGTCTCCGTCGCAGAAAAACACACATACATAA ACTCGGTAATATCGTGTTTTTAGTAGGTTTTCTTTTTTGATTTTTACTCA AAATATTTTGTTTTAGGAAAGTAATCGAAGAAAAGCTATTGGCAGATGAA ATACGAATGATCAGGCTTTGGCAACTCCAGACTTGGCGAACTGTATACAA AGTCTCATATTTGAACCAGCAGTATCAACTTTCATCTCAAAGTATTTTCG GTAAAAACCAAAAGATCTCAGTAGTATCAAGACTCGATGAGCCTTTTTTG ATGGAGAATTACATACCGTGTGAGCATTTCCAATGTCAAAAACATATCAT GTCTTGTCGACTTCCTTTTCATAACAAAACAACTCATATCCGTGAGTGGA GGTCTTCTAAATGTAGTGGATACGTTGTAGACCTATTGTATGAGTTATCA GTAGAAATGCATACAGAATTCGAACTTTACGTCGCCTTTGATGGGGAGTT CGGAAGATGCGTCAATCGTTCCACCAATGAATGGACAGGGATGATTGGAG ATGTCCTGAGGCGAGAAGCTGATTTAGCTATCCAGGGAATCACCATAACA GAAGAACGATTAAAAGTTGTCGATTTCACTTTACCATATTTGCAGAGTCG GATCGAGATTCTAACATTAAAGGAAATGCCAAAAGAACAGTTGTTCTCCA TGTATTTTCTTGAGTTATATGACTTAGAGGCAAGATATGTTTTGGTGCCA TTGTTTTTACTATCCATCTTATCAGTATATGTATCTGAAAACATAATCAT CTTCAAATCTAATATAACAAAACGAAAACAGAAGCGTAGAAACAAAATGG AGCTCAGAGATCTAGGTTTATATTTTGCAGGATCGGTGTTCCAAAAAGGT GATTTAGGAGCAGCAAACCCGAAGACTTATAGTGGGCGTTTTGTAAGCTT GTCATGGTCATTTTGTTTCTTGGTGTTGACATCACTGTATACTGCTCTTT TAACAGCTGATCGTGTGGTGACTGGTGGATATAGCTCATTCCATGGCATG AAAGATCAGCGGGTAAGATTTATACTTTTGCTCTAAATGCCGGTCTCAAC TTTCGCGNGTTCCATGGCATGAAAGATCAACGGGTAAGATTTATACTTTT GCTCTAAAGGCCGGTCTCAACTTTCGCGCGACATGAGCGAAATTACGTTT TTGTAATGTCATTGGTCGGTTGAAAAATGAAGCAATTCCATTGGTCGAAA TTGACGTAACAAATGAAAAAAGTAAAACTTCCTTCAACTTTTTTTATTGA TGCGAAACTTTTTTATGACGTAATCTTTTCTTCAGGCAAAAAAAGGTTAA GAAAAAAACTGTCACCCATTTCGTGGGAAAGTGGAGACCGGCCTTGAGTA AAAAACTTTTAAGGTGTTGATTTTTACTTTTACTCTTAATGACGAAATCA ATGCTTTCCATTATGGGAAGGTAGAGAATACCTGGAACAAAAATCAGCTA GGTGCTTTGCTTAGGGCTCTGGACATTTTTCGATTTTACACCAACTTTAA ATGGCAACCTCTGCATTTTAAAAAGATTAATGTATAACTTTTTTTATACG TTCTGTTAAACCTACCTTTTTAGAATTTAAAAATCGAAAAATTGAAATAA AAAAATGAAATAAAGAAGAAAACGAAGAGTTTTTCGAAGAAGAGTGTTTC ACCTTTCAAAGCCCTAATCTCGGTAAAAACTAAACATTTTGGAATTTTTT TTGGTTCAGGTGATGTATCTATTTAGTATCTAAAAATGAAATTTCGGAAA ATTTTTGTGGAAGTATCTTCCCTTTAAAATCTCAAAAAACCTCATTTTTG GCAACTTTCTCCACAGCTATAACTTTGGATGTAGCCANAAAAAACCTCAT TTTTGGCAATTTTCTCCACTAAATTTCCATAAGAAAACAGCTATAACTTT GGATGTAGCCAAATAGAAAATTTTTCCGAAAAAATCATAATAAAGAAATT ATTTGTCATTAACTTAATAAAATGATTTCCCCAAGGAGATTAGGCTTTTT