Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00073251 (transcript) - C. hemisphaerica

Overview
NameTCONS_00073251
Unique NameTCONS_00073251
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length2107

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00073251 ID=TCONS_00073251|Name=TCONS_00073251|organism=Clytia hemisphaerica|type=transcript|length=2107bp
TAGCAAAGTGGAAAATATACAACAACGGTAATTACGggaTTGACCAATAT
GAAGGATATGAAAGTAACGTTTATGTTTCTGGTAATGTTTGTGGTAACGA
TGGTCCATATCTTCTCCAAAACCTATGTTGAAGAATTCCGTCTATCTGTC
CGTCTGTCTACTAAATCTGTCACCAATATCACATTGCCATCAGATGAAGA
TGTTGTACAGACCATCATGAATTTGAAAAAGCTGAAATCAATGTCTGGAC
GTTTGGAAATCGAAACATCAAAACAGATCAATGTACTGGATAAGAAAGCA
AGTGTTTTCATGAAGATCGATTCAAAATTGGGCGATTATACTCCGAACAG
TGATACACAGATCTCCTGCGCCAGTGACAAAACTGTTAAACTTTTAGTTT
TAGTACAAACACCTTATAAAGATATCACTAGAAGGATGATTATTCGGGAA
GCTTGGAAGCAACAAATGGACCATGATTCGAACCGTTTGAATTGGAAAAT
GGTATTTGTTGTCAGTTCGCCAGATCAGGGatgggaagaaaaaaatttct
ttcgtACTGAGATGAAATTCAAAAGAGATATGCTACTTGTTGAACGTCCA
GAACGCCAAAGCGAGTCTGCTAAGAAGCTTTATTCTGCACTCCGCTGGTC
GGCTAATGGATGCAAATTTGAATATTTGTTAATGACAGATTCTAACACAA
AGCTGAATTTCAAAGCTATCTACAACATCATGCATTCACCAAACATGACT
AAAGGAAACCTTGTAATGGGGCACAAACTAACTGAAAAATCATCCATAAC
TTTTCGTCCAGTCAAAACCTCAATCACCAAAACTGAATTGATTTCAAGAT
TCTCCAGCACTCAATTCCTAATGTCCAGGGATGTTTTGACCAAAGTCCTC
CACCTTTTGAGATGGTATTCTACCCATGGACGTGTCCAGCAACCAATGGC
CATGCTAGCTCTGGCAATGAAAGATCGGCTTATATCTCCACTGGAGTATA
AACATTTCTTGACCAAACTGCCTAATGATTGCAAAGTCACAATCGAAAAA
ACATTGTTGATGCAAACACACAATGACGATTGTTTTAGAAACCCTTTGAT
GAAGTAGTGTCACCACACCACACTGGCACGCAATGTTATTTTAATaatca
tctaacgttatatggacgttgtgaacattataTAAACGTTTAAAGAGCAT
AGATTATTTTAAGAATGTGAATATTTTAGTGTAATTTGTTATTATTTATC
CAAATCATGTTGGtattaaatcaaaaaataaggCTTTACAGGAACGCTGT
AAGGGCTCCAAACATATTTTCCCGGGTACCTATTAACCAATCCCCCCGGT
tgataaatgtttttaaaaaattttccttttactTTTTCAGCTGgtaaaca
acgttgtttcaacgttcatttaacgttttatggacgttgtgaacgttaga
taaacgttgaaacaacgttgtgtgccagctggggtagGATCATTTCCCga
cttttatataattttaacaATTTCCACACACCCGCTTGTTCCAGACCCCC
AGCTCAGGTGCCCACAAACACACCTGTCTCAAAGCCCCGGGGGAACTTTT
tctctcagtggggataaaaattcctaataaaatcccaatgggaatagaaa
ttcctttgttccaaggttaaaagatttagtgggaatggttttaaagtcca
atttttaaacattaaatttcgaatgggacgaaaaaaaaattaatttccaa
