Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00073257 (transcript) - C. hemisphaerica

Overview
NameTCONS_00073257
Unique NameTCONS_00073257
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1366

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00073257 ID=TCONS_00073257|Name=TCONS_00073257|organism=Clytia hemisphaerica|type=transcript|length=1366bp
ATTTTGTTGTGGTAACAAGTTTATTCAGTTTTTATTTTCCAGtTTCTTTA
TTTGGAGAAGAACTATTTGGATGGATTGAGTGAAGATTTCTTCCCTGCTC
TACCATTGTTGAAATGGCTTGATGTCCGCCACAATCATCTCCGAAGTCTG
CCAAACAACATCCACATTGCAAAGAACTTGAGAAACCTGCTGTTGGAAGG
GAACCAGTTATCTCATCTTCCATTTGAATTAGGTTTGTTGACATCGCTAT
CCGGTTTGAATTTGATCGGTAATCCATTGGTTGTTCCGCCCCAAGAAGTG
GTCGCTTGTGGTGCAAAGGTAATTTTGAAGTATTTAAGAGAGCAGCTGGC
GATTGAacaaaagtttggaaaaatgGATCTTGGAGATGTTGTTGGAGACA
GCAGGCATCGTCACAAAACTTCTGAAGATTTCTCTGACGAAGAAAGCACT
ATTCCTTTTGAAGCAGGTACAAATAGTAAAAAAGGACGCAAAAAATATCA
GAGTACAAAATACCGTCGTCACTCCCTGGAAGAAGAGAAAATGACAAACT
CTCCTCCCTACTCCATCAATCCTTTAAACATCAAGGAAAAACGTTTGAAA
CAAGTCATATCACCACGCTGGAGGAGGGAGAGTCCTTCCAGCGCTCCTCC
GAGTTCTTCACGTGGACAAAAACAAGATCGAGATGGTGTGAAAAGTGATT
ATCTTCGGAAAGGTGCTATCGAAACAACATATTTACACGACGTCgaaaaa
gctgaaaagaaaGCGTTCAATGAGAAAGTCGATCAAATACTCCAAAAGAG
AAAAGATAAAACGAGCTTGGATGATTGGAGAAAGAAAACACGAAGATTGC
AAAACCACTCACGAATGTCCAAATCATCCAAGAAGAAGCGAGAGTTGAAT
ATACCCTATGGTAACGATGATCAACAAGAACAACAGGAAATAAGCAGGCA
TGCTGAAGATGTGAAGAGAGTATTAAGTCAAGATAAAATATCACGTTTGA
AGGAACTGCGTGACCAACAACTTGAGGAGAGGATACAAGAACACGCAAAA
CATATCCGTGAGTGGAGACAGAAGAATCGACTGGATAAGATGGAAACTGA
TTTAGAAGTGGCAaaacaaaatcttgaaaagGCGCTGAATCTACAACGTG
ACTTAGAAGAGAAACGTGCTTTGCAGTACCGCTTGCGTGCATTCACTGCC
GAAGAATTCTCACCGCCGAATCACGGAAAACCAAAATAATATCAATTGat
tattaaattttaaaatgttcctattttttgaaaattatttttataattaa
tGTAAATAGAATATAGAGTTTTATCTTTACAAGAATAACATCAGTTTTAT
TTATCTTATTGAACAT
Run BLAST on NCBI

protein sequence of TCONS_00073257-protein

>TCONS_00073257-protein ID=TCONS_00073257-protein|Name=TCONS_00073257-protein|organism=Clytia hemisphaerica|type=polypeptide|length=288bp
MDLGDVVGDSRHRHKTSEDFSDEESTIPFEAGTNSKKGRKKYQSTKYRRH
SLEEEKMTNSPPYSINPLNIKEKRLKQVISPRWRRESPSSAPPSSSRGQK
QDRDGVKSDYLRKGAIETTYLHDVEKAEKKAFNEKVDQILQKRKDKTSLD
DWRKKTRRLQNHSRMSKSSKKKRELNIPYGNDDQQEQQEISRHAEDVKRV
LSQDKISRLKELRDQQLEERIQEHAKHIREWRQKNRLDKMETDLEVAKQN
LEKALNLQRDLEEKRALQYRLRAFTAEEFSPPNHGKPK
Run BLAST on NCBI

transcript from alignment at scaffold_89:322898..353636+

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00073257 ID=TCONS_00073257|Name=TCONS_00073257|organism=Clytia hemisphaerica|type=transcript|length=30739bp|location=Sequence derived from alignment at scaffold_89:322898..353636+ (Clytia hemisphaerica)
ATTTTGTTGTGGTAACAAGTTTATTCAGTTTTTATTTTCCAGGTatcgtt ttcaatttttttacattaCGTAATACTTACAATTGCTAAAAGGAGAGAAA ACAATTGAATATTTCCCTTCGATCGAGGTTTCGGcttagatttataaagc ccgaagggctagatgtagtgctttggctgaaaaatgtACCGGCCGAGGCT AGGtaagaaatcctacctaggtcacgtgacattacaatagaatttcagca cttGACCAATAAGAATAAGTTTCGCGGCTttgcaggttttcgaaaacaaa aacagcaatattttttgcgatatttactttttttgcttgtaagagcttaa agcacgacatccagctcttcgggctttacaaaAATCTGTGGTTTTGGCTT CATCTACATAACAGCGAGCGCAATACCTTTATACTTACGTCTCTCGAtcg aagaaagatttttttctgaagATTACACGAGGGCATTGACCCATGAGAGC GTGTACTATGTTGTTGCTTTTTACATATATCTTTACTTTAATTTCAAACT CCGTGGCCTTCCTGGCCTACCACTACCAGTTCTATTAAGCCTTTGAAATC GAATATAGatgatgttatcgtccgttacagtgatatgATAGTAAAgacgg gaaaatatggcggtatggcgttatggcagTATACAGGAAAacaatcggcg ggagagttttgAAGAATTCGTTGACCAAaacaaatttggtcaatttattC CAAATTTGTTCcggaattaaatttttgcagttttgcccttttttaggaca aatttctttcattttcctaggaatttttcaataaaattggaatttttcTT TTGCGTTTTTGCGCTTTATTCCGCAAAAGTTCCGATAAGGTTTCGTTTCC TTTTGAATTACATTATTAGTCTTTTTGATATGTATTTTGGCGGTACCTAG TATTGTATTTTGAAGATTATTACCCCCTCCCTGATATTCTCATATGTGTC AAATCCCACCCGGAACTCAACTTTGGTAAATTTCAAAANNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNgttggaagc attacgtaatggattttttccaaatctctttgtaaatcgagctccggcgt caAAAACAGTAGAGTATTTTTATACGAGgatgaagacgtcatttctttgA GAAACGTCGcgggaaaatcgggaaaatataagtatccttctcgatcggga aacgtcgctcggttcggaagcgtattgttgatcggaccatactgcctttt aacagtcaaaacaaagatggcagcaaaaataaacaactggttgctaccgc tctttggctatttttctttggtttttatgctttaaagAGTTGAactggat catgatttttgtgtgattgttacaagaaatggttgatgatgaagttttct tattattattccttcctgaatttgatgtttcgtttggtttggcatNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN AAACAGGATATTTTATCCGgtcgatattttatcaactttcacaacaaact aacttcaattttgcctgtatatttacacaaattctaactaggcagttgac tgaataattgtggataaatctgaccatgctttatttgaaaaattttgcga catcaaaaaagtttgaactcacttttttataatgATGGTCAGATACAGAT GGTAGATGTGGcacccaaggaaatggttgtggttggatatgaactggtta gctttaatgtaaaaatttaaacccagagaaaaatttactgattgatgatt gatgttttaaaaatgcaacgtggaaaacttttggttgtgtgaatttggac attttcttgcacgtgcgttttaaaacttggaaattcttgctgtgaatttg gacattttctctacgtgcgttttaaacgtggaaaacttttggttatgaat tgggacattttcttccatgtgcgtttaaaacgtggaaaacttttggttgt gagtttggagaatttcttgcacgtgcgttttttaaaacgtggaaacttgc tgtgaatttggacattttcttccaagtGCATTTTAAATGTGGAAAACCTA ATTGGTTGTGAATTCGGACATATTTTCCTCCACGTGcgattaaaacgtgg aaaacttttggttgtgaatttggatattttctttcacgtgcttttaaaac gtggaaatttttactgtaaatttggacattttcttccccgtgcgtttaaa atgtggaaaatgtttgtcactaacttgacattttcttccacatgcataaa ttaaaaaatgtatatagaaaagttttgctgtcaggcaaaaataaaaaaaa atgtagtgtttccggaatgcaggtcaaggaaaaaagctttgatgtgccgg ccagaaaaaaattttttatttgatttttttgatgacttaagtaatatata taagatcattgaaatagaactttaacaatatcttttatgtacaaacagta tgaagtaagccctgaacaAATAATTCTTGATCTACAAGTGGGAATATTGA ACCAAGctacttttatagcttaaatgctccaacttgattttttttataat gaactaaatagatgaacccatagtctgcggccagatcagaaaattattat ttttcacccggttggtttccagaaaggctacattttttttattttcgcct caattgaaaattttttcaagcaatatcctggtatgaagactttttttctt tttggaaatttttgaaattatgattgccaattatgtgacattttatgctt