Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00073256 (transcript) - C. hemisphaerica

Overview
NameTCONS_00073256
Unique NameTCONS_00073256
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1357

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00073256 ID=TCONS_00073256|Name=TCONS_00073256|organism=Clytia hemisphaerica|type=transcript|length=1357bp
CTTCAGTCTGCCCAATATCTACAGGAATCGCTGGTACTCTTTCCTACTTA
TCTGTCAAATTCGTGCAAGAATGGGGTGTGTATTCCAACTTGACAGCAGA
CTCGTATGCTATAGTTCCCGCAGGAATTATCATGGCAGTAGCAATCATTG
TCTTTGTTTCTTCAATTGTTGGATTTTGTGGAGTTCATTATGAGAATAGA
TGTACATTGGGAGCGtttgtttCACTACTGACGTTCTTAATGATATTGGA
AGTTGTCAGCGGATGTTTGACTTATGCCTGGAAAGATAATATCGACAATG
ATTTACACACCAACTTAAAGAAATCATTTGATGCTTATTATGACAAAAAA
TTGACAACACAGAGTGCGTTTGATTACATGCAAAGACATTTGAAATGTTG
TGGTGTTGACAGTTCTAATGATTGGAATACAAAAAATTCGACATTTCCTT
ACCATCAAATACCAACATCATGTTGCGTTCATGACACTGGCACGGATTGC
AGTCAATacgagaaaaatatctttaaaaaaggaTGCTACACACAAGTATT
AGAGAATTTTCATCGTATATTACGCTATATCACCGGAATCGTAATCAGTT
TTGCTGTCTTCCAGCTAATCGGTATAATGATGTCTGCGTATttgattgtt
gttttgaaaaagaatggcTATATACGAATGGTAGACCATGCTAATCGAAC
TGGTAGATAATGCTTACAAGATGCATAATATTGACATTAGAATCACGCTG
GTTAGATGAACTAGAtgctttttaaataaaggtcattGTCCACTTAACTC
TTTTTGTCGCCGAACAATCAAGGCTTGTCGCAATATACGGCATgggcttt
tttgaaagttgaaaaattcaACTTGGTCCTAAAAGCTGTGCGTCTCTtct
attgttctttttgaaGTAGTCAATCAGCGAGAGAGTGTGTTTATTTTCAC
CATGTATAGTTcattttgtttagatttttttacgcgcaactttttactta
ttttcaatagaagGATAAAAGCGTTCAGCGACCAAAACGCTCGAACCTTG
CGCGTTTTTGGGCGACCAAAAAAGCTAAGTGGACAACGGCCTTAAGAATG
GTGTTGGGGGAAGTGTAAACAAGCATTTTAACCTCGATTTTTCGGGTCAG
CCGTCCGCAAAAgtgcaaaatatataaaatcgCTAATGGATAAAAAACAG
GGGGCATATATTTTATATAAgaatcttttatttttaagaaagtttttata
attatacatACAAATAAATTTACAGCTTTACATCTCTTTTATAAATACTA
TTTTCTGAAGCATAAGGTttgttaaaataaattttaaaatacataTTGTA
TAACGAG
Run BLAST on NCBI

transcript from alignment at scaffold_89:249713..286859+

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00073256 ID=TCONS_00073256|Name=TCONS_00073256|organism=Clytia hemisphaerica|type=transcript|length=37147bp|location=Sequence derived from alignment at scaffold_89:249713..286859+ (Clytia hemisphaerica)
CTTCAGTCTGCCCAATATCTACAGTAATGCACAATATCTcaaatttactt taattttcctttgactttcaaaaaatagtactTTTAAAAACTATGAATTT ATAGTTAGTCTTGAGCCCTAAGCCTACGCAGGATTGAAGCGTTTTTGCGG CTAAATGAGAATAAACTAAAAAAAAGCTGGTGTGTTATTTTTATGCGCTT CCACGTGCGATCGATATATCGCACTTTGTGACATActgataaaaatcgat ttgaattGATAGTTAATCGATATTAATTGATCAATCAGTTATCGATTAAA ATCCATTATCGATAGCTATAATCAAGGTAAAAAATGTGAATATCAATTAA AGATTGATTAGCCAAAGATTGATATCCATGAGCAATCGATTAATTTCGAT GAGATATTGACTAATATTGATTACCTTGCGGTATCGACTATTCCTTGATT ATCTATcgattagaattttttttcttattcggTGTCACCAAAGTCTTCGG AGTCTTTGCCTATATTTGACATTATAGCCCTAACTCAAAAAATCTTATCT atcttttatttacttttttgaatttattatatgcaccattgcaatttctt ctgacattacatcacggtcccaatagctgattggttgtaagggacgtaaa atcagtcaatacgtcactttcaaccaatcatctgttaggtccgtggaaga cattgcaatggtgcatatcatgaatagaatgTAATTACTTTTGTATATAC TTTGTAGGGAATCGCTGGTACTCTTTCCTACTTATCTGTCAAATTCGTGC AAGAATGGGGTGTGTATTCCAACTTGACAGCAGACTCGTATGCTATAGTT CCCGCAGGAATTATCATGGCAGTAGCAATCATTGTCTTTGTTTCTTCAAT TGTTGGATTTTGTGGAGTTCATTATGAGAATAGATGTACATTGGGAGCGG TAAGAATCTGCCTATATTGTTAAATTTGAATCTTTGTTCTAGTTTAGAGC GTCTACTTCTTGCTTCCTATTCTAATTGCTAATTGTTAGAGCATGAAGGT AATAGAAATAGATGGAGATTCAACGCCTTATGAGtgtttaatacaataat gactggTTTATGAGGGCTGtgctgagaaatattgcccgaggtcaagtaac gacagagtttgcgaggttgttgcgttgaccgagggcaatattttcagtat agcccaaaaaaaccggtcattattgtatttgttaaccgtttacttcaact ttgattgatttttagcgctttatccagaaaaaatagcgaaataaagcgaa ataaagcgaaaaaaacaagcgaaaagagatttttattaattgttataatt tctgacgtcagaaataaaaaatttgagaaaagatGTCAACGCAGTGTTCA TTACGTCacaattttcctaacgacgggcaactctggccattgtaggcccg tcgtcatgcgaaaagaaccaattgcattgcgcaaaaagcccgCGTGTAGC CCGCTTAGAAAAAGAAACCGGTTACCAAAGTCTGGTAATGCCACCCAAAT AGGtgcaaaaatttggaaaaaacaaagttttgaagttcaattttattcct ggataaattttttattaaacacttcaattttctaaaaatacaaATATCAG AGCTTAATCAAACTGGCTTAGTCCAGAAATTTGACATGGCAAAAAGTTCT TTGTAGATTAGACTCCATTTGAGATAAAGTATGCATAATCTAATACCTGT CTTAGATTTCAGCCCATGGCAAATATATACGGCtgtattagaaaatcaaa ttttgctGTCCAGTAttgcatatttttaaaatgctgacaaaaaatctaaa atgctaaaaattattCCTATGAAGTTTGACTTtatgaagaaaagaaaact ggctatgatcaagtaatttcattctagagttgaagaaaaaaacaaaagtt tgctatatttcagttagacaataaaaattagaaaatgaaaccttgttggt tgcggacataactttttgtcaaatttaatttaaaatcagcaaaaaacatt aaactcagttattttttgacttttaaagtctatttcaaattagctggcag tgtttttcaaacctcaataacttttttgctcgttgaaaagacaagCAGGA GTGGGATATtgtcataaagaaaaaaatcaaaaaagatcggaaagtgaaga ttgaaaatggagaagaagaaaatcaacttcttcaataattgaGCTATAGT ATTattttcacacgagtgattctttgatcttagaacatcattaatgTGAA AAAATGTATTCCATCGAAAGATATAGTCCAAAGTTTAACAATGATNCATc attaatgtgaaaaaatttattccatcgaaagatatagtccaaagtttaac aatgattgacttcaaaaatcatcaaaaacaacaaaaaaagccctttttta agtcaaccagggcaaagttttaagctgtatttttgatcgaatgaatattt tttaaatcttttttcacatttatgacgttctaagattgaagagtttctga ttcaaaaatgaagatcacagcattattctacaagaagttgattttcttct tcttcatttttcatcttcgtttttccattttttgaatatttttttctttt ttgataatattccactatctttttaacgagcacaaaaccgctaactaatt