gtggggccatagtggggctgaaattctaacGTATTTCTGTCAATCTTTCC
AGTGTGGCTGggctcccagcgggtctgtgacacaggggtcaTCGGCATTT
CCTTTGTCGAATGTTGCACAGATTTTCCATGAAATGGCTTTATTGATTCG
AAATGAGGATAcattttcaagccaaaaagGAATATTTACTTCTTTCACtt
tgtaatttgattttaatatttttgaataattttataTGACGAAGAATGTa
atgcaatgtttttgtttttaaattgcaattatttttattttgtaaaaaag
aaaaacttaagcATTTGAGAAAATATACAACAATTAGTGTATGCTAAATG
AAAAATG
Run BLAST on NCBI

protein sequence of TCONS_00073251-protein

>TCONS_00073251-protein ID=TCONS_00073251-protein|Name=TCONS_00073251-protein|organism=Clytia hemisphaerica|type=polypeptide|length=352bp
MKDMKVTFMFLVMFVVTMVHIFSKTYVEEFRLSVRLSTKSVTNITLPSDE
DVVQTIMNLKKLKSMSGRLEIETSKQINVLDKKASVFMKIDSKLGDYTPN
SDTQISCASDKTVKLLVLVQTPYKDITRRMIIREAWKQQMDHDSNRLNWK
MVFVVSSPDQGWEEKNFFRTEMKFKRDMLLVERPERQSESAKKLYSALRW
SANGCKFEYLLMTDSNTKLNFKAIYNIMHSPNMTKGNLVMGHKLTEKSSI
TFRPVKTSITKTELISRFSSTQFLMSRDVLTKVLHLLRWYSTHGRVQQPM
AMLALAMKDRLISPLEYKHFLTKLPNDCKVTIEKTLLMQTHNDDCFRNPL
MK
Run BLAST on NCBI

transcript from alignment at scaffold_89:135088..150573+

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00073251 ID=TCONS_00073251|Name=TCONS_00073251|organism=Clytia hemisphaerica|type=transcript|length=15486bp|location=Sequence derived from alignment at scaffold_89:135088..150573+ (Clytia hemisphaerica)
TAGCAAAGTGGAAAATATACAACAACGGTAATTACGGTAAGACATAACGA TTGTTTTGTGTACGTGTTCAAAAGAAACTAATTACGGATACCAAGGATAT TAAGTTGAATATGATGCTTAAGTTTTTTCTGGTATCTTTACGAAAATGAG CGGTTCAAAGGTCATTAcactttttgtattttaatttcatttcagtcaca ggaaaaaatcttaaaatcccaGGCCTGAGAAATGGCAATTTTCGCAGTGG GATTTTTTTTGCCCTGAGATTTTTTAATGATTACATATTTCGATTAAATT TCGGGGTTGATTTTGGCCATTTTACAACCCTGGTAAAATTTTTATGCAAA CTTTCCCACCCCGAATATGGCCATTATTCAGACCTGGGATTTCTTGAGGT GTAAAATGGTCATTTTCGAGGTGGgacttatttttcataaaatcagAGAT TTGGAAACCCACCCCGAAAATGGGCATTTCCCAGGCCTAGGATTTTTCGG GTTTTAAAATGTACGCATGTGCAAAGttaaaaccacaagtgattttttaG TTAAAAGTGTACAGATTGTATCTAAACCAAAACATTTTATAGTTGTATTC GGTCAGTGTGTAACACATAcaatcatggacgaaaattGTGAGACAACTCT CCTTCCCCCTTTCCCCCTTGTGGCAATGTTGAAGGGCATTGGAAAAGTCG GTGGGAAGGTCGTTCGCACTAAACATCGCCACTGGGGGGGGAGGGGGACC ATCCATGGTTTTTCCAGAGCATTTTCCtgtgtttttctcaaacattaaaG TCCATGATTGTAGCTACATTCGTTCACAGTGGACTTACGTTGCCTgggct