ttgcagcatgctttcGAAAATTACATAATGCCTTCTGTTAGGGGATTTTT TTCCTTTCGActttctttcagattatgaaaatatttcccAGTATATACag tatgagatttttttttcttcttttgcattacactttttttatataagaac cagtaaaatttttctgagcctcgactgttcttttttttttttgcactttg agcttctatcatgttcttattaataggatgtaagtcaggtattttaggca ttataccccgtttttattactttgacccctaaattgattgaaattgagta gtttcaggctcagcattgttcttaaaatgttcttattttttggcgatttt gagcctcgttgttctNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNataaaattgttcttatattaaaaaaagtgtatg tttgattatgaaattgtttccctgttttgaaagtttttgacatgcatttc aaaaaatataacttttagatgctataattttttacctttttttcaatata tatattttaccttttctccaatattttatatattaaaccttttttccaat attttatatgcaaaatatttcatctattttgaaaatataaattttccttt ggttttctcattgtaaaatattctcaatttttgatgaacaagatcaattt ttaccccctgatttaacaaaacgagaaaagagaaaaagacggAACAAAAT TCCATTACTTTGCGCAAAGTATCATAAGacattttttataccaaaaaatc cttattatgttcttattttaggtcgaaattttaagatatttgagttaaaa aaaaatcaaaaaagcagtttgttttgaaaatagaatatcaactttctttt ggctcaccagagtttgtacatgtttgaaatgcattgatagaaattttcct tgctcttgtgacgatcatgaaaattacatGGTTTGTTCACCAgtatcgcg aaaatagcccaaatcatgcctcaAATTATTTCtcgatcacgcatcacgca aacggctgggtataagtttttaaaattgtatcataaaatagctaactttc tcattcccNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNctgacaccggacttattgcgtccggtgtagcgaaagg atactttttgccaccggacaaatacaccggacagtccggtgcgtcggcag ggtcctctcTACAGGGTACCGTAATTTGGTCtaatccagacccgatcaat cgaacttgtcgaaccaatcgaacaatcgaactccatcaagcgattaaagt tcgattaaaaaaattaatcgaacctaatcgaacactcacaatctttgaAG CAattagcagttcgattagttcggtcggtaaaaagttcgattagttcgat gatattaaatcttcatatatcttccctcgcttgcaaaaactttgtcctgg cacgcgattgccatttcgacagttcccggacttaacagcttgatgtttat tgtacccggatatttgtctatccgcaataaagtccgtagccccctctgtt gcgatttcgcgcgcggccgactggcggaatactacgccccaacaaacccC GCCTCTGGCGCTataaggatacaggaaaagtgtgtaatccgttatcggaa gtaatttcccgatttacattccgaatttggctttgaaaagaagcacggtg gcggagcagcacaaacttgtcgaacaaaattggtttatcgaaccgaaacc cattgatcgaacttaatcgaacactcacaatcttttaagaaatcttagag ttcgattaatttttttaatcgaactttaatcgttcgatggagttctgGAG TTCGAGTagtttgattgttcgattggttcgacaagttcgattgatcgggt ctggtctaatgtcgacatccctcctctaattctgacacccttttaatcag ctgaaattgatggaaaggttgaaactatttttcttggcttagtggtcaca gaggaataatcctttttcaaccagtgattcaagctttcatattattcctt tctctaaagaaggatgtcggaattagacgagggatgtcggaattagacca acttacggtatggcCCAAACTTCTTCAGCCGCTTCAGGTCAGGCCACTTG GCAatttttaacttgaaaaagtCCTGAACATGACCAGAATTGGCCCATAC TATACATCTTCAGGGTACGTGCTTGGGTCAGGTGGTTTTTGGAGGGTAGT ACCCTAggtgaaaatccaaaattttgtgGCTTGAACTTCATTATAAAATG TTCAGGAGGCAAAAAGAATGTTTTGCTATTTTGGCCTGAACATGACCCAA AAATTATCAGTTTGTTCTGTCAGTCTGTTACTATCAGGTGGTTCTGGCAT AAGATAATGTTATGTTTTTGGAGTCATTACACGCTTTTGTCACTAGCTAA TTAATTTAATGGAAAGTCTTGCACCACATATCCTTGCAATTGCATGGTGT TTGTATTTGCAGCGGGTTAATTCCATACCCAGTAAACAGTAAATGAGATG AGATGTATTGGGCAAAACTTGCTAATTTGACcttaaaatcaaaatggcaA TCGGAAATATATACAGCCGAAATATCTAGCTGAGAAATCATCAACCAGAC CTAAAAATTATTTACCTGATGTCCTGGTAAGATTAAGATTTTATTTGGCC AAATTTTTGTGAGTACTGTAAACATGATCTTATTATGTATAATACCAAAA GAAGCCCCTTCAAAGGTAGATTGAGAAAAAGGCCAGTAACCATAGATGGA AATTATTTTTAAGTGGATGCATACAATTTCTCAAATAAAATCTATTCTGA AAAAGGTTAATTGTGATGCAATCAAAATTATAAGTAAATTTTCAAATGTC AGtgacctttttttcttcatctaCGTCAAAAATTGCATCGATTGGTGTAT AATATGTTGATATTATAtatgtttcttttataaaattttttgtttggCTT GTGATGTCATCAAAACACAAATGTTCCCGGACACACCCGGTAAATAATTT CTAAGTGTACCCGGTTGATGATTTCCTGACCCCAACTGCCTGACTAAAAT TGATATCTTCATTTCTTCTGTAAAATAATCTTCAAAATACAGTTAATCTC ACTAGGTACCGCCAAAATACATATCAAAAACTAATAAGACTAATTCAAAA GGGAAACCTTATCGGAACTTTTGCGGAATAAAGCGCAAAAACGCAAAAga aaattccaattttattgaaaaattcctaagaaaatgaaagaaatttgtcc aaaaaaagctgtaaaaatttaaatccgCAACAtgcaatttttccaatttt tttcttcgaCCTTAAATATTAGTTCCTGCGGAAATATTTGACTGAAAGAT GTAAGAAAAAAAAGACTACTCGTCAGAAAAAAAGCAGCTATCCAGTTTTC TGGAAATATAATTTTATCCATTAACCTGATGCAACTACAAATGGCATTAG TAAGTTTTTGTTTTCTACCCATTGTATTTGCCATAGATTGCAGCCACAAA TGACCCCATGCAATTGCAAATATATCCTCGACCGAGCAGGTCAAAATGGT ACCCTGTAGCAATAGGTCTAGTATAAAGCTTTGTCTAACATTTCTTGAAT TTTACAAAagatataatatttttcaaggaaTTATAGCTTGAGAATAGACA TGCTCCACCGCTGTGTCTAAAATTGTAGGAGAGGTAAACAAACGCATTAT TGCCTGCAAGGGCTAAACCTTCAGAGAAAAAATACAGGAGATGGATAATT TTTGACTTTGGCCTTGTATTGACTGGAAGCAGTATTTGCGTATCCAACCT TTTTTCTAGGAATCTTGAGATAACTCCTCCTTTCCTTACCCTGCAGAATG AGGGGTACACAATCTGTGAGAAAATTATGTAGCAAGATTGACTTTAATTT ATATTTCTATGCAATATTATTTTCCAAATTGCAactcttttttttgcttt aaatcaTGCAATTAATTGAAAGTTTCCAAATTGGATGATATTTTGGTAAT TATTCCATGTTAACACTCCACCACCAGCTAATGTAGGAAGCGTTGCGTTG AAAGTACCCACCTTTGTATGATCATAATAtacctaaaaataaaatattat ttatttatttgtagcttttttaatcaatttagAATCACTTCAACTGGGGG GAGCATGTCTCAATGCAGCAGTTTCTCATCTTAATGCCCAACCATTCCTA CAGTATATACAAAATAAATCCCAAATACCCCCCCCCCCNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NccccccccccccgtcagcccCTAAATTATGTACTAACCAGTATGATGGG AAGtgcaaaaattttgcaaaagatccaaaaaaaagataaaagacaAAAGA TATAAAATTTCCTTTTATAACCTGAAAAATAGTTCAACTTTTCTTTCAGA GATGGTAACCATCTTGGGATGTCAATAAGTCAgaagagaaaatttaaaat caaaacaatcgcAGTGAAGTAAATTTGTGTCATGGTAAAACTCTCATAAG GAGAAGTGAATGTTTTGATATAAATATCcaggggtactacccttgcagAC TGACAGGGGTACAACGGAGGTTCAAATAATGGAACCTATGTgggccaaaa tttgcgaaagtgaccctgaataggactggaaattcaaaatgttttcaaag ttttccacTCTTTTCCCAAATGCCCCCAGAAAGGTATCCTAAGGGgcact gactttttttttttttttttggaaaccTACCTCTGGGACTTATGGAGGTG AAAAAGGTGCCCTATACCCTTTTTGCTCAAGTATTTTCAGAGAAATAAAC ATTTTCAGATTAAAGCACTCACCGTCACTGTTTTGTTCTCCAAAACGTCA ATTTGTAACGAATGAGAAATCGAACCAGATCGGTTTCCCAACAAGCTAAG ATTTTTGCCAAactttttgataccatttttcACATAGCCTGTTTGGACAG TCGGTGAATGCAATCTTAAAAAGGCgataagaaaaaatataattattttt aaaaacaaagtgcacaatcgatttggaagcgctctaagttaggtttgaag ggtagagttttaactctgagttttaacacgcgacttaagacttacgtgct taggatctgaggatccaaaagttcaagaacggtccaatagggctcagaat atggcctagaagtctataaaccctacccaaaatgaaatatttgattaaat ctaacaaatagcccaaaagccaatttcttgcccgaactttaaaatgctaa