caaattctatcaaaagttattgcggtttgaaaaaacactgccagctaatt tgaaatagactttaatacTTACTTAATTACTGCTGTAATTGAACCAAAAC TTATAAATTGAAATCAGTTGTCTTGATTATGTTGTGGACATAACTTTTTC CCTTACAGGGTAGAACCATGGAACATTTGACATCATTTATCTATAATTTT GGAGTGTCTTTTTCTATTACAAAAATTTAAGTAACATTATAGAGACTAAA GCAATATAAAACCAAACGATCtggtttggtttgatttcagttattatatg tttttctttaaataagaacaaaagaagacttATCTATGATATTAAAATTT TCTCATATTTCAAATGGAAGAATGACCCtagaggacacaaaaaattgaaa aaaacaaggAAGAGGACGATACTTACAAAATATAACACTTTAGTATTGTC AAGGTATTATGTAAGCATAACCGCTTAAGAGGTTTAAAAATgtgataaat actttatatagTTAACATACTATTTGCTACAGAATGTGACTCTGTTTTGA GCGATGGAGCAATTCTAACTAGTCTGTAATTGAATGTATAGTAAATCAGG TTGTGTGAATTTAATATGCAAATTAATGCATAATTTATCCTTTATTCAAG CaagattatttttctgttaaaattttcattttggaccTCAACTTGACATC AGAGTACTTCTTTGCTATTTCTAATAGCTTGAGCATTACTTCCATATAAT AAAACAGCATCCCAGCTTGCAAAAACACTTTATCAGAGACATTTTAGaca aaaaagttatgtccgcaacattaaataaaaatgaaagagacaaataaagt gaaatcttcccaataaaaaattatcactTTTTTCTGGTTGAAACCAACTT AAAGTGATCCTAAATGCAAAAATTTATCAAAGAAACCTAAAAATGAAACT TGGAGGCCGCGAAAACTTCATgatttgttgcggacataacacTTTGTTGC CGACATAACTAATTTTTGGAGAAACAGTTTTGTTTCGCTGTCTTGCAACA AGCCTTGAAGGCTTAATTTATTTAATTATGCAATAATCGAGCCGTGCGCG TTGTTCGGCGACCAAAAAAAGCTAAGTGGACCAGCTTAACCCTTTTTTGG TCGCCGAACAACGCGCACGGCTCgatttttgcataaattaaataTATTAA GCCTTTAAGGCTTGTTGCAATGAACGGCGTGAGATTTttggaaagttgaa aaatttcaactttgtgTGCAAAGCTGTGCGTCTCTTCTATTGATCTTTTT AAAGTAGCCAATCATTGAGAAGGTAAACAAACTGATTGTGTGTGTTTGTT TTTATCATgtaccttttcgaccgtagtcgcgcggtcaggcgcgtgccact taaatatttaattatccccctaaactcgatccaatccttttttgatacct ttttctattgtctataggtgcgaaaaaaggactgggacggttttagtggg gtaaagcggacaaaaaaatgcccacgcAACAAtcggcggctacggtcgaa aaggtgtattgctcGTATTTTCTCTTGCGGGtaatgtttttctaattttc aatgGAAGTATAAAAGCGCTCAGCGAACAAAACGCACGAGCTGTGCGCGT TGTTGGGCGACCAAAAAAGCTAAGTGGACCACGAGCTTAAACTGCAGAGC TTTTCTGTTATTTATTTGACACTATAATTCAAATTCCCCTTTTGAAAAAC CCAAGAAAGAGGATAAGGGGGAGATCGActtgaatttcaaaactttttct gatcAAGCAAACGATTTAACAGCTTTTCTGCATGCCATGCAACCCAGTAT ACATTCCAGCTATTACAGACAGTTACCTTATCTGCCCTTCCTTAATTGCG TTAaatctcaattttcttttttttagccTGATCCTAATTTAATTTAAATC CCTTACGGCGGCCATTAAAACGTTAACGTCAATAAGCgttaaaagggccg ataaggtattttaaAGGGATGCGAAGATGGTACGCAGTCAAAAGATTCAA TATTTTCCAAACTTGAAAAGAGCGAAATACTAAAGATTTTATTAACTAGA GGTCGAGGGAAATCAAAAAGGGGTTGGGTTATCTTGTCAGGTCTTACTTA TCACCATGGCCAAGAACTGCCAAGAAGTTAAATTGTGAAAGAGAGACAAA AATTGctttaagttttattttatcaacatcTTGACTTCTAATTGTACCCT AAGGGAACTAATTGAAATGCATTTTTTACTAAAAGCCCTAAAAAATGCCT AGGAATATAAATGTAAGTTCGGTAAAAAGTGGGtgtcaaccgcgaaaatt agttccgcaaaaTGCACCTCACACCGTGAAAAAAAGtgccgcaaaaatta gttccgtaaaaattagttcccgcgaaaattagttcccaagGTAAATGacg aatttagaaaaaataatgaaatttaatTAAACAGAACTAGAGCAAGAGAA CAAGATTTTGATGAATGGTTATCACATATAGGATTAACTTTAAATCTCAT TTAGATTAGAAATGAAACCACGTTTATTCTATCTGAAACGCCCAACCCTT GTGGTTTCAATATAATAGCCAGATTGAATATATAATCTATAATAGCCAGA TCTCGAAAAATATAATTCGTTAAGATAAGAGAAAAGTGCAATAATTTCAA TCCGTCATTTTAAATGCAGAGCAAATCTTAATGCCTTACTTTTTCTTGTT AATgggaaagattgaagattcctctctagcccttcgggtttacAACTCAA TGGCTAAATCATATATCtgcatatttttttattcaatcttaccttaaggg aataaattaatgcgggATTGATTATTGCGAATTTGGCCCTTTCCCGCAAA CTTAAATTCTGCAAAACCTGAAAAATTTccgcattttttcaaaataaggt CTTTACACGTATTGTTTGTATTtcgttggaaatttttttagtttattcTG TTTCTTGAAAAGGATAAAAATCATTCGAAAAGCTATTTCGCATTAATTAA ATCCGCAAAATCCCTAAAATGGGCCTattcgcattaatttattccgcaAA ACATAAAGTTTTTCTGGGGTCgttcgcattaatttattccgcattaattt attctcgaattaatttattcccttaatgtgttttttttatcaGTTTGTTT CACTACTGACGTTCTTAATGATATTGGAAGTTGTCAGCGGATGTTTGACT TATGCCTGGAAAGATAATGTAAGTTTCGATTAGAATTTCCATTTTCTTCt gtaattattttgaaaatggaCAGTGCCGCCCCCATCATACTGTCGCCCCT CCCCAAAATTCATAAACTGACATAAATTGACATAAACCActgattaaagg ttttgtttttaaataattagATAGCGTTTAGTATCTTATCAGTTTTAAAT TACAAgccttttcacattgaattAACACgcatgtggagcaagattggtta gaaagaaggaaaagaaaacatATTTTGTTTTATTCAGCATGAATTCGAAC ACAATATATTAAAATAGGAGATTACTGGCCTGATATAAGACATgggtctg atatgaaacaggaacacttatatataaaactaaaactaaaacctTTAGCA AGTTTTTGAagtctttcttaaaaaaataaaaaaacggtCATGCAAGATCG GGTATTATGGAAGGAAAGCTACGCAAATTTTGGGACGTAAGTCgaataat gatgatgatgaaaaacCGTTAAAAtccactaaaatctcaatatattttgc cGAAGATTGTAGCTTCTTTATTTATTAGTTTGTGTATGAGTTCGTatatt gtctgtacacagacccggtATCTACGGCTGATTAGAGGGCCTGTTGTCAT Tgctttttctcatttgagatttttcaaaccgaccgctgcgatggagtgtt ggtgagagaggggagatgatgagagaagtgttgctctctataaatcatat ttcatcgcagaggtctccgtacgggaattctTTTATCAAATTGACAAAat gcacagagtgtactacgaagcgataaaagtgagatacactctggtacaga gtagttCGTATAATGCTAAACACATTTTCTTGTTCATGACTTTGCACTCA ATTCTATGGTAACATTGATCTCCCAAGGTCAAAAACGACAAAAAgttgtt aattttgtttttgatgaagCTCAAAATACTGCTACCATCGATGACTTTTA ATAACCCTGAACCAAGTTATATTCGCCAATTTTGTTCGGAGTTATTGGAA AAGTGGTACCCTTGAATGGTAGCACTACAACTCGATGTGAGTCAATTTGT AATTAAAGAAACTTTAccgtttaaaaatattttcatccacATTAAGTTCT GGTACCATTAGGTTACCATCTAAAAAaattccgatcaaagattttattTG GTCGTAATCGAGAAACTGTGTCCaagatatataaaggtcaaagTTTAGCA TCCGAAAAGCTTGACTATATAGACATTTCTTTATCAATTTAATGCAAGAG TTTCAAAGGGTATATTATTCATAAAAGTGCTACTACAAAATTTTACTTGT AAAAAATTCATTACTAGTTTCctaaaaaatatgtaaatattATAATTAAA ATACAATACAGTATATGATTTTGTTAAGGCCTTTAGTTCACAGATATCTT AAAATTAGATCGACCTTCTCCCGCATCTCCGAAATTTCTCGTCATCGGTC