cagtggatcggtgaTTCTTTTCAAAGTTAccattaatagaccttttcata aattacgtcacgaacatcacttgcctcgtattcaaacaatttccgtGGTG ATCacatcccttgagacattaaatgattttggtaggaatagaaaatagtt gtaataaaatctgctgggagttaatcaccatggcagtaatttcaaaacga ggcaagtgatgttcgtgacgtaatttatgaaaaggtttattcATACTAGT TTTATAGGGGTAGTTCAAAACTAGGGACGGGGGctgttcctgtaccaccc ccTAACTTTTGATTCTAGTCTAgtctttttggataaaatttggcacacaa gatccttgtcatttaagtaacttttgacaaaatattcttttgatgagatc actcatcatgctcaaagtgagaaaaaaacaacaatttcatttgtttttat attagctattgtattctaagaAAGTCTTTAGAAAAAACTTCCCTGAGTCT AAAGGTTTTAAGGTTTTACGGTTTTAAGTGAGAGTAGAATAGATCATGCA AAAACTTATTTTCCCTTATTtcagcatagtataagaaagccgcggctttc ttatactgtgatttcagtATTATGATAAATCAAATCTTCAGTATTTTTCT AGTAAAGCATCATGTATCAAATTCAAATGCGGTTTACTAAACTTAAGTGA AAGTAGAATGATCATGTTTAATTTCTGTTTAAATCTTATATAAATTGAAA CATCCAGAaggattttaaagttttcacAAAAGAGGAGGGGGCTTACAGTA GAGGGGtccaaaaatgactttttttggagatttttatgtttaaccatctt ttttaaattaatttttcatgctgattccgaatttgaaaTCTGTTTTTCCA TACCTCTTACCCCTGGGCGGCTACCGGAGACCCTTTTTTCGGAAAACCGC CCAAAAccgctaaaattaaaattttttaaaattttccattttgaatagct ttctagtgatgtgatatcttttttaaatcagtttttcatgctgattccga atCTGAAATTCATCTTGTCATAGCTCTCACCCTTGGCCTGGTATAGGAGG ctgtttttttactaaaatcttCGAAACTAAGGAAAattaataatttgaaa atgtttgaatttgaatgaactttgaatgaaaaatttaatggtAACTACTT GTTTTAGAtcaagttttcatgctgattccaaatttcaaattagtttttgc aTATCGCCCACCCCTGGTCTGCTATGGGGCCGGCTACATGAGGTTCCTTA TTcagaaaatattgcaaaaaaatgtacaaaaatcaatattattgAGAGGA TATTTCTTTTAGTTCGTCTGTGGCTTTTTGACACTTGGCTAATGTTATAC ATTCATCGTCATAGGGTGCCTTGAGTACTTTATCTTTATCCAATGAGCTA ACCCTTTGTACTGCTGCTATAAATTTATCTGCTCAACTAGTCATGAAGCA CATTCAACCTGATTAGAATCTCGTTACTATCTCAAGCTAGTGAACTCCTT TCAAATACAATGATTCCCTAAATTAATTGAACATTGAAATGTTGATAATT GTTTTTAGGATGCCTTAATCATTTAAGGAGAtaagttaaaattaaaatca cTAGGCTATACAGATAGCTAATATGGAAtctttcaaataattttaattca aaCGAGTCATATAAGAACAGGTTTTATAGTGAATCTATTGAAAGGTACCA ATGTTTAAGAAATATAACCTATTCCTAAAAAATAACTTCCCAACAAATGG ACCAATATGAAAGTATTTACATGGTTGTCCCTGGAAAGGAGTTTTACGGG GTTTTACTACTTAGAAGTTCACAAGATAATTTCatttctgaaaacttttt tctaattgACTTATCAAAGACCCCTTGTTCAGAACAAATAGTTATATTTG TGGAAGTCCGTAATAATTAACACCAATAATATTGTAATTAAATCAACAGC TTAAggtctgatttatttttaaaaagcattagTTCTTCAAATCTATTCAA GCAGGTATTTAAGGGATATCCATTCCTTAAACAATAGCGCCTTTCGATTG GTTCAATAAACAACTATTTGAATGTAGGATTTTTAGATTCTATCTATTCA