aaacgaCGAATTAACCAaatttctcaatatattttgaccgatatTGTAAA TCTGTCTTAAAATTCATTTATCCCAGGTCAAGCACTATCACTtgcaatat ttcaatttggtaTTCTCTTCAGAACAGGCTTAAAATCGGTATATCTGGTA TTACTGAATTTCCAGGCTAAATTTGTAAATTCGTTTCGAAAAATTCTGCC CAAAATTTAGCCGGTTCTTCTTTTGTCAATATaaacatattatttaaaaa ttaccTTGCGTAGACAAAGTCGTAGTTGTTTAAATCTCTCATATTGAAGA TCAATCCAATATGCCCTGAATCAATACCCCTCCatgcttgaatattttta aatctCATTCTCATTATGTATAACTTGGCCGGTTTTTCAATCTGGTTTTT GGGCACAGCAAAACATGGTGCTCCTTTTGATGTTGAAGATGCGTCCAATG TTAAAACGGATCCTAGATCTGTGTATCCAGCACAATTGTAAATCTCCCAT GCTACATCTGCAAATATAATAAAAGAAAAGGTATTTTAAATAAAcgatac cttattacacgaaaattACCAGTCATTTTATTGacacaaattgaaaaatt tcgtgttaataaaaaccccctgccttaattaaaaccaggcggctgttttc ttgaaaaagctgaaaaattcgtgttaatttcagatcgtgcaaatttcaag gccgttaaatacttgcctagtaatatttgtgtaataaggtagttaCAGCT TTTTAGATTAGGGCTAAAACTGCcaaaattaactttctttaaaagGATTG TATAAAGTTGTATTactttatgaattttctctACGAAGAGTATCGAGCAC TCTTTTAATGGTTGTTTAACAAaattaactttcttttaaaTGATTGTATA AAGTTGTATTACTTTATGAATTTGCTCTACGAAGAGTATCGAGCACTCTT TTAATGGTTGTTTAACAAAATtgactttatttaaaaaatgattgTATAAA GTTGTATTACTTTATGAATTTGCTCTACAAAGAGTATCGAGCACTCTTTT AACGGTTGTTCAACAAAATTGACTTTCTTTAAAAGGATTGTATAAAGTTG TATTACTTTATGAATTTGCTCTACAAAGAGTATCGAGCACTCTTTTAATG GTTGTTCAACAAAATTGACTTTATTTAAAAGGATTGTATAAAGTTGTATT ACTTTATGAATTTGCTCTAGAAAGAGTATCGAGCACTCTTTTAATGGTTG TTCAAcaaaattaactttctttaaagaattataacattttatctaaaaag attacaaaaaataaaaataaaagataaatcTGCGAGGTTTAATAGTCTGA AAAGTTGCATACGTTGTAATTATTTGAACCTTTATTTAAATAAAGAAGCT AATCTATTTccctttttccttatttttttatgatttttaaaaaattcaga cgatgaaaataacttttcatTGTAGCATAGCAAGGTGACGACAAGATGTT TCAAAAGTTAAGTGCCCACATAATTTTGAGAGAGACTCTTAACATTAATA ATTTTTCTCTCCATTTTCCCCTAAATTCTAAGCCTAAGTTAGTGATGCTT ACTGTCAATGAAAACCGCTGTTTTAAGTGTTACCTATTACAGCCTATTAA ACAAATAAATGTTTTGTTCGAGTTACTGGCTAGATGGGAtggtccagacg gtgtcaatcgaacgaatcgaataccgaatcaattgaacataatcgaataa ttgcgattcgattgttgAACTCAATTGAATCGTAATCGAATATTATCCAG AATTTGCCGTtcaattgcttcgattacgttcggttgattcaattgtattc gcTCTTTTCCGATCTCTTCAgcccacgctgaagctctaaaggagtgggtc aatttaattgcaatcaaacttattgaactaaattttgaatgtacttgaca atcaatcgaacgttattcgaacacaatcgaattttacacaggaatcggcc gtttgattgagattcgattgcattcgacaatcgaatctcaattatTTGAT CGTATtcgataacttttgattggtTCAATCGCGATTTTCGTTCGAgcttg ttcgattgacaccgtcttgGATGATGTGATTTACAATGTTTTTTGGCGTG TGGTTGCGTGATTCGTGATTTGATAAAAAGTGAAAGCTTTCTTATATTTT GATAACCTTCcttgtttttcaaagaaaatcactaaaatttcaGTTTCTTC GATGTATGGGAAttattttcgaaagaaatcatAAATAGAGCAATTTCTTG AATGACTTTTATGGCTTTTTATTTCACCGTCTGAATTCTATTAAACAGTT TTTGTTATTGGGCAGCTCTTTGGACTTTTGTCAGGAGGTTATATAAAAAT GACAACACACCATTATCTTACCTCTATTGCACGAAGGCTCTAAAAAGCAT TGGATGAATGAAACTAAGCCAAAAATTACTATCAACTTCATATTGACAAC CATTTTCTCTTTCtgaattttttgcaattttcttcCCCATTTATACCCAA TTCATTAGACACAAAATAACGTCTATTTATTCAATAACTTAAACATTTTT GCAGCTATTTCTATATGATTGCAATTTTCCAGATGATGAATTTTGACATA GTATAGTAAATATGGACATTGAACTAATATTTAAAAGTCgttatattttg tttattttaaattttacacATTTTGTCTGGGAAACTAACCTGGAGATTac tttaaaagcttttttatagacagTATGGCGCGCTTAATAAGTCTAAAATT TTGTGGGCAATCCCTTAAATTTGAATTCGAAACCTAGGGAGAAATCTTTA ACCTTCTCTTGGGAAGCACTAGTGATGCCTTAAAATTTGCGCCGCATTTA GGATGGCGGATTAAATGTagcactttcttttttttccgcgttttacaatt ttacagaatatggcggtaaattttAACTTCCAATCTAGAGCTTGTACGAA AACTACACAGGCCGGGCAAGTTGTGTAGGAAATAAGTAGTTTTTGCGGTG TACCTTATCGGTGCAATCTAAACTCTAGTCGACTGGAAGCAGAAAAGGTC TTTCTTGCCACGACTGATAACCAACTAAAGTATTATTTCTTattgatctt tttttcttttctcagtTTCTTTATTTGGAGAAGAACTATTTGGATGGATT GAGTGAAGATTTCTTCCCTGCTCTACCATTGTTGAAATGGCTTGATGTCC GCCACAATCATCTCCGAAGTCTGCCAAACAACATCCACATTGCAAAGTAA ATATATGACTTTTGTTTTGTCCTGACTATCTAAGGTTAAAGTAATTAGAA CTGACTGGGAGAGGCTTAAAAGTTTTGATATAGATTgaattatatttata ttttatccTCCTGAGTCGTTTGTGTATAAGTACTAAGCACCACCAGAGAG CACGAGTTGGGTAGAGGCAAGTGCAGTGATTTTCATATCTAAGATATTGA ATGCTGTCGACTGGATTGGGTTTGTTCCGTTTTTTGGAAGGATTATCTTT CTCGTAGGCTTCTGCTcctcctctagcgaaaaaagtttctatataggaag tatatctcaGTGCCGCAGGAAGCATTTTGATATGACACCGTGAGGGCCAA CCACCGCACGGTTTGGGCcgtgggggggggggaattttgaaatctacagc tctaaattggctaaaaccaaaataattcgaataacaactaaaataattcg aataaaaactaaaataattcgaataaaaactaaaataattcgaataaaaa ctaaaataattcgaataaaaactaaaataattcgaataaaggcaaacttt aaaggtaaaatactccattttatgaagaaaaatcaCTCTTAGAAAAATCC CCTAGCCCCCCTGGTAGCTACGGCACTGtctatagaggtctgcaattcag acATCTGTCTCTCGTGTCTTTATCGAGAAGAATAAGTCAATTCATCATCT CTCATAATTTCATTTTAGGAACTTGAGAAACCTGCTGTTGGAAGGGAACC AGTTATCTCATCTTCCATTTGAATTAGGTAAGTTTCTTTTCTACTGTGTC TTTACCTCATTTATGTCAAAAAAAGTACGTTCGCATTTGGGAAAGGGGAG TGAGATAAAAATGTATACacgttttgagatttttcaatacAAGGAAATTT TGGCCATACTTTAATCATGCTTTCTGATTATTTTATCAACAAAGACAAAG TGCTAAACTTTGTTTCAATTTCTCTAAATGCTTTAATTTCCTGTTTATAG ACATTTATACCTATAGGGGATCTCGAAAGCTTGCGTACGCGGGAGACACC AAAGCGATTGAGCCTTGAATATTTCATTGTGTGACTTTACCGTAAACTTG ACTTGACTGAGTTGCCTGAATTTCtccttatttttggacctacctcggag gtcctttaatttaacctttgttcgttcgttcgttcgttcgttcgttcgtt cgttcgttcgttcgttcgttcgttcgttcgttcgttcgttcgtctgtctG TCCGTCcatccgttcgtccgtccgttcgtctgttcaaacttttctcggga ttggcccaTTATGTTTTTGCttagtgatgcaaaatgataaaaatatggtt tttcggactttttgtgaaattgttttgttcTGATTTTTCGCATAAAGAta aagggcaaggttctctaaaaagtggatGAAGCTGTTTTTTCCGGAAAATA TTCTTTGGCCGTAAAAATTGgatggggaaattcccttttgtcatttttag agaCTTAAAATACTTGATTTTTTGCAgactgatgtaaaatggtattgttt aaaatctgatggagcccgattttcgaaattaaaaatttttgggccaaatt tgggccaaattttgGATTTGTGGAAGTTGTTTCATTTATCTTTATAAAAG AGTTATCTTTACATGAAAGAAAGAATTGTTTTTCGTTTGTGTCCAAAACA TAGCATGACtccttaaaaaaaattaaaaagccaGTGTGAAGCAAGCTTCA TCGTGTATTTCAAGCTTACGTATCTCTATGTTCTGctgttatcttttctt tttcgttcgaaCATTTTCATCAATTCATTCAGCATGTTTCCGACTATCTa tctcaggtaggtccattcggCATGTTGCTTGTCCATTTTTAGATTTGGAA AGATTTGTTGATTACTTATTATGAAATATCCTTATGAAACAAAACGTTtc attatcaaattttttcagcTCGGCGCTTTTACTCTCTACTTTATTTTGAG GTTTGTTGACATCGCTATCCGGTTTGAATTTGATCGGTAATCCATTGGTT GTTCCGCCCCAAGAAGTGGTCGCTTGTGGTGCAAAGGTATAAAGTTTGCT