GTTAAAGGGTTAATAGCGCAATGAAAGCCCCAAATGAGTGTGTCttcaaa gtcttaaaatgttcctaaacgttcttaatattttgaccgcATCAAAGTCT tttgttcttacatagtttgttcttataaaaattgtgTAGTCATGATATAT CATACTTAATGATTTACTCCACCCGGGCTTACTTTCCTTTTGAAATCATT CAAACTCTTCTAAATTATCTCCATTTTAGTAACTTTAGAGATATTTACGC TGCTTCGTCACCAAAAATGATTtactttcataaaaaaaataatttttata agaTCTGGAGTGATGATAAATGACTTAACAAATCATCCGTGCCTTGCGTT ACacgcctttttataagaacaattttacaagaatacaatgctgaaatttg gccaagacctaagaacaaattaagaacagtctttactgagaagtacagat ttccatctatatattaatagccgtagtctgtatgtctgtttgtttgtttt tcgtgtgtcacttttgttttcacaagtaatattattttttgttctcgata aatttgttttaaagtctattcacgataagtgtgcactctttttttcattt acctataacttttgaaggaattcctcaatctttataaatttggcatcgtt ggaaagatattagtgagtggaacaatttggaataaaaaagtctataaaaa aagtgctataactatcattttcactgaagtctATAAAAGTCTATAAAAGT CTataaaaaagtgctataactatcattttcactgaagtgactccttaatt atcgaacgtcatcactgtgaaaaaacttctcaaaaataatcattcagtca aaagatatcaaacaaagttataagctataTATTNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNttttttttcagtttgtttCACTACTGACGTTCT TAATGATATTGGAAGTTGTCAGCGGATGTTTGACTTATGCCTGGAAAGAT AATGTAAGTTTCGAttagaattttcattttctcctgtaattattttgaaa atggaCAGTGCCGCCCCCATCCTACTGTCGCCCCTCCCCAAAATTCATAA ACTGACATAAATTGACATAAACCActgattaaaggttttgtttttaaata attagATAGCGTTTAGTATCTTATCAGTTTTAAATTACAAgccttttcac attgaattAACACccatgtggagcaagattggttagaaagaaggaaaaga aaacatATTTTGTTTTATTCCGCATGAATTCGAACAATATTAAAATAGGA GATTTCTGGCCTGATATAAGACATAGGTCTGgtatgaaacaggaacactt atatataaactaaaactaaaacctTTAGCAAGTTTTTGAagtctttctta aaaaaataaaaaaacggtCATGCAAGATCGGGTATTATGGAAGGAAAGCT ACGCAAATTTTGGGACGTAAGTCgaataatgatgatgatgaaaaacCGTT AAAAtccactaaaatctcaatatattttgccGAAGATTGTAGCTTCTTTA TTTATTAGTTTGTGTATGAGTTCGTatattgtctgtacacagacccggtA TCTACGGCTGATTAGAGGGCCTGTTGTCATTgctttttctcatttgagat ttttcaaaccgaccgctgcgatggagtgttggtgagagaggggagatgat gagagaagtgttgctctctataaatcatatttcatcgcagaggtctccgt acgggaattctTTTATCAAATTGACAAAatgcacagagtgtactacgaag cgataaaagtgagatacactctggtacagagtagttCGTATAATGCTAAA CACATTTTCTTGTCATAATTTTGTACTCAATTCTATGGTAAAATTGATCT CACATGGTCAAAAACGACAAAAAgttgttaattttgtttttgatgaagCT CAAAATACTGCTACCATCGATGACTTTTAATAACCCTGAACCAAGTTATA TTCGCCAATTTTGTTCGGAGTTATTGGAAAAGTGGTACCCTTGAATGGTA GCACTACAACTCGATGTGAGTCAATTTGTAATTAAAGAAACTTTAccgtt taaaaatattttcatccacATTAAGTTCTGGTACCATTAGGTTACCATCT AAAAAaattccgatcaaagattttattTGGTCGTAATCGAGAAACTGTGT CCaagatatataaaggtcaaagTTTAGCATCCGAAAAGCTTGACTATATA GACATTTCTTTATCAATTTAATGCAAGAGTTTCAAAGGGTATATTATTCA TAAAAGTGCTACTACAAAATTTTACTTGTAAAAAATTCATTACTAGTTTC ctaaaaaatatgtaaatattATAATTAAAATACAATACAGTATATGATTT TGTTAAGGCCTTTAGTTCACAGATATCTTAANNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNctttatatt gaataaatattttagtgaaatttcttcacagtgatgacctcctaagatca aataatctctccagtgaaaatgaaagttatagcacttctctgcaagatct tcctttttttcttcttcattttcatcttcgtttttagaatttttttaaag acttttttatttcaaattgttccactcacaaatatctctccaacNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNaaatatctctc caacaataccaaatttataaagaacaaagaattccttcaaaagttatagc taaaagaaaaaagagtgcacacttatcgtgaacagactttaattgacaga tcggatggagcctggtttagactttattcagcctttgttttgaaatttaa ggcccgtctatatttagtaattttaatttctgtcCTGGCTTGCCCACCAA AGGTTTTTCTCTTTTCCTTgagtgagatacactctggtacagagtagttC GTATAATGCCAAACACATTTTCTTGTCATAATTTTGTACTCAATTCTATG ATAAATTGATCTCACATGGTCAAAAAcgacaaaaagtttttaattatgtt tttatttctGAAAGTCTGCGATGAAGTTCAAATTACTGTTACCATCTCGG ACCTTTACTAACCCTGGACCTAgttatatccgccatctttgttcgGAGTT ATTGTAAAAAAGCGGTACCCTTGAATGGTAGCGCTACAACTCGATGTCag catggatttattatagagactctggataaacatcgaatgaaacggtggag agcgaagtattgtctttctattgtttcagaaaacaattgatgttctagNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNgacaagaaattcagacaaaatgctta taatgtaacaaaattttcaattggaaatatctttccaagactgtccccag aagagctgaaattaacataaatAAGACTTGAATCTCTTGGCTCCACTGta gtatgaaaatcctttggaggcacgtggtggcaaggtggtttttttgaggt tgaagtttgaaaatttccggtgtcaaaattaaatttcttatacacaacac gtcttttgcatctttctcacagcttgaaacgtcataacgacttataatta tcaattaagtggaagaatctgactcttaCAAGacagttttaagtctcttt tgggaattggatgagtgattttcgataagaaatgtaataaaaatgcttcg aaaaaatcatttaatgagggaaggagagtgaacaataatatcattactgc ggacatagctagtacacaagaaattggcaaaattcagctcattgtttttc cagtgtctataataattccataaTGTCAGTCaattttaaattaaagaaat tttaccgtttaaaaatattttcaatatcaaTAAGTGATAGATGATTCCAT CAAAGAGTGCTCGATGATCAGGACCAGAGCTTCATACAGTGTAcaggaaa aaacaaaatttgaattatagaactTCAAGTTTCATATTTTACGAATCGTC AGCTATGAAAAATCACAAATGCTAtgatttttatgttgaaaaattgatcg taaaatttttttcaattgaaatGAATCTCTAGGGTCATAAAATATACAAA TGCAAATTCTCTACAGACGTTCTATATGCGTGAAGGTCAATCTTTAGACT TATAATTTgctaataaaaatttattttgatgacGGCATTTAGAANTATgc cagaaaatacaatggaaaagctattaaaatcgaatccctcatgagcaaat gccaaattacaaatgccagttggtctaaacgcagccgtTGTTGTATCATT TTATCTCTTTAACGATCGACCATTTAAAATTGGGAGTTTTCCCAGCGGAT TTTAGGTGCTATTgtcatcaaaataaatttttattagcAAATTATAAGGG TGCTTTTTTACTACGCTAGATCGATAAGTGTTCTCATCAatggtcctttt cataaatttctaagggttgtaaaaaatatacaatgaagattcgtgcttaa cattAGATTTTGATGGCTTCATATTAAGATTCNTTTTTTTGACGAGgtta attcaaaatttcgtatttttcaTAAAGACATAAATTGCAAGATTTGGACA cgttggctgcgtttagaccagcctggcatttgtaattgcttgcagtattc