GTATAAGGTCTATACATCCTTATGATTTTCATTGTAACTTGACCTTTCAA ACAATGATATACGGCTTGTGAAAGCCAATATCAACTTTTGAATGTCCAAT GCGGACAATCATTGCATTTGGAAGAAGTTTACTAGCTCAAgatattttta acaatttgaTTTTTACATCTTTAATCATATTCTAAGCAGACAAATTAAAA GCAGCTCGGTCCATAGGGTTGGATCATTAAAGTACTCAAAACTCTTTGTA ACAAGGAATGTATAACCAGATGTTCTGATAAATGGAATCCAAGTACAAGA ATCtcctttgaaaaatattcatttcagtacatttttgcgatattttcTGA ATAAGGAACCTCATGTAGCCGGCCCCATAGCAGACCAGGGGTGGGCGATA tgcaaaaactaatttgaaatttggaatCAGCATGATCTAAAACAAGTAGT Taccattaaatttttcattcaaagttcattcaaattcaaacattttcaaa ttatcaattttccttggtttcgaagattttagtaaaaaaacagCCTCCTA TACCAGGCCAAGGATGAGAGCTAggacaaaatgaatttcaaattcgGAAT CNCTCCTATACCAGGCCAAGGGTGAGAGCTATGATAAAATGAATTTCAGa ttcggaatcagcatgaaaaaccgatttaaaaaagatatcacatcactaga aagctattcaaaatggaaaattaaaaaaaaatgacttttagCGGTTTTGG GCGGTTTTCCGAAAAAAGGGTCTCCGATAGCCGCCCAGGGGTAAGAGATA TGGAAAAACGGAtttcaaattcggaatcagcatgaaaaattaatttaaaa aagatggttaaactcaaaaagtgtaATTTTGGACCCCCCTACTTAcaggg tttgcgatttccgaaatcccgaataattttgccaaaatttctgagattcc gtaaaaaaatacttgcaattccgatactgattttttttgggttttttacc tcgttttgactaattttttatcaaatttgattttacatttatgaattccg aaaaagggggataaaaacttcacaataccgaaatttcgaagcaaaatttc atggatttccgataccgaaacaatttcagaattccgaaataccgaagaaa aaagggtcgatttccgaaactccgaaataccgtacgcctcCCACACAAAG CTCAAACTATCTTATCGGGAGATTAATGAGAAAAATCcaaatgtttattt ttgtacTTATTTTATACATAAATATTCAATCATCTTCAAATATAACagtt aaaattggtaaaattcaaactttatacaaaataaatctttttaaagtttt tttattgtaaatctATACTGTGAATAAGGAACTGCGTCTTTATACACACT CGCTTCCGAgcctttttcagaaattttgtcctcttgaaattttatcaaaa gttttattttcagAGGCTCCTTTTGCCTGAGTTCTGTTTCGAATTCCTTC ACATTGTATACCAATCGAAGCAGAATTTCATGTAGATTGCAAAAATGTAT TAAAGAAGCAAGCAAACGTTTCTCTATTAAAAGAACATCAGGCGTACAAA CTTCCACGAgtagaaacttttgattttcACGAATTTAGGCCCTTTCcgca aaagtaaatgtctttaaaaattctaggaagggccattcgcgaaagtttat ggtCGCGAAAATTTcgtgacaaaatagaaaatctgtaaaacttcaaactt tgaatcaAATGTAGCTTATATGGCACTTATTAGCCCGTTAAAAGACTATG TAATAAGTCaaaggaaaaatgtttcaagccaatccataAATTATTTGtct ctctaagccattttttcatgtgaaaattcgcaattttacgtcttgattcg cgaaagtttatgctggcaaaaaaatatttttcctttaaatttgcgaaagt aaatgtcgtgaaaaaaaccagctggcacacaacgttgtttcgacgttttt ctaacgttcacaacgtccatataacgttaaaaaaacgttgaaacaacgtt gtgtgccagctgggaaagtaATGGCTCTTTGAAGTATTGCTTTGACCCCT