TTGTGAAAAGTATATGAATAGCGTGGTTTTGACGTTTTATCAAGGTCCAT GTCACACTTTTTTCTTAATTACTCATGATGTAATTACTTAAATTCATTTT TTCAAAAGCAGTTTGTTCTTAAACATGTCAAAGAAGCGAAAACATAAGGT TTTATCTTCAAATTCTAAAATAGCGCACCGCGCTGAATCTAAAAATATAT TGTGTTTTTGACATAATCATTACTCTCGATGTGTTTGTACGAGTTCCAAT CCCATCAACCTTTGTGTTCATCTTTTTTGTACGTTAATTGCATCATTTGA CAAAAGATGTATAACAACTTGCACCTATCTTTAATTGAGCCGCATTGAAT TGTGGGATTGCAACTTGTACAAATTTCAAAGAAAGTGAAAAGTAATAATT ATGACGTACGTGTTGCGGAGCGCTATTGATTTTTCACAAAATTGGGTATG TCCAGAGCTCTTAAGGGTGTGTGGCCTGAAGGGGAACGGTTTTTATTTTC TTGTTTTTAAGGCCCATACTCTAAGGCCCGGGGGGGGGGGGACTAGGGCA AAATGGGTTACGGGGGTGCTCCGCTGGTCAGGGTACCTTTTTAAACCTCC ACGAGTCCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCCGCTGGTCAGGGT ACCTTTTTTAACCTCCGCGAGTCCCAGGTAGGGTCGCAAAAACACCAAAA TAGAAAAATCAGGCCCTCGTAGGGTAACTATTTTTGGAAAATTTGGGAAA AAAGTAGAAAATTTGATAAAATTTTGGAATTTCAGTCCCATTCAGGGTCA CTTTTTTCGCAAATTTCGAGTCTCACGTAGGGTCCATTTTTCGAACCTCA GCGGAGCACCCCCGTCGGTCGACAAGGGTAGTACCCCCCCGGGCCAATGC CGATAAAAATTCGAAAGTTTTTTGTTGAAGACCCCTAAAGAAATTCTTTA TACTTAAAAAAAAAAGGTTTCTGAATATCTTTTTTCAAAGGTGAGATATT TATCTCCAAACTTACCACTCCATGCGCGACCTTTCGGCCTCTCACTTTAA AAAAAGTTCGATTAAGTTCGATTTCAGTAATTGAACTTACTGTAATCGAA TTTTGTATTTTGAGAAGTTTGTGAGTATTTGACTAAAGTTCAACAACCGA ACTTAGTCAAACATTAATCGGCCTACAAAATTTGATTCAGTTCGACAAAG TTCGATTAAAAATACGGTGTTGGATTGGTTCGATTGATTATGTCTGGAAG AATAGATTGCTTGAGGAATTTCAAAGATTGAGGTTTTTGGTTTGGTGGGA AAATGAAAAAAGGTAATATGAATCATAATATAAAAGGTTCCAATTTTAGG TACCGACCGACCAACCTACCCATTTTTCAAATCTTCTCTAGGACATATGA ACCAAACAATCAATTGGGCCTGGATGGCCCCTAGCTATCATCGATTATCG TTTTTAATTTATATTTAATAAATCGATTAATTATCGATTAGCTATCGATT TTAATCAATAATTGATTTTATCGATTAGTAACGTCTGGATAACATAAATT GAGGCCAATATGTGGGAGTAAGAAAAGGCCAATATATTTTTCTGATGTAG TGGCGTGGTGAATATAATATATTTTCAAGCAAATTTTGTCTAGACAGACA ATAAAAAATAATTCATTGAAAACAATTTACCTGATATTTGATTATGCCGT CTTCTAAAGCCCAATGGGTGAATGCATGGCCAAGTGGATGTGGTAGAAGA AGAAAAATAATAAACAAAATTTGGCACCGATCAAAAANTTTTTGATTTTT TAAAGTATTTGCACGTTTTTTATTCAGTTCTTTCTATAGATTGTAAAATT TGCAAGATTTGCCATAGCCTAGCCCTACAGCAAAAGGTTTCAGTCCTAAT GACTGCAGTTTTTGAGAAATTCCATGTTTTTCATTGTTTGATCTGTCAAA GTTGAACTTGAGGGAATCACCTTTTCAGTAATGACTCTAAAAAGACGATT GCNTTGCAAGATTTGCCATAGCCTAGCCCTACGGCAAAAAGACTGACTGC