ttttgaattatattgttccgcgcaattgttcggtttgtcaaatNTTGGTC ATTgaaccttttgttctccaagagaggggtagagctctcttggcttaatg accaattaaaccAAAGATACACCGAAAACAGATTGTTTGCAATAAAATAG CATTCAGAGCATCAACATTTATCAGCAGTGAAATTGTTTGGCTTTTgcat aaaatgaaagaactgcCTCCACTGTTGGAGAACTGTTTATAAAAACGACT GACTTATAATTACTTACTTattatcgagtttgaacatgcgattgagtaga aaagtttgtgtgtgttatcgctaaaatataagaacgttctccatcacaca ggcttattacaaaaggtagttNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNaagagggagagcttaaaatacaattttg tgaacacacacataaaactttctactcatagttgtgtttcgactcgatac tttaattagggacaccctgtatatgaTTTAACTGTTGTGGGAGTCAGTAA tgttttcctatcaattttctttgttttagctaatcgattttctgcagaca gtctcagtgaaaaagcaccctaaGTCTAATGATTGACCTTCACGCATATA GAACGTCTGTAGAGAATTTGCATTTGTATATTTTATGACCCTAGGGATTC ATTtcaattaaacatttttttacgatcaatttttcaacatagcatttgtc atttttcatttgatagCTGACGATTCGTAAAAGATGAAACTTGAAGttct acagtatgtggcccccaaaacggcggtcaaatttgaaatttctctcaaat ctagaggaaaagatattttacaaaaatttttgctgcatgaaaacctttaa catctctactttatttccttgaagttctttttcaaaattttcgatttcaa caatatttttcaatcgcttaaagataggcagcttttttctaatggccccc aaaacggaggtttgaaattttagcgatttctcgagatatctttaagatat gaatacaaaattttgaccatagttttgaaatatgatttagagggttttgg gcataagtttatttgataaaatttttacagtatacccctggttgtcaaaa tgcgtAGTGTGTagttaagagccagtttttttaagagcggggcaggtcca atagtttgaaacttagatttttttcatttttggatatgttgttaagtaca atgaactTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCCGCCT GGTCTCttaggatcaaaagagaaacctatgtgacctcctaccattaattt tttatcttgatttaaaaattttcttaacatcgcttgaaaaatgaataaaa tttgggatattttggcccattggcaaacttcaaaggggtctatgtcactg aatttgttataatataagggctatgatgaatcttttatataaaaacaatg aaactaggtgaaaaaagttgttaaatgtgcttttttgggccaaaaaggct ttttttttaattttttgactagagctgaggtcattctattgcagccagta attggcaattagaaagtaaattttatctgaaaatcacgattcctcatcac attccagaaaggtttctaggaaaatcaaatatggtactcttcgaaagctt atagaggctgaattttcactcaaaggcGGATTCAAACTCCCCTGAccccc ttaattttgtaaaattgacccaaaaatctttaaaggtGGACTTTACCAAC CCCATAACACAATTTTGCTATCAGCCTGTTTGCTCTTAAATGCAGTTAAT GAGCCCAAAGTTCAAATTATCCAANNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNCAAACTATTGGAACTGCCCCAAACTgccccattc ttaaaaaaactggctcttaaaatcaaattattaagcccagtggtaatagg gggaaaaactatgaacatatttatgttttcccttaaatttacgacccgat ggaggtaaaatttatgatttttataaattatttcaagattttcgatattg caaagtcaaaactgaaaatttagaaattttcaaaatgacaattttgattt aacaacgtcttaatcaagtttttgaaaacAAATCTCTTTTGAAAATAGTT CCATTCATGTATGGAATAAGCTGTtaaaattttagaaaaaaagcttaact gaaactgaaaatattaagctttaaagatatttttctcctatattttgcaa aaaaattacagagtttgcctttatatataatgttaattttttgttataaa ctattaactcaaggtgataggaatagaattccaagattttttgctttttc tcatatttagaattttcggttNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN Ntttcggttttgtcaatgctgattctagggctccaaaatactggttgacc ttcaagatgctatatcttttacccagcctctaaagtcacagatgtatttg tatcttctgaacggcattaggtgtagaaattttcctataccccgttttca taacttattttcaatatccaaaggaattagagtgagttatatgcaatttt tatctaattttggtgttaaaatatttcctttagacgcaaatatgttattt tgaatctgtctcaaaccagcaaaaacNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNaaatctacaagtcagaatcttca ttttaatgaaaacctccgttttgggggccgtctccgttttgggggccgtc tccgttttgggggccatatactgtataattcaaattttgttttttcctgt acactgtaaaaatattttcatccacATTGAGTTACTGGTACCATTAGGTT AccgtttaaaaaaattccgatcaaagattttattTGGTCGTAATCGAGAA ACTGTGTCCAAGATATACAAAGGTCAAAGTTTAGCATCCAAAAAGCTTGA CTATATAGACGTTCAATTTAATGCAAGAGTTTCAAAGGTATATTATTCAT AAAAGTGCTACTACAAAATTTAACTTGTAAAATTATCCtgaaaaatatgt aaatgttATTATTAAAATGCAATACAGTAGATGATTTTGTTAAGGCCTTC AGTTCACAGATATCTCAACATTAGATAGACCTTATCTGGCATCTCCGAGA TTTTTTCTCATCGGTCGTTAAAGGGTTAATAGCGCAACGATAGACCTAAA TGAGTGtcttcaaagccttaaaatgttcttaatattttgaccgcGTCGAa gctttttgttcttatatagtttgttcttataaaaaatgtgtagtcATGAT TTACTTTAATGATTTACTCCACCCGGACTTACTTTCCTTTTGAAATCATT CAAACTCTCCTAAATTATCTCCATTTAAGTAACCTTGGAGATATTTACGT GGCTTCGTCACCAAAAATGATtcacttttataaaaaataatttttataag aTCTGGAGTGATGATAAATGACTTAACAAATCAACTCTTTGAATTTCTTA ATCATCATATGAAACAATAAGGGACTTTCTTTATCTTCCTCCCATATAGT TATTGTTCCGTCTTTTTCAAGTTGCGGCGAATCATGTATTGAATTGTCCA TATTCACTATCACTAGCCATGACTTCCATTAAGGTGCTActgcagcaaaa cgaacacatagagttgaatttacgttcaaaaggaatgatcttagccctac agtaatttttgttaagagagacctctcatctgagacaaaattctttcaaa tgctaacaaatgtgtcaagggagtgatgtacagtctacttagagtgacat ccgtgccttgtcttacacgttttttataagagcaatttcataagaatacg aggctgaagtttggccaaaacctaagaacaaattaagaagaatgtgaacc tcagatttcagaaattactgagaagtacatgtttccattttaattaatat tgacatttaaggctgaaaaactcatataaatttaagagcagcccagccag AATCATATGACTTACTGGTTTTTCCTATAAAAAGGGTATATATTTGAAGA Tgctgctcttcatatgttattttactaatgtacacgtttagcaacataac tgttcgaatactttgagcagagtaatatttttaacctataaagagcgctt aataactactcgtatggtataaaaagggaatttcccagaaaagggaagGA TTGGtgatttttatcgaaatttgatgaattttagtGAAGTtgtgcagaaa aaaaattcagatcCAGAAAAGCGTGTGTCTGcgaaaataattgacgtcaa aaaataaataatattaatAACCCTGGGCCAAgttatatccgccatctttg ttagGATTTATTGTAAAAATGGTACCCTTGAATGGTAGCCTACTTAACTT CATGTCAGTCAATTtttaattaaagaaattttaccatttaaaaatatttt catccacATTTAGTTCTGGTACCATTAGGTTAccatttaaaaaacttaga tcAAAGATTTTATTTGGTCGTAATCGAGAAACTGTGTCCaagatatataa aggtcaaagTTTAGCATCCGAAAATTTTGACTATATAGACGTTACTTTAT