CTACCTACGAGAAACTCGTGGTTGGCAGCGAATTTGTTAAAATACTATTT CAATCTGAAGAATAGTCGAGTCTGGGTTGAATCTCATACACAATTCATCC AATAATTGATCATATATTTTCGATAATATCATCCAATTATGAAATATTCC AAAGGTACCATTTACATCTGTTCTTGTCGGCCCTTTTTACAGCTTCAAGG CATCATTGTGTTTATCAAGAGCTTTAAGTTTATCAAAATCACCACCAAAG TCTATGGCACAACGTTTGCCGAAGTAAGGAAAATTCTGGCATGTAGGACA ATCTGGATTCGTGCAATCTCCATCACCGGTGCATATATGATAACAATTTG CAGACTCACTCGCTGGTCGCGCATTAGTTAATTCTACCATTATCAAAACA ATTGTAAAAAGAACAATTGTTTTCGCCATGTTTCTTGATAGTGATTTATA GTTGCTCttctttataataatttttgtttttcactaCTGAGCAAGTTTTT GTTACACCCACAAGCTATGTACTAACTTCAAGCTTTTGAATGATCTTTCA ACCTTAGCCCTCGCTTGTCGTATTTATAACATTATGATAATCGCCTTGAA TAattacttttcaaaatcttaacaAAAATTTCCGGGCCGGTTATTTTGAA TCgaatattcattattttcttccTCCTTCATACCTAATgatagttttttt ataagaacaaactatataagaacataaggcttagatggccaaaatactaa gaacaagcTAATAACTTTTTAAGGGCCTTTTAAGGCTTTCAGGACTCTAA AACCCGCGATTTCGACAAAATTActctcaaaatggtgaaattaaaaacat tttaggcttaaaactcaaaaaactaagaacatccaaaggctgcaaaaagt tttggatgttcttatagaaaaacaacgtgtattgaCAGTTTTTTTTCGTG TTgtcatttcttttgttatttttcattttctatttttcaataGCCCTTTC CGCAAAGAATTGCAACAGAGAATGGAATTTcagctacatgtttttttttt aaataggaaCGCAAGCTTTTAATggcaaaaatatgaaaaacaagttaaga acatattttaaggctttgcggaccctAGAACACCTTATTTCTGTAGTCAC AAAATGGTAAAGATAAAAACTTGTTAATCtataaaggcttcaaaaatttt ggattttcttataaaaaacgtgtacgatatcaaattaaaaaataaaattt gaaatgcttaggtaatggttttatttttactgaCGACAAAGGATATCATT AAATCCTGAAGAAACAAGAAAGAGtgatttttttctatcaattaCTCCTT TGTTCATAAGGTAAGGATGCTTTTGGAAAATTCCAGAATGTTTCAGGTGT ccggaaaaaatgaagaaatacaaacaaaattttgataatgcACAATTATA gaaagtactctcgggtacctaatagctgggggggggcacaaattaatttt tggaaaatttcccaccgaggacattcttattccataTATGCACCCTATTT TCAGACACAATCAAGTTGAAACGATATCTCATAGCTACATCGTGTGGTGT ACACCCTTGGAATTCTCTCAAAGGTGTACAAAAACCATAAAACAGAATTG GAGTCTCTTAAAGGGTAACAAAATTATAATATTAAAAATCGACTCTCTCA AGAGTCATAAATTCTCGTAATTTggattaaagtttgaaaattttggttga aaattGAGGAAAAGGTCCCTCTAAGGAAcgtaaaaacatcaaaaaagggG CAAAGCTTTCGAAATCCAGTCTCTCAAggagtcgattttcaaactctGGC TTGGACGAATATAATAGCGTAgttcactctgtgcgcattgtctgtttgat aaaaattttcgtgcacggagacctctgcgatgaagtaaaAGGGATGGGTC TatgtccgaaaggacgaggaaaattcgagaaaaaaatcacGAATGCAATT TTCAAATTGCGCGAGTTATCGTGTGATTACAAGCTAATTGCATAATGGGT TTCGCTACTTTTTTCCGTTGCGGAAGAAGATTACGCAGACAGTATTTTTT