GgatatttttttaacttctGTTTCCTTCGTGGAATCATTTCCGTGCACCA CTTTATAACACGTGAAACTTTTGACCAGCGGACAGTACTagaggccccca gcggaccttcaattcacacaatcacgcaaatttcaccgtgaactttttta cgcgcaaagcattgtgggcaatatttgggggtcaaatctgagttttcacg ttaagctgatatcgtctattcacgcaatttttgttcacgcaatgcttttc aattcacgcatttacgcaatttttttccaattttcgcgCATTCACGcgag tgaaaaagcccattcacgcattcaagcAAACCGCTGGGGACCCGTACTAA CATACCGGAATTTAATACAAGGGTGGCTTTGATTTTGCTTTGTGCTCTGG TTTCGTGTAATAACTAGTAATAACTGGTTATACGCATTATTCGCGTATAT ATTATTCAACCAGagattttttcttaactttttcttaacttttttcgtgT TGTTTACACGTAATCAAAACAGAGCTAATTCGAAACCTATGGCCAGGCAA GAGGATAAATGATGGAGTGGTCGCTAGCACCTGGGACCAGCCAGTGGTAA CACTGAACTACAGAATTGCagaattttcaattcaattgtTTTCTCGTGTT TTTTTCTTAGGTAATTTTGAAGTATTTAAGAGAGCAGCTGGCGATTGAac aaaagtttggaaaaatgGATCTTGGAGGTACgataagacattttttttac ttttagatATGAAAAGTTATTCCCATTACCATGTCAGTTTACCACATGAA CTGAAAAGATTCGTAAGCAAAAACAACAATATTGGCAAAAATCTGGTCAC TTtgtaaaaatgtcatcaattttCGCCAACAATTTTTTACGAATACGTAG ATATTCCATAATAAAATAAATCGAACATGTGTGTTGTGATGTTATAGACA AAAGAATAAGACCGGAAGTGCGAGTGCCTCTTTAACGTCCGAGTTGGATT CATTAAGATATGTGGGCGATTGCCCTACATAAGCTGACCCCAAAGGGGAT TGAGAATCTTACGTCGTATATGTTTTGGTGTTGTTTTGCATTTATTTCTG TTCAAAAAGTTCCTTATTTATATGATGTTGTTTCCTTGTGTGTTCTTCTA GGATATATAGACATAAACATTTTCATACGGACACGTTCACACTGAAGGGT TGTGCAAACATGAAGCACAATGTATAGCATTCTCAAGATTTCTTTGAGCT GCACTAGGTAGCTCATTTATAAACCTGGTATGGAGCTGAGAGTAGATTTG ACAATTCATCCTTACATTCGATTTATCCTTACATTCAGCACAGAAGAGTC TTCAAAATGACGGATAGATTTCCTAATAGTTGTTTAAGAGAACGCGACGG CCTAtggaataacaaattactccacatacattactttccctcagccagta AAAACGTGgcaaattatcttgtctctaggtaactgctgtggattaattag ttattcaaaagaccgtcGCGTTCTGTCAAACGACTATTCTATATATGTTT ATCTGACATTCATGTTTATTTTATGCCATATATATGACTTATATTTCTCT AGATGTTGTTGGAGACAGCAGGCATCGTCACAAAACTTCTGAAGATTTCT CTGACGAAGAAAGCACTATTCCTTTTGAAGCAGGTTAGACATTATCTCTC TTTTTTTGTTTGCGTGTAAAGAACGAGTACCTTGCTCCTTTtagttgaaa ttcaaaaaatataaaactgaTCACATTTAATACTACAGTTGACTCTCAAA AATTCGGATTACGGAAAGTATTTAATGTGATTTTCCACTTGAGGGGATCA ACGTTTcagtttgaattacagaaagatttgaataataatGGTTCGATTTA GAGAGGCTTGACAGTTTTCAGTGGCCATGCAAACGACACAGCctaaattt tccttaaaattgaaatttatgtTGATCTAGAAAGTCCTGTTTCTAATAAC TAAGATTTTAAATCAACAAACGAAAcatctgttttcttttttttttgtag gaGCAGGGTACTCGGCTAACACTTTCGCTACTAACGACACAACCCATTTC TCGACTAATAACATTGATCTTGAAACAAAAACTAATACTGATACGCTTTT GACACAAAAGTTAGAGGTTTCACTAACACCTAATGATTCAGAACAAACCT CTTCACTTGATCATGTAGGGAAGTCTGACCAAGTTCTACCTACTCAGAAG TCAATGTCTAAAAAGTTGTCAAAGAGTAATCAAAAATGCGACAACATTAG AGCACATGTAGTCAAAACGAGATCTGATATTAAACAGAAATCGAAATCTG ACTCCAAACTTGAAACTAAAGAGAACGCTCATCAACGAAGAGTTGCCGat aagaaaaagattttgactGAGAATTTGGCTAACAGACCACAAACCAGTCC AAGTGAATTGAATCTAATACGCAGGAAAAGTAGACAGCGTAAAAGAGAGG TTAAAAAAGAAGATAATAAAAGTCGAATCGTTAATTTGACTGCACCAACA TCAACCAAGGATATTGGCGAATCTACAAATGCCAAGAAGAGAGTTAATCC TTTGGTAACACAAATGCCAAGGTTCAAAGATCTGAAAATGGACAGTATGG TTGCATTGCGATTGTCTGACCATCACTTCATCATCCCTGGTCAACCATCC CTAGGGAAAATTATACTCATCTCTGACAGTCATGTTACAGTGCACATGTT CACTGGTTCTTTTGGTGGCGCCTGGTGGCCGATGATGAGTCGCCAGAGCC CTTACACCCGAGAAGTTTCTTTAGATAACGTAGTTCATCAGTTTGAACTG GACCAACAGAATATGTTATTTGCTAAAGATGTAGATCTTTTAAAAGCCCT TTGTAAAAGATAAAAAGAGTTactatttggatttcgaaaccTTTGCGTTC TAATTTTTTTGACCTTCGCATAATGTCCTCAATTTAGGTCAGGTGAGTTA TGAGGATTATTCTCTgttatttatttgtattttatCGAATAATATTACCA CATTTGGCTATTTCAGAAAACGTTTGAATATAGGGCTGAAGGATAtagca ttttttgaaaatttacttcCCCTCGGACATCAGAACACTCCCGgaaaagc atcagttgacccccggacattcaaaatcacccctaacTAGAGCAAGTTCA CCCCAAAAACAAGGCAAAACAAGATTCTTCACTACCcagacaaaatatcc aatatatcctacaccccctccccccatgtacaaaaattttctggaaaagc ccattttgtcTGTATTGTGTCtatagatttttttcagtaaAGACTTGTAA ATTATTGTATGGATTTTTCGTCAAcctattcaaaattttcatgttaTACT CACCGGAGTTTTTAAATTAGCCGTATTGGTGTCGTCCGGAACGGCTCTTC AACTGGATTATTATAACATTAatctcaattttgaaaaatacagttattgt tttccttaaaaaaatacatataaaatttctttttcctcGTAAACAAAGTA AATAATTATATTTTCTCTGAGAAGACAAGATCAATAATTTTTGCCTTTAC AATTGCAATAagccagccgaggctggaaagtcagccaataatagagctta gctagatagctttaataagtgggttaagcagatgtaagagatgcactgaa acagagtagactaaaaatgttgaataatgtataaaatgtgaaacatttga taacttgatttaaaattatttaaaacaagcctgagagctcctccaccccc cccccccccccNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNTATAAAAtgaaagagaaacatagtgtaattaaactttttgttaattt cattccagtcagttatgacacattttttctgttggatgtagacaatatcc atatcttaCTAAAGTGTtatactagaaataaataagaaaattgccaaaac gtcagaaccaaaattaagatatccatcaaatatacatagaaactgtactt tttgttttacttgataaaactccaataacactttaaactaacaagctaca agcTTTAAGTCACNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNctttgcaaaacgtagttcatatttataacat ttcaacaggaactgtatttttggtagacttggttaaattacagaaaccat tagTCAGTTGTGTGCAAGGCCAATGAtgtacgtaaaaactgactgctatt cagtcaaagccaaaatttggcaaggtcagaaaaacataatttgcatccag cctgcgtaaataaattttgttgtaCCGTCAAGTTCACAACCATCTtaaag actttgctggtcgcaaatgataatcgaaagcaaaactcaaattcataact atgcggggaagctcattttcccccgtttttctttaaaataccttttgatt ggtctatgaatttgggcgatcgccttaccgccttggcggaataatcACAC GACCatgataaataaattcaacaggacAGCGGAGTAGCAAtcaatttcaa ctgggagtcctctcttctgtgccaagcactggcagtgtttttcaaacttt aaaacaatgttaaatgaagaccagatggatctgtttgttatatgactgtg caagttgtgacaagagtgtgcatgttgtgtaacttgacggtataattcat taaattctagaaaccatttttcataactttcaactttctgcagtccgctt tctgcaagtctgataggagatatgtataaactgttatcgccattcattcc attccatcattcagtcaaaacgtgcgccaaggttagaaaaggttagaaaa acacaatctgcgtccagAACTGCGTGAAAATAGTTTGattaatttcaaca agaactgtatatattaatattaatataattgatcaaattccaaagaccat ttgtcataattttgcaagtctaATAATAGGAGAtttgatgtcatcatttg gttcccgtcatctgaccgaccctgatttacggtcagcaggtagagttgga gagtcggaaagcttttcggctgctttgctggatttccactgtcgacctct gcacgctctgtgtttacaagttttcaaatcgaagtagcgggccgcatgct aatggaggtaaaccgaaaaccagtttatccacggtttctcaatcttttaa ttcggatcagtccacacggattccctttcaacaagatatagctgcttctt aacagaaaaattttttcgaccgaccgaccccgactttttaaagtagaaat gacgggaaccaaacatttttttgcgattcgccttatcaaacacgtccaag tccaaaaaagcacgatNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNgcacgat tgcatccagtctttatcaaatttagacagtagctgtacttttgtaaactt tatcaaattccaataacattataacaccatcaatcccccccTAGagacaa acaagaaaaatatgtttttattgcaaaaactaataaaaagcagcaataaa aagtatcagaaaattcaacataaacaaaaactcgagcaaacggctttaaa cctttaagagatgtagaaaaagaatccccttgatgaaaatcatgtgtttt atttgccgagttaaaaaaataaatcacagaaattgaagcttgcaacagat ttacacactggaaatactttggtacaacactgacttatcacatctgactt atcgcttgagccgccatcttgaaacaccactatgatctgtaaaaacaacg cacgctaaaagtacccaaaaagttaacccgatcggaagaaagtttagaaa tcaaaatgagatcgggaaatcggatttttttttgccgtcttatgatggaa gaactgaattttacctatttgaatgctcagcttaggctgaccaattaccC TTTCTTCTTAATTAAAGTGAAACATACAAAATGATTTTCCGTGTGCTATT GCTTTTTTCTTTGAGAGAAACAACAGCAAGAACTTTTTTAcaccaaaaat acaaaaaatatctttgttgaaaaatacgtttaaatctttttcttttttta catcGAAAAATACGAATTCATTGTATTTTTTAAgaataatgtttttttga aacTACGACAAATGCTGAAATTATCTACTTTGTCATTTTAAAATGATGTg atattcttttctttcttttgttgcaGGTACAAATAGTAAAAAAGGACGCA AAAAATATCAGAGTACAAAATACCGTCGTCACTCCCTGGAAGAAGAGAAA ATGACAAACTCTCCTCCCTACTCCATCAATCCTTTAAACATCAAGGAAAA ACGTTTGAAACAAGTCATATCACCACGCTGGAGGAGGGAGAGTCCTTCCA GCGCTCCTCCGAGTTCTTCACGTGGACAAAAACAAGGTAACTTCCAGTAA CGTAGACAAGGGGGACGCAAATTTGtttaggagagcagatttttatgaca cagctgttatctttttatattatgaatagataattagagtgtcataaaaa tctgctctcctacataAATTTTGCGCCGTccccttgtctacgctactgac tTCTAAATTGCACTTTATTCGCCCTTTTTATCttcgctttctttcttttt atatgCTGGGCATGAATTTTAGGGATAGGGGGTCCTCAAAAACTGCTCTA GAGTTTGATTTGATCCATTTTGATTAAAAGTCACTTAAAATTTCTAATAT GTGCAATACGGCATACACTTGTCATTACTTTATCGACACAAAAGCCTGGT TTCGAATTTCTTGAAAACTGTCTGTtacaattgttttattttgttactAT TGATAGCTTAGGAAAACAAAGTTTTCTTTCTTGTTGATTatgcaaaactt tttttaaactgaaaGATGTGTTGCCACTCGGTTTTGAATAAACTGGGTAT AGCTATTTGAAACCGAACACGTGAAGAAGTTTTTAAAACTAGGGACATCT GTaatttacttttgagatgaacCTTGCTTGCATATTATTTAAAACGAGTA ATTAGCAATTCCGGAGCTGACTTGCCCAGACCAGGAGGACAGAATTTTGT TGTGGCTAGAACTCCCACTCGTCGACTACTACCTTAGTTGGGAATTATGG ATACGGTACACTCGGCAGTCTCTTGAACGAAATCGCACGATCGAAAGAAA TGAATTATGGGTACCAAATCAAGATTATTCAATTGGAGAAGAAAGTCGAA GTTCTAGAATTGGAAAAAGAGCAGTTGAAATTTCAACACCAACATCAAAT GGATATGATAAAATTTGAGCACGATGAGAAGATAAaagcttttaaagaaa aacagaaaatagaaaatgaaactGACTTTCCTCAGGAAATCGGGGAAAAG AACGAAATGGAGCAGTCCgtaaagaacaaagaaatacACGACGTAGACGA TTCTACGGCCCCTCAACAAGAATTGGTGAAGCCCATGCAATCATATGTGA CTAGGGTAAATAAAATGATCTGGGGAGCACAACAATACTTCAATAGCCAT GATGTTATAAATAACCCTGGGTCAAATCATTTTGACTCGTACCAAGACTG GTATAAACATGTTTTTAACTGTTGCTATACAGGTATGCATTTTATAACGG AAGATTATATCTTCGCAAAGATTGAAAATACTGTTACCAACGgccacggg tttcgaattattCTGAGAAATCCAGGAACTAAACATCAGAAGCCACAACC TGACAAATGGTCTGGGAGAGCATCAGTCGATGTTGAATATATCATTGAAG GTGTTCCTGACGACCTTTGGTCTCGGATAACATTTTACGTATTAGACCCT TTAGACCTTTCAGAATCGTCTCCGGCTACGCTAAGTGAATATATACCGGG TACTGGCACTAGTTCTTATTGTAAAGAATGGATCATGTATTTCCAACCAA GGAGAGTGGAAGATGGCTATGAACATCGTTTTGGAATTAAAGAAATTATA TTGGGAATTGTGAACTAGGAGTAAAGAAACTTAACTTTAGTTTATtagaa attgtaaaattgagTTTAAGAATTGAAGATTATtggatttcaaaaaacaa tcatTATGAAGAACTTACTCTCTATCCTTTTGCCTCCTTCATTTCTCATC TAACGCTTCTAAAATATGTTGAGCGGGAAAGATGAGCTAATTatattatc tggcacccagatggtgaaattttcattcgacacgctaaagctgtgaagat cgggaaaattttcaacatctggaaggtttacattacggaattttgcgaga ccgcgtcaagaattttgcagcgggtgGTCttgtaacccagccctcgtttt cggggattggcgggtccaaccgaaatatttataggtttacgcacaagggc tgttgaacccAACCGAgggtgcggcacatcaaaggccgactatcattcct ctccgatgggaaattggcccgttccctttagagctttagcgtgggcgccc gccaatccgccatcggaatatcagataactaaTTATATGGAAAATCAAAA ACTATATTTATTAAGACATTTATgatgtttcatttgaatttaTTGATTTC GCTTTACAACTAAAAACAGCCTTATCCTTCATTTCGTGATTTTTACCATG AGCTTTTCTTTACGGGTAAATTAATGACAACAGAcgaatgaatattttaa aagaCAATACTTTAGCCTAAAGGAATGACAAAATTAGGCTGCTTAAAGGC ATATGTGAGTTACCACTGTagagttcaaaatttcatttcttttagtCTAG CATGGTAACAGCAAGTCCCAATTAATACAAAgcagaaaatgagcaaaaag taataaaatggACAAATTGCAGCCCATACAAACTGATATAGCTTGCTACA ATTATAGTATTATTGTATACAACCATACTGTATAATATTGCATGATTATA AACAACTAAGTTTATCTTTCATTCAGATCGAGATGGTGTGAAAAGTGATT ATCTTCGGAAAGGTGCTATCGAAACAACATATTTACACGACGTCgaaaaa gctgaaaagaaaGCGTTCAATGAGAAAGTCGATCAAATACTCCAAAAGAG AAAGTAAGTCAAGgattttaagtttaaaaacTGCTAGGAATCAACTCTTT TTAGTTGGTGGAGCAAAGCAAACCAAAAATCTTGACTCTGTAAGTTGTTG actagttttttgtttttttttaaacttcgcgaggatcaaatattttgcag attttgcgactttgggtgtcatccgcgaagtTAAGTCCCAAAGGATATTT GGAATTTGGCCTTTTATttgcgaaatatttttaaacaaaactcaaaacat GTCAAATGAACTGCTTTTAATTTAAATGTTTACTTGCATCAAATAAGCGC TAGAAATGCGCATCTcgacaaccaacatgcatgatttggaagtaaaaggc acaaaattgtgaaaatatttgATCCATGGCGTTCTATGATTGGATCCAAA TAGCGTtaaccgcaaaattaagtcctCGCGAAAACTTAGAATTTCGCAGA TGAGCTCAACCGTGAAATCTAATCCCTGCGAAAAGGTATCGcatttaatt ttttagcaaagAAGCCTTTTAATACGCAATGAAAAGCAACCAAAGAAAGA ACTATTTTTTGAAGCGAAAATTGTATTGGTCTAAGCAAACCCAGAAAATT TTACCATAACAAACAAGTTATAACTAAAGAGTTATTAAAAGTTAAGGGGA ATATTATTTTGCGTAgattattttcatgattttcgaGAAAGTTAGTCctc gtgaaaattttaaaataaggaatttttgCCAAAGTTCCTAAGAAAATTAA CGAAATTAGTAAAAAAAGAGGCCGATATGTTAATTTTTGTTCGTGCGAAG GCTTAGATAGACTAAGATTTAGAAAACTcccaattttgacgaattttgaC AACatcaatttctttattttcatttcttccaGAGATAAAACGAGCTTGGA TGATTGGAGAAAGAAAACACGAAGATTGCAAAACCACTCACGAATGTCCA AATCATCCAAGAAGAAGCGAGGTGAAATCCCCCctctacacgtttttata agaacaaattatataagaacataaggcttcgatgaaaaaaatgttaagaa catgttaagacttcgcggactctaaaacacccgaattcttaagaaaatgg acaaaaatactcaaacaatggcgaaaataagaaacaaagttcttgtgtgt gtttcactaaatttgcaatgtttatcaaagtttctctctgcgtcatatta attgtcacgagacatcttttacaaaaaacaaatgaaaattgtaaagaaag ttaattatttttaatcataatggCTGTTGTAGaaacaattattgtgttgg tatacattttcttacattttcttAAACACACGCAgcaaccttctactcag aatcaggttcgaactcgatactttttccGGACACTCTGTATTATTTCATA GCAATAtctttcgcaggtctattgacctctataaGAATTGCACATAAAAA GATagataatagaccttttcataaattacgtcacgaacatcactttcctc gtattcaaacaattaccagggtgctcatatgatctggcctacgtcatgtg ccgcgcttaagggtggggttttgcAGCATCCCAAAattcactgtaagggt