CAATTTAATGCAAGAGTATCAAAGGGTATATTATTCATAAAAGTGCTACT ACAAAATTTTACTTGTAAAAAATTCATCACTAGTCTCctaaaaaatatgt aaaatattATAATCAAAATACAATACAGTAAATGATTTTGTTAAGGCCTT TAGTTCACAGATATCTTAACATTGGATATACCTTCTCTGGCATCTCCGAA ATTTCTTGTCATCGGTCGTTAAAGGGTTAATCACACGATGAGCTATTTTT TCTCAAttggcgcgccttcaaagagagcaattaatcgttaattgtattct gtagagagcaattaatcgttaatcacactcttcggAACGTGATGAAATTT CAAAGCCGCGCCAatgtttcaaaaaactgtttccTCTTTTTAATCTTCCC GCCTTTTTGTTCGAACGTCTGATGTAGATTTCaccatttgactttttgaa agaaaaaaaaattataaacaaacaGAATACATAGCAGAAGAAGATGGAAc gtttttttacttcaaaagaTTCTGATATCAAATCCTTACAAGATGCTAGC AAGtgtaaaaacacacaaagatCAACACATGGATGGATAAAAGTATTCTC TTCCTGGGCTGAAAGTAGAGGCTTCGAAAAACAAATTGAACTTTATGAAC CGAGTGTGTTGAATAACATATTGGAACAGTTTTACACAGAAGTGAGGAAA ATTAATGGCCAAGAATATGAACCAGACAGTTTGAAAGTGATGCTTGCAGC TCTCGATCGACATCTAAAAGACAAAGGTTTCCCTGTATCGATTATTTCAG GAAGAGAATTTGCCTCTTCCAAAAATGTCCTCGAAGGAAAAGCACGTCAG CTTAGACAAGCTGGGATGGGAAAAAAAACCAATAAAGCTGAGAGCCTTAC AGACGAAGAAGTAAATGTATTATGGGATTGTGGACAGCTAGGAGATGACA ACGCTCGTTCACTTATGAATTCTGTTTGGTGGTGTATCGTGCAGCAGTTT GGCATGCGAGGAAGAGATAACCATTACAATTTAGAAATCGATGATTTTTC CTTAAAGGTAGACAACAACGGTAGGACATATGTACACTTTGTTGAAGGAC CTTCCAAAACAAGACAAGGAGGTCTAAATTTCAAAGCAAGATCTATAAAC CCGAGAATGTATGCAATTGGTGGGGCTAGATGCCCAGTTAGATTGTTTGA GGCTTATATATCGAAACGTCCAGAGGAGTTGCGCAATAAAGGGCCTCTTT TCCTTGCAATTATTGATAATCCAAGGAGTCAAAATGTATGGTACAAAAAC TCTCGTTTAGGAAAGAACTCACTGTCAAATATGATGAAGAATATGAAACA AAACTCTCCTCTAATGGAATCTTCTTGCGCtggaaaaaatattacaaatc aTTCTCTAAGGAAAATGACTGTTCGTACATTGAAATCTGCTGGTTTCCAA AAATGCGAGATAAAAAATATAACCGGACATTCGAAAGAAGAGGGTCTTGA TGCATATGATTCGGGGAATGAGGATGAAATGTATAAAATGTCAAGCACCC TTGCTCAGCAGAAACAACCGGTTGCAACAAAAGTAAATCAAGAGCAAAAG GAACCAAACTTTTCATTCGGTCTTGACTGgccaaaaattccttcaaaaca gctaaatcaaggaaaaatgattttcaataaCTGTTCTAACGTTACAATTC AATCAGGTAATGAACCACAACCGAAAAAAAGGAGAAGGAGGCTCGTGATC TACTCTTCAGAGGAAGAGTGAATTTTNACAAAGATCAACACATGGATGGA TAAAAGTATTCTCTTCCTGGGCTGAAAGTAGAGGCTTCGAAAAACAAATT GAACTTTATGAACCGAGTGTGTTGAATAACATATTGGAACAGTTTTACAC AGAAGTGAGGAAAATTAATGGCCAAGAATATGAACCAGACAGTTTGAAAG TGATGCTTGCAGCTCTCGATCGACATCTAAAAGACAAAGGTTTCCCTGTA TCGATTATTTCAGGAAGAGAATTTGCCTCTTCCAAAAATGTCCTCGAAGG AAAAGCACGTCAGCTTAGACAAGCTGGGATGGGAAAAAAAACCAATAAAG CTGAGAGCCTTACAGACGAAGAAGTAAATGTATTATGGGATTGTGGACAG CTAGGAGATGACAACGCTCGTTCACTTATGAATTCTGTTTGGTGGTGTAT CGTGCAGCAGTTTGGCATGCGAGGAAGAGATAACCATTACAATTTAGAAA TCGATGATTTTTCCTTAAAGGTAGACAACAACGGTAGGACATATGTACAC TTTGTTGAAGGACCTTCCAAAACAAGACAAGGAGGTCTAAATTTCAAAGC AAGATCTATAAACCCGAGAATGTATGCAATTGGTGGATAACAGTTAGATT GTTTGAGGCTTATATATCGAAACGTCCAGAGGAGTTGCGCAATAAAGGGC CTCTTTTCCTTGCAATTATTGATAATCCAAGGAGTCAAAATGTATGGTAC AAAAACTCTCGTTTAGGAAAGAACTCACTGTCAAATATGATGAAGAATAT GAAACAAAACTCTCCTCTAATGGAATCTTCTTGCGCtggaaaaaatatta caaatcaTTCTCTAAGGAAAATGACTGTTCGTACATTGAAATCTGCTGGT TTCCAAAAATGCGAGATAAAAAATATAACCGGACATTCGAAAGAAGAGGG TCTTGATGCATATGATTCGGGGAATGAGGATGAAATGTATAAAATGTCAA GCACCCTTGCTCAGCAGAAACAACCGGTTGCAACAAAAGTAAATCAAGAG CAAAAGGAACCAAACTTTTCATTCGGTCTTGACTGgccaaaaattccttc aaaacagctaaatcaaggaaaaatgattttcaataaCTGTTCTAACGTTA CAATTCAATCAGGTAATGAACCACAACCGAAAAAAAGGAGAAGGAGGCTC GTGATCTACTCTTCAGAGGAAGAGTGAATTTTTTTTAAATCTTTTCAATA TTTTATTAAAATTTTTGTACGATAGGATTTTTGTGTTAGACCCTTTATAA TTTTAATGTTAATGTTTTGTTGCTTGTTGTTGTGAAAAGAATTGTGTTAA TCGTTTTCCGAAAAAGAAATTCTGTATTTGTTTGATCAATGGAAATCGAC ACTTATTTCGACGAGAAACTGACAAAAGAAATAATTTTTTTTTAAATTCT GAATGCTTTTGGTCCTTTTTGTTTGCAAGAAAAAATCTCAATCTTCATAA TAAAACCAATAAAACAGCTAGGAAAGGCCAAGCGTGTGATTAGCTCGTAA TCACATGATAACTCGTGAAATTCGAAAATTGCACTTGTGATTTTTTTGTT TTGAATtttcctcgtcctttcggactcggaaaattaaaaacaaaaaaatc actcgtgcaattattctcgaattgcactcgttatcatgtgattacatata ctaatagCGCAATGATAGATCTAAATGAGCGTGtcttcaaagccttaaaa aatttttaacttgttcCTAATATTTTGACCGCATCGAAGCCTTtagttct tacatagtttgttcttgtgtAGAAATGTGTAGAAATAATATATCATACTT TTAATGATTTACTTCACCCGGACTTACTTTCCTTTTGAAATATCATTCAA ACTCTCCTAAATTATCTCCATTTGAGTAACCTTAGAGATATTTACGTGGC TTCGTCACAAAAAATGAtttacttttataaaaaataatttttataagatt ttgagTGATGATAAATGACTTAACAAATCAACTCTTTGAATTTCTTAATC AACATATGAAACAATAAGGGACTTGCTATATCTTCCTCCCATATAGTTAT TGTTCCGTCTTTTTCGATTCTCGGCGAATCATGGATTGAATTGTCGACGA TCACTATCACCCATTTACTTAAAGGTTTCAGCTCTTCTGGAATGGGAAAA CTTTCCCCTTTAAGTTTTATAATTATGTTTATGATGTCATCACCATTAGC TTTCATAAGAATTGCTTTCGCTTCGTTTAAATCAATAAAGCCATCATCAG CCATCAAGCCATCATCAGTACCGAAAAAAAGGAACAATTGTAATTGCCAG AAGAAATCAACACGTACTTTGAAtttaaattggaaaaatttaaCCATGTT TGGTTCGGAACCCATCCGACCTAGCATTGGAGTAAACAATAGATGAAGTC GTCGGGATTTATTTCGGCAATCAAGATCATCATATTCTTTGAATCGGTCA TAATCTTTATCGATTATCCCATCAAGTAAGACTTTGTGCACGTGTGGATT GAAAACTTTTGATCTAACATCATATATTATTTTTGGTAGAGGTATGAACT TTTCTGATTGACTACATATGTCGTTTTCATTCGAGCACTGCATTACCACG CTCATATATTCCATCGACTCCTTCAAACAATCTACAATTAGTGATATTTC TTGCTCAGATAAGTCATACTGAAAGTTAAGAGCAATAAACAATAATGTGT GTTGGTTTTCTTCAACAGCTAATTTTTTAACCTCATTTAGAAAATCGATA AGTACGTTTGTATCAGGTAGATCCATTGCTTGAATCTTTGTCtctaaaaa aatgtttgaattgTCTTTGTTCTGTGCAATAGATCTATTTTCCAATGGGG AGTAAACCCAAACTGTAGTACAAGGAGTATCTAACAAGGATTTTATAAGA TACGTCAGTTGTGGCACTCTAAAGCTGAAGATTGTTGAGCgaatattttg