AGTTTTTGAGAAATTCCATGTTTTTCATTGTTTGATCTGTCAAAGTTGAA CTTGAGGGAATCACCTTTTCAGTAATGACTCTAAAAAGACGATTGCTTAA ATGCCATGACAGAAAATACAATGGAAAAGCTATTAAAATCGAATCCCTCA TGAGCAAATGCCAAATTACAAATGCCAGTTGGTCTAAACGCACCCACAGA TTGGAAATTTCGAAATAAGCTCATTAATATTGCCAATCCTCAAAGGATTG TCGGGGATTGTCATTTTCATTAATCTTTATATAAACGTTTCCATTGAACG ACCAAAACTTATNACTATTAAAATCGAATCCCTCATGAGCAAATGCCAAA TTACAAATGCCAGTTGGTCTAAACGCACCCGGAAATTTCGAAATAAGGTC ATTAATATTGCCAATCCTCAAAGGATAAAAAATCTTTATATAAACGTTTC CATTGAACGACCAAAACTTATGAATTTGATTATCCTTCAACAATGCTTCA CCGCGATCTGTAGCTGCAAGTATGAAAAATCGGGGAAATTTCAATATACT TAGGCTTAAAAAACAACTTTTGGTTGTCAAAAGTCCACAAGAATTTGATA GAAAGTTGAAAATAACGTATAAAGCCCATTAAAAGAATTTGTTCTCAAAT ATTTGTTTTCACCCTTCCAAACGAGAGAGCTTTCGTTTTCTCCAGATCCC TCAATCCCCTAAAATCCCCTCTCGGATCCCTCAAATCGGAATCCTTATAA TTCCTATATTGTAGTTGGTTTCTGTAAATAAAATTTTGGGCTAAACTAAA CTCGACATCCTATATGTAAAGAGAATACAACAAAAAGTTTTTATCGTGTA TTAAAAATTTTAAAGAAATCTTAAATATCTTGAACTTGTGAATCCGATAC AGATCGCTGTGCTTTTGATTTCCCCCATAGTAAACGATTNGTTCTGTAAA TAAAATTTTGGGCTAAACTAAACTCGACATCCTATATGTAAAGAGGATAC AACAAAAAGTTTTTATCGCGTATTAAAAATTTTAAAGAAATCTTAAATAT CTTGAACTTGTGAATCCGATACAGATCGCTATGCTTTTGATTTCCCCCAT AGTAAACGATTATAGTTACTCAAGTTGCTGTTTATGAAAATTTTGTCTGG TAAGATAGCTTTTTCCTGTATTGCTGTTTTATGAAATTCTTTACTGGAGC GTAAAAGAGCTCCACAGATTTTTCGATTTTTAAAACGAACAATAGTTCTC CTTGGGAAGGGATGGTACTAGGTTGGATTGTTTATCAGTGGACTAGGTCA AATTGTNAATTCTTTACTGGAGCGTAAAAGAGCTCCACAGATTTTTCGAT TTTTAAAACGAACAATAGTTCTCCTTGGGAAGGGATGGTACTAGGTTGGA TTGTTTATCAGTGGACTAGGTCAAATTGTTTAACAGTGGACCGGACATGG ATAGATTGGATTGTTTATCAGTGGACTAGGNATAAACACTTTCGCTTCCT GAAAACCTAAAAACAAAAATCAAAACATCCCAAATGAGTGACCTGAGTGA TTCTAGATTTTAGTAGTGTTCTAGCTACTAATATCAGAAATCTCATCTGG CCACTCCACATGCATCCTTTAGGTAAAATCTCGTAGCAGACTCGAATAAG AGTACACCCCCTTCTCACTGGGAACGCTTCTCACTAGGAAAATTGGTCAA AATGATCGTACCCGTTGGAAAATTATACTTTTGTCCCCGCTGAAAATAAT CAGATAAGCCAATCCTCAATGCAAATTATAATATCTTTTTTCCTTACTCA CTGAATTTTCTAGACCGAAAACAATGGAATTAAAATCCCCAGTTATAAGT AAACATGGGAATATCAATTCCCATCGAGTTTAGGTCCGCTATTTTACCCC TACTGGCTGATAATATCCCACCGGGTCTGAGAGAAGGGGGTGTAAAAGTG ACCCACTTCACTGAAGTCGTTTGTGAAAAATGTTAAATACAGTTATATAG GTGATATACAGGGTGTCCGGAAAAAAAGTATCGAGTTCGAACATGATTCT