gtgtttctgtgagattgcactgtaatggtacgattttgaaaagcagattt tgcgcggcacataccgtcgtttcgaaatcgagtgcccccccccgggtgtt tgtgacgtaatttttgaaaaggtctattgggtCATAAATTTGACTGGTTA GTTATAGTGAGCGTAATCCTTTTCAAATGTTATTTCCTGTGCTCTTTATT ATTTCAGAGTTGAATATACCCTATGGTAACGATGATCAACAAGAACAACA GGAAATAAGCAGGGTGAGTTTAGTGTTTAAAGAATTTGCTACGCTCTATA TATACTGTTATATTTTCAGAGCTGATGGCTCggaatttcaccattttgta attgtgacgtcattaaaaagattatatcatttttggttgaaaagatattc aagttaagtttgtagatttcaaaaatcactCTGTATAATTTGGGGTCACT TTTTAAAAGTGCTGACACCATCGAATTTAGAAGAACTaacaagaaacttt ttcttggaACATGAAGTGAAATTAAAGTTAGGAAAACTtgtaaaggtttt gtttttaaataaaagtgctatcgtttgcttactcttAAGTTCCAAGGGAG GGAGAGGGAGAGGTtgattggaaattttttgagattttaataaacgaaTG GGGGGACCTAATTTCCGGGTGGGTTGGagattgtacttctgaaaatccaa aaataaggtaaatataaaggtaaatataggctaaaaccaggctattttag agcaaaatatggggccttctctttgacagctaaaaatattcttgaaaatt agtaaacggatggtcctaataaggtccgggggggttggaaaattttagaa aaaacggTGGGGGGGGTTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNggggg gggggggtttatttggaacctaagagactcatcaatttaattcacaagct tttcgatattgaattgacaaaaatgtggagcaagattggccagaaagagg aaaagaaaaacattttttggttatatcagcacaataaaacaatactgtcc tgatatgaaatatgtgtctgatatgagacgggaacacttatgtaaaaata aaaactttaataTGAATAATGTTGTACAACCCCCATCcgtaaaatcaaag aaattttctgaGTAAACTTCGTCCCCAtatattccaggctttatttacgt tacagatggacgccagagaatattctGATGGGAACGAGGTTGATCCTGAG TACGAAATTATATATACTTTATTCTATTGTTTATTTTGCCCATTATTTCG TACACAGCATGCTGAAGATGTGAAGAGAGTATTAAGTCAAGATAAAATAT CACGTTTGAAGGAACTGCGTGACCAACAACTTGAGGAGAGGATACAAGAA CACGCAAAACATATCCGTGAGTGGAGACAGAAGAATCGACTGGATAAGAT GGAAACTGATTTAGAAGTGGCAaaacaaaatcttgaaaagGTATATTTTG CATACGCCGAAGGGGAACGTTTTTCTTTATTCCTGATATTatcatgatgt aatgttttatacggaagcatcCAAAATAACCAGGGAGTTTGCcactacag ttgactctctctaattcgatcttcaaaggatcaagtatttttttcgaata agagaaagattcgaactaCGTTTTTATACGACTTTTCAGCTGAGCTGACC AATGTTTTAGTTTGGATtacaaagattcgaataatagaagttcgaattta gagagagttgactgtggCAAATAACCGTCTTTTTTGGCGGCTCCGTATAA AACTTTATgtaaaaaatatcaagaattgtCTATTTCACCGCTGTCCGAGT GACCCAGTGAGAGTCGATCAGAGGATATAAATCGTCACCTTTGAATTGTT GTTTACAACTGAAAAATCCACAGTAGAGAATTTCTTGGAATTTGTGTTTC CCATTGTGGGATTTAAAGGACagtgttatttttcaaatgatgATGAGATT TGAGGATAATTTCCTTCATCTAATCGAAAAAGGTTCGGCCAACAAGGGCC AAATTTtgataccttattggtatatattttcgcgtgttacaaattttcgc gggtacttaatttcgcgagttttttggtcaattttcgcgaaatttaatac tgtttaaatttttcaaaattatgaaaTCGCGAAATCAAATACTCTGGCTC CATCAGGTCTCAACAAAGACTGCCACGGATACGCGAAAGAAGTGTACCAG ATGTTCCGTGACGTCAAAAACTGAAGAAGTCATTGTAATGNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNGTTCTAGCGTCGTTAAATATAATTGT TAAACGtctttgttattcaaaaaaactgaagatgctctaagagagagcga aatattttaaaccagtatgtttttattctgaaatcaaatacacgcgaaaa aaattttcgtatttttacatcaaaaacgttgtgtttcaagcaaaatcagt ctttttcttgctttatattcccactttctgaaaatacctagtttagtgaa tcgcgaaatttNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNagtgaatcgcgaaatttaatacacgcgaaacacgttttt tcgaaaaaatttcgcgattcgcgaaaatttgtaacacgcgaaaatatata ccaataaggtagttGATGATCATGTCTCGACTAATACCCTAAGCCTTGAC ACATTGGAACTGCTTTCCATGTGGGTAACTGCTTGGTTTTCAGGCTGGGC CCCATGGGGACTGTGCCCTTGTGTTTTTGTCCTacgataaattatttttt caggcCAAATTATTATTTAACTATCTACTACCAATCTGGTCCGAAGGGGA GGAGGGTGTACATCCCAGATGCcaaaatttgctaaaatttatgaaaaggg aCCCTATTAATGATTAAGATACAGCATTTAAGAGTCAGCATTTTGTCTTT TTAGGCGCTGAATCTACAACGTGACTTAGAAGAGAAACGTGCTTTGCAGT ACCGCTTGCGTGCATTCACTGCCGAAGAATTCTCACCGCCGAATCACGGA AAACCAAAATAATATCAATTGattattaaattttaaaatgttcctatttt ttgaaaattatttttataattaatGTAAATAGAATATAGAGTTTTATCTT TACAAGAATAACATCAGTTTTATTTATCTTATTGAACAT

Coding sequence (CDS) from alignment at scaffold_89:322898..353636+

>TCONS_00073257 ID=TCONS_00073257|Name=TCONS_00073257|organism=Clytia hemisphaerica|type=CDS|length=6936bp|location=Sequence derived from alignment at scaffold_89:322898..353636+ (Clytia hemisphaerica)
atgGATCTTGGAGATGTTGTTGGAGACAGCAGGCATCGTCACAAAACTTC
TGAAGATTTCTCTGACGAAGAAAGCACTATTCCTTTTGAAGCAGGTACAA
ATAGTAAAAAAGGACGCAAAAAATATCAGAGTACAAAATACCGTCGTCAC
TCCCTGGAAGAAGAGAAAATGACAAACTCTCCTCCCTACTCCATCAATCC
TTTAAACATCAAGGAAAAACGTTTGAAACAAGTCATATCACCACGCTGGA
GGAGGGAGAGTCCTTCCAGCGCTCCTCCGAGTTCTTCACGTGGACAAAAA
CAAGATCGAGATGGTGTGAAAAGTGATTATCTTCGGAAAGGTGCTATCGA
AACAACATATTTACACGACGTCgaaaaagctgaaaagaaaGCGTTCAATG
AGAAAGTCGATCAAATACTCCAAAAGAGAAAAGATAAAACGAGCTTGGAT
GATTGGAGAAAGAAAACACGAAGATTGCAAAACCACTCACGAATGTCCAA
ATCATCCAAGAAGAAGCGAGAGTTGAATATACCCTATGGTAACGATGATC
AACAAGAACAACAGGAAATAAGCAGGCATGCTGAAGATGTGAAGAGAGTA
TTAAGTCAAGATAAAATATCACGTTTGAAGGAACTGCGTGACCAACAACT
TGAGGAGAGGATACAAGAACACGCAAAACATATCCGTGAGTGGAGACAGA
AGAATCGACTGGATAAGATGGAAACTGATTTAGAAGTGGCAaaacaaaat
cttgaaaagGCGCTGAATCTACAACGTGACTTAGAAGAGAAACGTGCTTT
GCAGTACCGCTTGCGTGCATTCACTGCCGAAGAATTCTCACCGCCGAATC
ACGGAAAACCAAAATAAatgGATCTTGGAGATGTTGTTGGAGACAGCAGG
CATCGTCACAAAACTTCTGAAGATTTCTCTGACGAAGAAAGCACTATTCC
TTTTGAAGCAGGTACAAATAGTAAAAAAGGACGCAAAAAATATCAGAGTA
CAAAATACCGTCGTCACTCCCTGGAAGAAGAGAAAATGACAAACTCTCCT
CCCTACTCCATCAATCCTTTAAACATCAAGGAAAAACGTTTGAAACAAGT
CATATCACCACGCTGGAGGAGGGAGAGTCCTTCCAGCGCTCCTCCGAGTT
CTTCACGTGGACAAAAACAAGATCGAGATGGTGTGAAAAGTGATTATCTT
CGGAAAGGTGCTATCGAAACAACATATTTACACGACGTCgaaaaagctga
aaagaaaGCGTTCAATGAGAAAGTCGATCAAATACTCCAAAAGAGAAAAG
ATAAAACGAGCTTGGATGATTGGAGAAAGAAAACACGAAGATTGCAAAAC
CACTCACGAATGTCCAAATCATCCAAGAAGAAGCGAGAGTTGAATATACC
CTATGGTAACGATGATCAACAAGAACAACAGGAAATAAGCAGGCATGCTG
AAGATGTGAAGAGAGTATTAAGTCAAGATAAAATATCACGTTTGAAGGAA
CTGCGTGACCAACAACTTGAGGAGAGGATACAAGAACACGCAAAACATAT
CCGTGAGTGGAGACAGAAGAATCGACTGGATAAGATGGAAACTGATTTAG
AAGTGGCAaaacaaaatcttgaaaagGCGCTGAATCTACAACGTGACTTA
GAAGAGAAACGTGCTTTGCAGTACCGCTTGCGTGCATTCACTGCCGAAGA
ATTCTCACCGCCGAATCACGGAAAACCAAAATAAatgGATCTTGGAGATG
TTGTTGGAGACAGCAGGCATCGTCACAAAACTTCTGAAGATTTCTCTGAC
GAAGAAAGCACTATTCCTTTTGAAGCAGGTACAAATAGTAAAAAAGGACG