cttcataaaaggAACAATCGTAACATTCTTTACTCTATCACATGCGAAAA AATCTTGTTTCATGTTACCAAAAATTTCTTCTGTTCTAACCAATTGCAAC GAAAtaatccagaaaaaaatcgctTTTAAattcatcatcaattttttgtt tgctCATCAAAGTTCTGTTCCTCACGACACGCTAATGAAAGAAAGTTTTC TCTCCCTCCAGCTTTTATCAAATCAAATGGTCTCAAAATCTGTACTGATT AATATGCATGGTAATTacctttttctaatttaaatttGAACCACAAAAAA TAATTATGTATCAATTTTAACTTTCAGCAAGGGACTTTACTCACGTTGCT TTTAATTCGGACTTTACTCATGTTGCTTAATTGGAAATTTTCTCATGTTG CATAAGGTGGAGTCCTGTTAAAAACCCCAATTTCAAAGTTGAGCTTAATA GACTTCCTGCAGATTGATATTGCTTTTGGGGAAGTTTTTTGGTCATTAGG GAATTTCCCCAGCCAACCGCAAGCGATTATTTGCCGTTCAGagcttagaa aaaaattaacgaGGCTCTCTGTTAGTGCTCGCCGTTAGTGGTCAAAGTGA CTTTGAAGACTTTTAATGACTGATGATGAgttcaatttttggaaattttt gcatcaaccttttcaaatttcagccaaaatgcaaataaaaaactttttct ccaATTCTTTTTCAGAGAGCCTAACAATAATAGCGTCGAAACGATTCAAG CTTTTGACTTGAGATTTACAACAATTTCTTTGATATGATCAGCATGTTTT GAACGAAACAGCTTTACGTATTAGGTAatagaaaataattaaaaaacggA CATGTTAGACCCAATATTTCTGAAAATACTCAGAAACTAAAAAATAGAGT TTGACGGCCCACTTGGTGCACCcagagaaaaatatcaaaaaaagtgaTTC GTTTAAAACATGGCTCTAGtaccaaaaaacatttttggaaaatttgagaa agtttGAATAATCCTATAATGAGATATCTTTGTTAAGAGACTtactactt tttgaaaaaattgtttttttctgaaatattttattGGTATACAActttgt accaaagtattttgaaaaattccgattatttgacaaaaaattgtcaatta ccaGGACTCTGCCTTAATTGGGACTTTTTGGACCTGCAACGGAGAACTTT TaatttaacctttgttcgttcgTTTTTTCCTCTGTTACCAGcctttctca ggattggctgattagtttttttctgattttttttgaacGACAGTTcccag aagaaaaaaattgggcAAATTTAGGTCTAAatgtgcctaaaaatagggtc tTCTGAATTTTgtgtaaaattgcttcattaattttttctgattttttacc tGGGAAaagttctctaaaaagtggcttaAGCCGTTTTTTCCACAAATTaa ttggccgtaaaaatcggattttcttatttggggaaattgccttttgtaat ttttaggaGAAATGAGCATTTCCCGCGATTgtcttggtatttttttctga tcttttgcaCAGCGATAAAAAGTTGTCTTGTTCAAAATCTGATGCAGCCT AATTTTTCTTTGTGTGAAATTCCTTCCatagtttttcttatttttttaca cAGTGATGCCAAATTGTAATCCTTAAAATGTAAGACTACaggatttttaa aaacaaaaagttttacacAAATTTGGtgcaaattttgaatttgtgaAAGT TGCTTTATtagattttatctttaaagaGCTAGAGCTATTTTTATATGAAA GaaaggattgttttttgtttgtgcccaaaacttagcatggtTCTAAAACA TCGAAAAGCCAGTGTGAAACAAGCTTCATCATGTTTTTTCAAGCTTAAGT ATCTCTATGCTATGctgttatcttttctttttcgttcgaacattttcatc ttcatttagCATGTTTCCGACTATCTATCCCAGGTACGTCCATTTGGCAT ATTGCTTGTTTGCTTTGGTCGGGACCCGACAAAAATTGGTAATTtaatac attaaaaaaaagttttacaacatcaataacaaaaataatgaatttaaTTC AAATGCTCATTTCTTGGTGAGAATTAAAAAGTACCTAGAGGATGCCTACA TcgtcaaaaaagttttcacGTAGTTCGGCGCAAACCCTTGGGGCCCGTGA CACCTTTTATGTGATGCAACCATTTCACAGAATGAAGTATTTGAAGAGTT TCGCAAGGGGGGTTGCTACTAAGGCCTTGTAAACTATTTTAGGACTGAAA AACTGACCCCAaacattttataaaatttaGTCGATTTCTCAACATATATC ATACATTCTATCAAAGTCGAATTTTGACGCCATTTCCAGTCGATTTATTT GAGTTAGTTTTGTTAAAGTCCGGCGCAAATGCaacaaacatttcatccaa catttcaaattcttttttggaCGGAATGTTGGATGAAAGTAACGAggaaa aattcaattgatttgagAGGTCATTTgcacaaaaacgtcaaacataTTCG TCCAACATGATTACGCAAATGCATTCAACATTGAAGCCAACAtgaaagtg acgtcaatctcacaaaatgtttgatggcgatcaaaccATAGATTTTATAA AGCCCGGACTGCTAGATATCACCAGCCTCTTTAAATGACCTAAGTGACAA AGTTTTGTTGGTCACAACCAAAGCAAAAAAATGATTACAATAAGAACAAA ACTTCAAAAACAGCCATGCCTCAGCatggaaataaaaaatttactggttc ttataaaaaaaagtgtcttCTAAATATAAATTATAATGCCATGGCATTAA GCATTAGCTCAACAAAAACAACTAATTATTAATCCGTTCACTGAATGATA GTTATCTACAAGCATCTTATATTGATTGCTTTTGATGTAATAGAAATAAA TGGTTACTTGAAAGTAATtaacgattaaaaaaattttaatgaacAGATTA TAAATCTGTATTAATGAGTGAGATGCAGATCTTTTAATCCATAAAATGCC GATATAACTTCTAATAAACATTTTATATGCACAACCAGGTTGctctaacc tgataacagatgttcataattttcttacgcgcacggtaaacctctaaagg cgcttgaaaattatacatctgaggaaaatagtcctcccgcNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNaaatcttgttgtg cgccggaaaaataaaaactgatacggcgccctattcataaacacaatcac gcaactttgttgtcattcccagtccttttagacgaacgcggtccctACGA Ttccgagattgcatattcgtcagattgtttgttttcacacatccctttag agcttcagcgtggtgtgcagaaaacattcacaatctgatctcaggttagg ttGCTCAGGATCGATGTCTAAAATTAGCCGATTTTTTCACTATCTCATAA GCTTAGATGATAtttacaaagcaaaaagaaaatttaccaaTCAAACCGAA AATTCTGTTTAGTAATCTTAAAGTGTTTTACAATCGGCGCcgaatatatt ggcacttttggtttttttaacgtttttcagaatttaaagatcgggcgaga attgcagtttcagtacttccactttgtttcattggatttttcgatatggg aggggttaagtggcttctaggctatattctcagcctttgttattggaata ttttcaagcttttagatcctgagatcctaaggtcatAAGCCTTAAGtatc atgttaaaactcagagttaaaactctactttccaaccgtacttcaaagca cttaaaaatcacttgcggtttccaaatttgagggaattccccttttgtgc caaatattacgGTGGGGATTGTAGGCGATCTAGAagggctaaaattcaaa aatttgtaggcctgattggtgtaattatcgtgcaaatttggaacaaagca cCAAATTTGGACCAGACATACCTAATACCCTGTGGATTGATATTAGAAGG GCTGCCCAGAAAGATTTTAAGGGTAGACCTTATTTTTGGAcccatttatt gaaaaactaGGCTAAAACCCAAGGGCccaatttttatggaaatttcaaac tcattttaagccaaaaacaattatagaatctgaaagctctcaaaaaaNTT CAAACTCATGTTAGGCCAAAAACAATTATAGAATctgaaagctctcaaaa aactatataaaaaacttttgagcGAGTATGGCTGAATTTTGTACTGAACG GGAGTTACTGTATTTGATGTAGAAGTGTCATTTTATAAGCGATTTATGAC AAAAATGAGGGGGAGACCACCACTTCTTCATCAAATAACTCCCGTTCAGT ACAGAACActgacattacatcatagaCCGccgtaagtgacgtaaaatcaa acaatactttaaccaatcagctgttgtgtccgtggaagacattgcaatgg tgcatatcatgaatactttaAATCACGCGAAGTCAAAAAGATGAACTCAA AGAAATTATATTTCACCTGAGTGGCTCAGGCTGGTTAACTTGACCAGCCC ACCGCCATATATGAACAGCCCtgagttgaaaaatttttaattggTAAAAA TAGAACAACATTTCGAGatgaaaaaatgtctttttttaaacatttagaTT TATATGGAAATCGTTCTTCGCCTGTCTTATACGCCAATAAAGATTTAGGC