GAGTAGAAGGTTGTTGCGTGTGTTTAAAAAAATGTAAGAAATTATATACC AACACAATAATTGTTTTTACAACAGTCATTATGATTAAAAATAATTAACT TTCTTTACAATTTTCAATAGCCCTTTTTACTATTCCCCTACCGCTGCCTA GTTTTACTTTTTTATTGTTCCATACATTCCATTTTTATTATTTTCATAGT TTTACATACGATTCTTTACAAACATGTTTTAATTGTTGCGTTTTNGAGTA GAAGGTTGTTGCGTTGTTTAAAAAAATGTAAGAAATTATATACCAACACA ATAATTGTTTTTACAACAGTCATTATGATTAAAAATAATTAACTTTCTTT ACAATTTTCATGTAGTTAAAGTTATTGAGAATTGTTTTTTGTAAAAGTTA TTCATAAAAGATGTCTCATGACAATAAACATGACACAGAAAAACTTTGAT AAACAATTTAGTGAAACACACACGAAAACTTTCTTTCCATACACCATAGA CTTTTTTTCGGGACACCCTGTACGATAATACAATAACTGTTATGTGATAA TGTCCTTCAGCTTTCCTTATTACCATACCAATACAGGGTGTCCCTAATTA AAGTATCGAGTTTGAACATGCGATTGAGTAGAAAAGTTTGTGTGTGTTAT CGCTAAAATATAAGAACGTTCTCCATCACACAGGTTTATTACAAAAGGTA GTTACAACGTATAAATTAATCGTAATGACAAAGAAAAAAGAGGGAGAGCT TAAAATACAATTTTGTGAACACACGCACATAAAACTTTATACTCATAGTT GTGTTTCGACTCGATACTTTAATTAGGGACACCCTGTATTACCAATAATC TAAGTAAAGCATCTTTGTAATTCGCAGAAAATTAGCAAGACTCAGCAACT TTGGTTTTCATAAAATTGGGGAAGCCGAAAACGACCAAACCAACAATTTA AGAAAATGAGGATGAAATCTTGGGGGTACTGTGAGGGACGAATCTAGCAT GGGACAATCAAAAGCACATCATTGTCTCAACCACCCGAAAACAGAGTAAA ACACCCCATTTTCCTTCTTGTTTCCAGATCTTAAACCCAACATCAGCTTT CAAGTTTGGT
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_045451XLOC_045451Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073264-exon-scaffold_89-1575043694:168428..169414TCONS_00073264-exon-scaffold_89-1575043694:168428..169414Clytia hemisphaericaexon
TCONS_00073264-exon-scaffold_89-1575043694:166703..167648TCONS_00073264-exon-scaffold_89-1575043694:166703..167648Clytia hemisphaericaexon
TCONS_00073264-exon-scaffold_89-1575043694:160455..160487TCONS_00073264-exon-scaffold_89-1575043694:160455..160487Clytia hemisphaericaexon
TCONS_00073264-exon-scaffold_89-1510915933:168428..169414TCONS_00073264-exon-scaffold_89-1510915933:168428..169414Clytia hemisphaericaexon
TCONS_00073264-exon-scaffold_89-1510915933:166703..167648TCONS_00073264-exon-scaffold_89-1510915933:166703..167648Clytia hemisphaericaexon
TCONS_00073264-exon-scaffold_89-1510915933:160455..160487TCONS_00073264-exon-scaffold_89-1510915933:160455..160487Clytia hemisphaericaexon