CAAAAAATATCAGAGTACAAAATACCGTCGTCACTCCCTGGAAGAAGAGA
AAATGACAAACTCTCCTCCCTACTCCATCAATCCTTTAAACATCAAGGAA
AAACGTTTGAAACAAGTCATATCACCACGCTGGAGGAGGGAGAGTCCTTC
CAGCGCTCCTCCGAGTTCTTCACGTGGACAAAAACAAGATCGAGATGGTG
TGAAAAGTGATTATCTTCGGAAAGGTGCTATCGAAACAACATATTTACAC
GACGTCgaaaaagctgaaaagaaaGCGTTCAATGAGAAAGTCGATCAAAT
ACTCCAAAAGAGAAAAGATAAAACGAGCTTGGATGATTGGAGAAAGAAAA
CACGAAGATTGCAAAACCACTCACGAATGTCCAAATCATCCAAGAAGAAG
CGAGAGTTGAATATACCCTATGGTAACGATGATCAACAAGAACAACAGGA
AATAAGCAGGCATGCTGAAGATGTGAAGAGAGTATTAAGTCAAGATAAAA
TATCACGTTTGAAGGAACTGCGTGACCAACAACTTGAGGAGAGGATACAA
GAACACGCAAAACATATCCGTGAGTGGAGACAGAAGAATCGACTGGATAA
GATGGAAACTGATTTAGAAGTGGCAaaacaaaatcttgaaaagGCGCTGA
ATCTACAACGTGACTTAGAAGAGAAACGTGCTTTGCAGTACCGCTTGCGT
GCATTCACTGCCGAAGAATTCTCACCGCCGAATCACGGAAAACCAAAATA
AatgGATCTTGGAGATGTTGTTGGAGACAGCAGGCATCGTCACAAAACTT
CTGAAGATTTCTCTGACGAAGAAAGCACTATTCCTTTTGAAGCAGGTACA
AATAGTAAAAAAGGACGCAAAAAATATCAGAGTACAAAATACCGTCGTCA
CTCCCTGGAAGAAGAGAAAATGACAAACTCTCCTCCCTACTCCATCAATC
CTTTAAACATCAAGGAAAAACGTTTGAAACAAGTCATATCACCACGCTGG
AGGAGGGAGAGTCCTTCCAGCGCTCCTCCGAGTTCTTCACGTGGACAAAA
ACAAGATCGAGATGGTGTGAAAAGTGATTATCTTCGGAAAGGTGCTATCG
AAACAACATATTTACACGACGTCgaaaaagctgaaaagaaaGCGTTCAAT
GAGAAAGTCGATCAAATACTCCAAAAGAGAAAAGATAAAACGAGCTTGGA
TGATTGGAGAAAGAAAACACGAAGATTGCAAAACCACTCACGAATGTCCA
AATCATCCAAGAAGAAGCGAGAGTTGAATATACCCTATGGTAACGATGAT
CAACAAGAACAACAGGAAATAAGCAGGCATGCTGAAGATGTGAAGAGAGT
ATTAAGTCAAGATAAAATATCACGTTTGAAGGAACTGCGTGACCAACAAC
TTGAGGAGAGGATACAAGAACACGCAAAACATATCCGTGAGTGGAGACAG
AAGAATCGACTGGATAAGATGGAAACTGATTTAGAAGTGGCAaaacaaaa
tcttgaaaagGCGCTGAATCTACAACGTGACTTAGAAGAGAAACGTGCTT
TGCAGTACCGCTTGCGTGCATTCACTGCCGAAGAATTCTCACCGCCGAAT
CACGGAAAACCAAAATAAatgGATCTTGGAGATGTTGTTGGAGACAGCAG
GCATCGTCACAAAACTTCTGAAGATTTCTCTGACGAAGAAAGCACTATTC
CTTTTGAAGCAGGTACAAATAGTAAAAAAGGACGCAAAAAATATCAGAGT
ACAAAATACCGTCGTCACTCCCTGGAAGAAGAGAAAATGACAAACTCTCC
TCCCTACTCCATCAATCCTTTAAACATCAAGGAAAAACGTTTGAAACAAG
TCATATCACCACGCTGGAGGAGGGAGAGTCCTTCCAGCGCTCCTCCGAGT
TCTTCACGTGGACAAAAACAAGATCGAGATGGTGTGAAAAGTGATTATCT
TCGGAAAGGTGCTATCGAAACAACATATTTACACGACGTCgaaaaagctg
aaaagaaaGCGTTCAATGAGAAAGTCGATCAAATACTCCAAAAGAGAAAA
GATAAAACGAGCTTGGATGATTGGAGAAAGAAAACACGAAGATTGCAAAA
CCACTCACGAATGTCCAAATCATCCAAGAAGAAGCGAGAGTTGAATATAC
CCTATGGTAACGATGATCAACAAGAACAACAGGAAATAAGCAGGCATGCT
GAAGATGTGAAGAGAGTATTAAGTCAAGATAAAATATCACGTTTGAAGGA
ACTGCGTGACCAACAACTTGAGGAGAGGATACAAGAACACGCAAAACATA
TCCGTGAGTGGAGACAGAAGAATCGACTGGATAAGATGGAAACTGATTTA
GAAGTGGCAaaacaaaatcttgaaaagGCGCTGAATCTACAACGTGACTT
AGAAGAGAAACGTGCTTTGCAGTACCGCTTGCGTGCATTCACTGCCGAAG
AATTCTCACCGCCGAATCACGGAAAACCAAAATAAatgGATCTTGGAGAT
GTTGTTGGAGACAGCAGGCATCGTCACAAAACTTCTGAAGATTTCTCTGA
CGAAGAAAGCACTATTCCTTTTGAAGCAGGTACAAATAGTAAAAAAGGAC
GCAAAAAATATCAGAGTACAAAATACCGTCGTCACTCCCTGGAAGAAGAG
AAAATGACAAACTCTCCTCCCTACTCCATCAATCCTTTAAACATCAAGGA
AAAACGTTTGAAACAAGTCATATCACCACGCTGGAGGAGGGAGAGTCCTT
CCAGCGCTCCTCCGAGTTCTTCACGTGGACAAAAACAAGATCGAGATGGT
GTGAAAAGTGATTATCTTCGGAAAGGTGCTATCGAAACAACATATTTACA
CGACGTCgaaaaagctgaaaagaaaGCGTTCAATGAGAAAGTCGATCAAA
TACTCCAAAAGAGAAAAGATAAAACGAGCTTGGATGATTGGAGAAAGAAA
ACACGAAGATTGCAAAACCACTCACGAATGTCCAAATCATCCAAGAAGAA
GCGAGAGTTGAATATACCCTATGGTAACGATGATCAACAAGAACAACAGG
AAATAAGCAGGCATGCTGAAGATGTGAAGAGAGTATTAAGTCAAGATAAA
ATATCACGTTTGAAGGAACTGCGTGACCAACAACTTGAGGAGAGGATACA
AGAACACGCAAAACATATCCGTGAGTGGAGACAGAAGAATCGACTGGATA
AGATGGAAACTGATTTAGAAGTGGCAaaacaaaatcttgaaaagGCGCTG
AATCTACAACGTGACTTAGAAGAGAAACGTGCTTTGCAGTACCGCTTGCG
TGCATTCACTGCCGAAGAATTCTCACCGCCGAATCACGGAAAACCAAAAT
AAatgGATCTTGGAGATGTTGTTGGAGACAGCAGGCATCGTCACAAAACT
TCTGAAGATTTCTCTGACGAAGAAAGCACTATTCCTTTTGAAGCAGGTAC
AAATAGTAAAAAAGGACGCAAAAAATATCAGAGTACAAAATACCGTCGTC
ACTCCCTGGAAGAAGAGAAAATGACAAACTCTCCTCCCTACTCCATCAAT
CCTTTAAACATCAAGGAAAAACGTTTGAAACAAGTCATATCACCACGCTG
GAGGAGGGAGAGTCCTTCCAGCGCTCCTCCGAGTTCTTCACGTGGACAAA
AACAAGATCGAGATGGTGTGAAAAGTGATTATCTTCGGAAAGGTGCTATC
GAAACAACATATTTACACGACGTCgaaaaagctgaaaagaaaGCGTTCAA
TGAGAAAGTCGATCAAATACTCCAAAAGAGAAAAGATAAAACGAGCTTGG
ATGATTGGAGAAAGAAAACACGAAGATTGCAAAACCACTCACGAATGTCC
AAATCATCCAAGAAGAAGCGAGAGTTGAATATACCCTATGGTAACGATGA
TCAACAAGAACAACAGGAAATAAGCAGGCATGCTGAAGATGTGAAGAGAG
TATTAAGTCAAGATAAAATATCACGTTTGAAGGAACTGCGTGACCAACAA
CTTGAGGAGAGGATACAAGAACACGCAAAACATATCCGTGAGTGGAGACA
GAAGAATCGACTGGATAAGATGGAAACTGATTTAGAAGTGGCAaaacaaa
atcttgaaaagGCGCTGAATCTACAACGTGACTTAGAAGAGAAACGTGCT
TTGCAGTACCGCTTGCGTGCATTCACTGCCGAAGAATTCTCACCGCCGAA
TCACGGAAAACCAAAATAAatgGATCTTGGAGATGTTGTTGGAGACAGCA
GGCATCGTCACAAAACTTCTGAAGATTTCTCTGACGAAGAAAGCACTATT
CCTTTTGAAGCAGGTACAAATAGTAAAAAAGGACGCAAAAAATATCAGAG
TACAAAATACCGTCGTCACTCCCTGGAAGAAGAGAAAATGACAAACTCTC
CTCCCTACTCCATCAATCCTTTAAACATCAAGGAAAAACGTTTGAAACAA
GTCATATCACCACGCTGGAGGAGGGAGAGTCCTTCCAGCGCTCCTCCGAG
TTCTTCACGTGGACAAAAACAAGATCGAGATGGTGTGAAAAGTGATTATC
TTCGGAAAGGTGCTATCGAAACAACATATTTACACGACGTCgaaaaagct
gaaaagaaaGCGTTCAATGAGAAAGTCGATCAAATACTCCAAAAGAGAAA
AGATAAAACGAGCTTGGATGATTGGAGAAAGAAAACACGAAGATTGCAAA
ACCACTCACGAATGTCCAAATCATCCAAGAAGAAGCGAGAGTTGAATATA
CCCTATGGTAACGATGATCAACAAGAACAACAGGAAATAAGCAGGCATGC
TGAAGATGTGAAGAGAGTATTAAGTCAAGATAAAATATCACGTTTGAAGG
AACTGCGTGACCAACAACTTGAGGAGAGGATACAAGAACACGCAAAACAT
ATCCGTGAGTGGAGACAGAAGAATCGACTGGATAAGATGGAAACTGATTT
AGAAGTGGCAaaacaaaatcttgaaaagGCGCTGAATCTACAACGTGACT
TAGAAGAGAAACGTGCTTTGCAGTACCGCTTGCGTGCATTCACTGCCGAA
GAATTCTCACCGCCGAATCACGGAAAACCAAAATAA
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_045448XLOC_045448Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073257-exon-scaffold_89-1491911889:322898..322939TCONS_00073257-exon-scaffold_89-1491911889:322898..322939Clytia hemisphaericaexon