AGAGACTAGGTGATTTTGAAGGTACAACCTGCTAAAAGTTATTCTTTGAC CATTTTAGATCGACAATGATTTACACACCAACTTAAAGAAATCATTTGAT GCTTATTATGACAAAAAATTGACAACACAGAGTGCGTTTGATTACATGCA AAGACATTTGAAATGTTGTGGTGTTGACAGTTCTAATGATTGGAATACAA AAAATTCGACATTTCCTTACCATCAAATACCAACATCATGTTGCGTTCAT GACACTGGCACGGATTGCAGTCAATacgagaaaaatatctttaaaaaagt aAATGTTTAATAACTATTCTTACCTTACTAGGTTAGTAAATTAGTAAGGC AACTAAGATATATGTCGGGAATACCCAagtcaaaattcgaaaatcgaCTC TTGAGAGACTGAGCTCTAGTtaagacggcccacttttcgctctgctattc taattgtgaagtgAAGTAGACATAAAGTTGGCTGTTTGAAGTCAGAATGC ATTTccttcttttgacgtcaatccaatgtcttctttcaacccTTCTCAAG CAAAGATATCaactgccaactttgtgcccaATTTTTGCATACTCTAACAA TTAGTATAGATGGGGTAGAAAGCCGGCCGTTTAAACTAGAGCTGAATGTC AAAAATGTTATCtttttacgaccctttgagagactatttCCCCAAAATGT TCAGCACAATGCTCAAACTTTAATCAAAAATGATCCTATGAGGGAGTTTA TTTCTGATATTTCGAATTTTCGGGACCGCTTAACCCTTTGACTCCGCTGT CGACCACTGTTTTTGACTCTACAGCGCGCAgtggtttttcataaaaagtc aCCTTTTACGCAAACCGGTAtaacttttaaacaaaacaacTTCAGCTAAA AAGTTATATATCTTTGAAAAGGAAAACTTATCTGCTTTCTTCTGAGCCAT AAGATAACTCCTATACTGCATTTTATCTCAGTCAAAGTTTCAAAAGGTTC AGAACTACATTTTACGACACcgaaaaaaagtgcaaaatatgggccaatga aaatctattttttcaaaagctattttagtgaaaaacaaataaaaaactta caGAACNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAATATCATTGCTTAAATGA CCATACATATAAAAGACGCGTATACGCGTCCCTCGTATATAGGCGCGGAC GCACATGTGCGTCCCGCGTGGGCTAAGGGTTAAGAGGCTTGATTGCAAAT TTATTGTTTATATATCCCTTTCAGAggttatttattttttggaatGCGAA AGCAATTAAAAAGCTTCTTTTTAATCGTAcaagcattttcattttatctA ACAAACCCATATTTGAAATCAAATGAacttttatttctaaatttgattta atagtTAGAGGGTTAATCAGGTAGTTTAAGATTTATGGCCTAAAAACCTC TGTAGTCCTGAGTAAAGCCGCCAAATAATTCAGCTTATGGTTTTTTCCAT AATGAGATTTGACAATTAGAAATCTCTACATATGGGTTCCTTATGtcaaa attatattgttttttaGCTTAAAACCTCGACTTTCTCAAAAATAGTCATA CAAAAAGATTCAAAGACATATTTATAACAACGCTGAAGGGactataaaac ttgttcgagttaaagagacattcaatttatagaggttcgaattaaagagt gtccatttctttttttcagggaTGCTACACACAAGTATTAGAGAATTTTC ATCGTATATTACGCTATATCACCGGAATCGTAATCAGTTTTGCTGTCTTC CAGGTAAGTTCGCTTGTACAGTCAGGTCAATAGATCAACCAACCCCTTAA CCCTCTCCGTGCCCACGgggaaaaatgtcaaaaaagttgacaaaaatcTT CGAGGCGATGCAATTGTTCTCGGCGGGAGAAAATGACAAGAGCATTTTGA GCAGCCGATGGCTTGTATATTTGTCCTCACCAGTTGTTAGCCGCCAAGCC CAATGTCAAAtataccatgaacatataaacgactggacatctatctttta ttgtctctttgaagcgagcttcgttgccgcctgttttccaaaattggtat gaaaaatccgacaatattccgtcataattttatttctttgaattatttag gtaaaaagattgataAAGCTTGAACcttactcctaatgcacaaaaaagtt attttcggatttttttacaagtttgtaacatattttatcaactttttcaa ctctgaaatgcagaatttcaactgcgtgtatacttttgaatcccttttgt cactccaataattttctttatgacttcaaaaaaatagcttgccaaagttg agagcctgtgtaataaaaatatcgaaattagaatgtgaaactctctaaaa ttattagacacttttaagtcaaaattttgaaatattagtcggagttttga caagctgacgatgattttgcctctgttatctttgttatgatatagataaa agacttgagaggagtaagtagaacaacagagacttttgtcgaagttttga cgttgttagcaaggtattcccaagtggtatatcatcaaaatctattattt cattttatgcttttaacgaagcggcaacgaagctagctgtgttatcttca aaaagacaaaggagacggatgtccagtcgtttatatgttcatgaatATAC TGGACATAGACTTCTAAAATTTTGCCCATTTTTTTTTGTGCAGCTGCTTA ACTGatcttaaaaaaacattttgcaatGTCAAATATACTTGACATGGACC TGTCGAAAAGTTTCCGCAATGTCAAATATACTTGACATGGGCctgtcgaa aaattttcgcaACGTCAAATATACTTGACATGGCACAGAAAGGGTTAAAA TTCGAGGAAACTAATGAGGTTACCAGGAATTTTAGCattggttttttttt tacagagacaaaaattttgacgtcTCCCGCAGTCCTGGTAAACTAGACTC AAATGTTTTTGCGCACAGTTTCAGTAAAGCCAGAAGGGATATATAGAGTG CTTTAAGCTTTAAGTTTTTCCAAgcaagaaaaaagtgaatatcgcgaAAA AGTATTTTTGCTATTGTTTTTCGAAAACCTATCTAtggtaatgtcacgtg accaaGGTTggattttctataaaaaatatcACTTCTCTAAAATGAATTGA TGGTATGCAAAAAATTCTCGAAGGCTcttttagtactcatatatgtctga gattttagtaccgaacACCTCCCCCCTGCTTTAATAAATCATGTTTAGAA TGTTCAAATGTCATAAAGAAAGCTTTGTTACTTATATACAATGTGGTTCA TGACTCCCGTTCTTATCACATttaccccagccccactggaaagtttgtta aaaattttgttCCCGGTGAGAAAAtactctgaaatttcagcccactggga aattgactttgattccatccccattcaaaacagtggcgttgtggccgggg gcatggccccccccagcggagcttttttgacggggcgccgaagagcaagg ggcgccaaaagagatttttttaaacgctcaaatcttaaaaatcatacttt atgcgccttaatttgcgccccaggaccaattttactgagatagttttaaa atacttgaatttttttcgctcgcttcgctcgcaatacagttaattggtaa cttctttgcaatctagctaatttacaaatttttttgtgtacaatatagca ttattaaatgaaaatctaactgcgccccaagaccaatttgctgacaacaa tatttaaatcataaaacatcaattttttcgctcgcttcgctcgcattaca cattgtttctttaagtttcttttcactctagcaactGTCAAATTTATCTA TTTTTATtaagtgatttagggtatcttggtagtcaattttcaaaattttc tagtcggccccaaccatggtggggtctgtttttcctttttccattcatca aagatatatctacttttatccattaaatatttccttcctcgttATGCCAA GGCATtagtaaaaatttagaaattgctGGGTCTTCtggggggcgccattt aaaaaaaattgactttggcccatccagaaaaattttcccacaacgccact gattcgaaattcaatgttttaaaaattgcactcaaaacccatccccactg gatttttaacGACGTTGGAACGAtctaatttctatccccattgggatttc aataggtgTTTTTATcgccactgaggaaaaaagattTACTGGGGCTGTGA GAGAGGGGtgtatttattgttctacgggaAGACCTTCAGAAAACATGGTG CGGTCGATCAGCATAATGAAAATGAATTTCTTTAGGGTCGGATCTAGGGT CGAAAGGTCAAGATCTAACAAATTCGTGACGTTTTAAAGCAGTTCTTTTT CCCCTCAATCGATGAGCGACCTTCGTTCCAATTCCGTTGTATGTTGTATA TTTAATTCGTTTTAGTTCAGTTATCTACAAAAAAGTTATAAAGTCAATTA TCCAGCTTTGgaaattcaacattttttatCGATTATGCAAAAAACAGGGT TGGTCGGGCCcgtgaataaataaattaatttaattaaattacAAATTTGG TCTCACCTAGCCTATAATAATCATAGACAAAGAGCAGAAATACACATCCC