TCONS_00073264-exon-scaffold_89-1491911889:168428..169414TCONS_00073264-exon-scaffold_89-1491911889:168428..169414Clytia hemisphaericaexon
TCONS_00073264-exon-scaffold_89-1491911889:166703..167648TCONS_00073264-exon-scaffold_89-1491911889:166703..167648Clytia hemisphaericaexon
TCONS_00073264-exon-scaffold_89-1491911889:160455..160487TCONS_00073264-exon-scaffold_89-1491911889:160455..160487Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_89supercontigscaffold_89:160455..169414 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0 0 0 0 0 0.0215178 0.669593 0.432194 0.565116 0.142861 0.472855 0.0345296 0.451143 0.397333 0.0897441 0 0.333481 0.244504 1.25495 0.54524 0.899324 0.936525 0.069456 0 0.195115 0.316877 0 0 0 0
Blast
BLAST of TCONS_00073264 vs. Swiss-Prot (Human)
Match: NMDZ1 (Glutamate receptor ionotropic, NMDA 1 OS=Homo sapiens GN=GRIN1 PE=1 SV=1)

HSP 1 Score: 106.301 bits (264), Expect = 1.273e-23
Identity = 69/256 (26.95%), Postives = 121/256 (47.27%), Query Frame = 2
Query: 1226 CRLPFHNKTTHIREWRSSKCSGYVVDLLYELSVEMHTEFELYVAFDGEFG---RCVNRSTNEWTGMIGDVLRREADLAIQGITITEERLKVVDFTLPYLQSRIEILTLKEMPKE------QLFSMYFLELYDLEARYVLVPLFLLSILSVYVSENIIIFKSNITKRKQKRRNKMELRDLGLYFAGSVFQKGDLGAANPKTYSGRFVSLSWSFCFLVLTSLYTALLTADRVVTGGYSSFHGMKDQRILNPTSAFKFG 1966
            C  P        R      C G+ +DLL +L+  M+  +E+++  DG+FG   R  N +  EW GM+G++L  +AD+ +  +TI  ER + ++F+ P+    + IL  KE+P+       Q F      L  L    V V L+LL   S +       FK N    +++  + + L    ++F+  V     +G   P+++S R + + W+   +++ + YTA L A  V+        G+ D R+ NP+  F + 
Sbjct:  436 CTGPNDTSPGSPRHTVPQCCYGFCIDLLIKLARTMNFTYEVHLVADGKFGTQERVNNSNKKEWNGMMGELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGLTILVKKEIPRSTLDSFMQPFQSTLWLLVGLSVHVVAVMLYLLDRFSPFGR-----FKVN---SEEEEEDALTLSS-AMWFSWGVLLNSGIGEGAPRSFSARILGMVWAGFAMIIVASYTANLAAFLVLDRPEERITGINDPRLRNPSDKFIYA 682          
The following BLAST results are available for this feature:
BLAST of TCONS_00073264 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
NMDZ11.273e-2326.95Glutamate receptor ionotropic, NMDA 1 OS=Homo sapi... [more]
back to top