TCONS_00073257-exon-scaffold_89-1510915933:322898..322939TCONS_00073257-exon-scaffold_89-1510915933:322898..322939Clytia hemisphaericaexon
TCONS_00073257-exon-scaffold_89-1575043694:322898..322939TCONS_00073257-exon-scaffold_89-1575043694:322898..322939Clytia hemisphaericaexon
TCONS_00073257-exon-scaffold_89-1491911889:336863..336993TCONS_00073257-exon-scaffold_89-1491911889:336863..336993Clytia hemisphaericaexon
TCONS_00073257-exon-scaffold_89-1510915933:336863..336993TCONS_00073257-exon-scaffold_89-1510915933:336863..336993Clytia hemisphaericaexon
TCONS_00073257-exon-scaffold_89-1575043694:336863..336993TCONS_00073257-exon-scaffold_89-1575043694:336863..336993Clytia hemisphaericaexon
TCONS_00073257-exon-scaffold_89-1491911889:337716..337774TCONS_00073257-exon-scaffold_89-1491911889:337716..337774Clytia hemisphaericaexon
TCONS_00073257-exon-scaffold_89-1510915933:337716..337774TCONS_00073257-exon-scaffold_89-1510915933:337716..337774Clytia hemisphaericaexon
TCONS_00073257-exon-scaffold_89-1575043694:337716..337774TCONS_00073257-exon-scaffold_89-1575043694:337716..337774Clytia hemisphaericaexon
TCONS_00073257-exon-scaffold_89-1491911889:338998..339083TCONS_00073257-exon-scaffold_89-1491911889:338998..339083Clytia hemisphaericaexon
TCONS_00073257-exon-scaffold_89-1510915933:338998..339083TCONS_00073257-exon-scaffold_89-1510915933:338998..339083Clytia hemisphaericaexon
TCONS_00073257-exon-scaffold_89-1575043694:338998..339083TCONS_00073257-exon-scaffold_89-1575043694:338998..339083Clytia hemisphaericaexon
TCONS_00073257-exon-scaffold_89-1491911889:339758..339824TCONS_00073257-exon-scaffold_89-1491911889:339758..339824Clytia hemisphaericaexon
TCONS_00073257-exon-scaffold_89-1510915933:339758..339824TCONS_00073257-exon-scaffold_89-1510915933:339758..339824Clytia hemisphaericaexon
TCONS_00073257-exon-scaffold_89-1575043694:339758..339824TCONS_00073257-exon-scaffold_89-1575043694:339758..339824Clytia hemisphaericaexon
TCONS_00073257-exon-scaffold_89-1491911889:340700..340780TCONS_00073257-exon-scaffold_89-1491911889:340700..340780Clytia hemisphaericaexon
TCONS_00073257-exon-scaffold_89-1510915933:340700..340780TCONS_00073257-exon-scaffold_89-1510915933:340700..340780Clytia hemisphaericaexon
TCONS_00073257-exon-scaffold_89-1575043694:340700..340780TCONS_00073257-exon-scaffold_89-1575043694:340700..340780Clytia hemisphaericaexon
TCONS_00073257-exon-scaffold_89-1491911889:345724..345933TCONS_00073257-exon-scaffold_89-1491911889:345724..345933Clytia hemisphaericaexon
TCONS_00073257-exon-scaffold_89-1510915933:345724..345933TCONS_00073257-exon-scaffold_89-1510915933:345724..345933Clytia hemisphaericaexon
TCONS_00073257-exon-scaffold_89-1575043694:345724..345933TCONS_00073257-exon-scaffold_89-1575043694:345724..345933Clytia hemisphaericaexon
TCONS_00073257-exon-scaffold_89-1491911889:348474..348600TCONS_00073257-exon-scaffold_89-1491911889:348474..348600Clytia hemisphaericaexon
TCONS_00073257-exon-scaffold_89-1510915933:348474..348600TCONS_00073257-exon-scaffold_89-1510915933:348474..348600Clytia hemisphaericaexon
TCONS_00073257-exon-scaffold_89-1575043694:348474..348600TCONS_00073257-exon-scaffold_89-1575043694:348474..348600Clytia hemisphaericaexon
TCONS_00073257-exon-scaffold_89-1491911889:349480..349568TCONS_00073257-exon-scaffold_89-1491911889:349480..349568Clytia hemisphaericaexon
TCONS_00073257-exon-scaffold_89-1510915933:349480..349568TCONS_00073257-exon-scaffold_89-1510915933:349480..349568Clytia hemisphaericaexon
TCONS_00073257-exon-scaffold_89-1575043694:349480..349568TCONS_00073257-exon-scaffold_89-1575043694:349480..349568Clytia hemisphaericaexon
TCONS_00073257-exon-scaffold_89-1491911889:350405..350460TCONS_00073257-exon-scaffold_89-1491911889:350405..350460Clytia hemisphaericaexon
TCONS_00073257-exon-scaffold_89-1510915933:350405..350460TCONS_00073257-exon-scaffold_89-1510915933:350405..350460Clytia hemisphaericaexon
TCONS_00073257-exon-scaffold_89-1575043694:350405..350460TCONS_00073257-exon-scaffold_89-1575043694:350405..350460Clytia hemisphaericaexon
TCONS_00073257-exon-scaffold_89-1491911889:351555..351737TCONS_00073257-exon-scaffold_89-1491911889:351555..351737Clytia hemisphaericaexon
TCONS_00073257-exon-scaffold_89-1510915933:351555..351737TCONS_00073257-exon-scaffold_89-1510915933:351555..351737Clytia hemisphaericaexon
TCONS_00073257-exon-scaffold_89-1575043694:351555..351737TCONS_00073257-exon-scaffold_89-1575043694:351555..351737Clytia hemisphaericaexon
TCONS_00073257-exon-scaffold_89-1491911889:353402..353636TCONS_00073257-exon-scaffold_89-1491911889:353402..353636Clytia hemisphaericaexon
TCONS_00073257-exon-scaffold_89-1510915933:353402..353636TCONS_00073257-exon-scaffold_89-1510915933:353402..353636Clytia hemisphaericaexon
TCONS_00073257-exon-scaffold_89-1575043694:353402..353636TCONS_00073257-exon-scaffold_89-1575043694:353402..353636Clytia hemisphaericaexon
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073257-proteinTCONS_00073257-proteinClytia hemisphaericapolypeptide
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_89supercontigscaffold_89:322898..353636 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
13.5777 14.5463 18.7263 19.4429 19.4183 14.2096 12.8979 13.5102 12.6924 11.1108 11.3574 12.7201 7.35596 10.2716 8.4149 8.14068 8.39364 11.0948 16.8007 11.3968 7.38533 7.89146 21.2377 19.493 43.5029 32.5067 9.2935 9.68536 15.3178 17.1967
Blast
The following BLAST results are available for this feature:
BLAST of TCONS_00073257 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 0
Match NameE-valueIdentityDescription
back to top