TAAAAGCCAAcccaaaaatggcattttcttgTTTTGGGTAATGACGGGAT GAGATACATAAAACAATGCACATTTACCAGATATGATTTAATCTTTACAT TTAGCTAATCGGTATAATGATGTCTGCGTATttgattgttgttttgaaaa agaatggcTATATACGAATGGTAGACCATGCTAATCGAACTGGTAGATAA TGCTTACAAGATGCATAATATTGACATTAGAATCACGCTGGTTAGATGAA CTAGAtgctttttaaataaaggtcattGTCCACTTAACTCTTTTTGTCGC CGAACAATCAAGGCTTGTCGCAATATACGGCATgggcttttttgaaagtt gaaaaattcaACTTGGTCCTAAAAGCTGTGCGTCTCTtctattgttcttt ttgaaGTAGTCAATCAGCGAGAGAGTGTGTTTATTTTCACCATGTATAGT Tcattttgtttagatttttttacgcgcaactttttacttattttcaatag aagGATAAAAGCGTTCAGCGACCAAAACGCTCGAACCTTGCGCGTTTTTG GGCGACCAAAAAAGCTAAGTGGACAACGGCCTTAAGAATGGTGTTGGGGG AAGTGTAAACAAGCATTTTAACCTCGATTTTTCGGGTCAGCCGTCCGCAA AAgtgcaaaatatataaaatcgCTAATGGATAAAAAACAGGGGGCATATA TTTTATATAAgaatcttttatttttaagaaagtttttataattatacatA CAAATAAATTTACAGCTTTACATCTCTTTTATAAATACTATTTTCTGAAG CATAAGGTttgttaaaataaattttaaaatacataTTGTATAACGAG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_045447XLOC_045447Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073256-exon-scaffold_89-1491911889:249713..249735TCONS_00073256-exon-scaffold_89-1491911889:249713..249735Clytia hemisphaericaexon
TCONS_00073256-exon-scaffold_89-1510915933:249713..249735TCONS_00073256-exon-scaffold_89-1510915933:249713..249735Clytia hemisphaericaexon
TCONS_00073256-exon-scaffold_89-1575043694:249713..249735TCONS_00073256-exon-scaffold_89-1575043694:249713..249735Clytia hemisphaericaexon
TCONS_00073256-exon-scaffold_89-1491911889:250470..250661TCONS_00073256-exon-scaffold_89-1491911889:250470..250661Clytia hemisphaericaexon
TCONS_00073256-exon-scaffold_89-1510915933:250470..250661TCONS_00073256-exon-scaffold_89-1510915933:250470..250661Clytia hemisphaericaexon
TCONS_00073256-exon-scaffold_89-1575043694:250470..250661TCONS_00073256-exon-scaffold_89-1575043694:250470..250661Clytia hemisphaericaexon
TCONS_00073256-exon-scaffold_89-1491911889:258241..258315TCONS_00073256-exon-scaffold_89-1491911889:258241..258315Clytia hemisphaericaexon
TCONS_00073256-exon-scaffold_89-1510915933:258241..258315TCONS_00073256-exon-scaffold_89-1510915933:258241..258315Clytia hemisphaericaexon
TCONS_00073256-exon-scaffold_89-1575043694:258241..258315TCONS_00073256-exon-scaffold_89-1575043694:258241..258315Clytia hemisphaericaexon
TCONS_00073256-exon-scaffold_89-1491911889:280921..281160TCONS_00073256-exon-scaffold_89-1491911889:280921..281160Clytia hemisphaericaexon
TCONS_00073256-exon-scaffold_89-1510915933:280921..281160TCONS_00073256-exon-scaffold_89-1510915933:280921..281160Clytia hemisphaericaexon
TCONS_00073256-exon-scaffold_89-1575043694:280921..281160TCONS_00073256-exon-scaffold_89-1575043694:280921..281160Clytia hemisphaericaexon
TCONS_00073256-exon-scaffold_89-1491911889:283032..283115TCONS_00073256-exon-scaffold_89-1491911889:283032..283115Clytia hemisphaericaexon
TCONS_00073256-exon-scaffold_89-1510915933:283032..283115TCONS_00073256-exon-scaffold_89-1510915933:283032..283115Clytia hemisphaericaexon
TCONS_00073256-exon-scaffold_89-1575043694:283032..283115TCONS_00073256-exon-scaffold_89-1575043694:283032..283115Clytia hemisphaericaexon
TCONS_00073256-exon-scaffold_89-1491911889:286117..286859TCONS_00073256-exon-scaffold_89-1491911889:286117..286859Clytia hemisphaericaexon
TCONS_00073256-exon-scaffold_89-1510915933:286117..286859TCONS_00073256-exon-scaffold_89-1510915933:286117..286859Clytia hemisphaericaexon
TCONS_00073256-exon-scaffold_89-1575043694:286117..286859TCONS_00073256-exon-scaffold_89-1575043694:286117..286859Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_89supercontigscaffold_89:249713..286859 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
1.76896e-07 0 3.8936 3.78515 2.7119 2.52387 5.97436 6.28777 0.0926454 0.0440698 5.74254 0.00327973 0.283245 6.45784 5.67846 5.75438 0.230751 6.22338 5.57976 7.81184 7.63578 6.64018 9.79618 0.462653 0.0065571 0.022958 5.20203 3.22362e-05 0.649149 9.03865
Blast
BLAST of TCONS_00073256 vs. Swiss-Prot (Human)
Match: CD63 (CD63 antigen OS=Homo sapiens GN=CD63 PE=1 SV=2)

HSP 1 Score: 79.7221 bits (195), Expect = 7.894e-17
Identity = 43/158 (27.22%), Postives = 79/158 (50.00%), Query Frame = 3
Query:  177 CGVHYENRCTLGAFVSLLTFLMILEVVSGCLTYAWKDNIDNDLHTNLKKSFDAYYDKKLTTQSAFDYMQRHLKCCGVDSSNDWNTKNSTFPYHQIPTSCCVHDT-GTDCSQYEKNIFKKGCYTQVLENFHRILRYITGIVISFAVFQLIGIMMSAYLI 647
            CG   EN C +  F   L+ +M++EV +    Y ++D + ++ + N ++  +  Y K   T S  D MQ   KCCG  +  DW  K  +   +++P SCC++ T G   +  EK I K+GC  ++     + +  +    +  A  +++GI+ +  L+
Sbjct:   73 CGACKENYCLMITFAIFLSLIMLVEVAAAIAGYVFRDKVMSEFNNNFRQQME-NYPKNNHTASILDRMQADFKCCGAANYTDWE-KIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNVLVVAAAALGIAFVEVLGIVFACCLV 228          
The following BLAST results are available for this feature:
BLAST of TCONS_00073256 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
CD637.894e-1727.22CD63 antigen OS=Homo sapiens GN=CD63 PE=1 SV=2[more]
back to top