CTCTACtctatgtttttctttcattgttgttcatagtttttcgtagtttt tctttctcgcaaaatgaatttcaaatgaaaaaaacgaaagaaaaaacatt aaaccctattttgtaaacattggcgcgtcattgaagagtgtgattaacga ttaattgctctctacagatACAATTAACAATTAACTGATCTCTTTGAAGG GGCgccaaatgagaaaaaatagcccatcgtgcgattaattAGAATAATTC GAAGGCAACTACGGCACAGGCTCCATATAGCTATTGATCTATATTATATT TTCGATTTATCCGCTATTATTGTATTCTTGATATgtgtaagtcatttttc tagcggaaacaccctaaaaaaccgggatttgacctctctctgttactaaa aatagaaacacggagctcaaaaaccggcttttttgggtgcttctgtTAAA AAATacgacgtcatcttgacttgacgcatatcaagaataccGGTAGGTAa gaacagccattgaataatttttgatataccatggctattattGTACCACG Gtagaattcttttttcaaattttgctttcaaaggttgatttttttgtcgc tcttgttgttatcaaagattaaaataaatctattgtcaatttcatgaaca aattttattaatcaaagtaaataaaagaaaatcattaaaaaagaaaaaca ttcgaacgttcgattatgggagtgttttaagtgaaacgttttaatctttt gtttttgcctctaggtacataataaaacatatattcaataggttttcatt ggttattggatttattatccctcggtgatgtatattcaactcggcttcgT CTGTCGTTGAATATTACATTACCTCGGATTAAtgaatctcaataaccaac ttttacccattgaatatctgcttaatatccATCCAATCAGTATTGTATCT ATCTATCAAATAAtcatatatttttataatgttGTAATGGCGATGTGTTT ACTTTCCTTTATCATccacatgaaaaatatgagcaatctgattggctaaa aaggcgtacataaatgctgtatttcaatttcatattgtaccgtacaaata caagaccACGTTCAAAAAAAGGATCTGGTAAAGCGAGAGATAATATTTTG TAACAATTTTATGATTAGAAAGGTTTTCTCTTTGTTTCCCGGCGGGGGGG GGGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNcagctaaatccaatttcttgac tcttgaaagcctatcctaacaagcttcccaaaatttaagaaaactcGGGT TTAGGGGCCTGACCTCAAAATCGATTATAAAGATGTGCCTCCGATTCATA CTTCGTTTTTCATATGTTgtttttgactcgttgtcggacaaaattgttgt cgaaatactgacgcattcgtcaaatccaacgtcggacatttttactgtcg gactagaaagggTCGGACTACTGACGCCCTCccctcaaggtaaatgacct accagacgttcggcccttaagggcaggtttttcatagttcagctagggca ctgtaagggtaggaaattacaaaactgcactgaactgcactgtaagggca ggaaattgtgataaaagcccaattttttggtaaaattggcacaaaattgg gcaattttggaggaagaattccacattttcttggaaaattgcaaagattt tcgcccttacgggcgagaaatttttaacaaaagcACAGTAAGGACGCCtt actgcactgtaagggtaggaaattgtgataaaagcccaattttttggtaa aattggcacaaaattggtcaattttggaggaagaattccacattttcttg gaaaattgcaaagattttcgcccttacgggcgagaaattttgaacaaGTG CACAGTAAGGAtgattcactgcactgtaagggtccgattttagaagccaa attttgggccgaacgtatggtcgttttcagatcgaatGCCCCCGGGCTTT GTTTCCAATACACACCAACTTATCAACAACTTATCAAAAGAGTctatgaa aacaatgttttgatctttttaatgaccattcgattcttttttcgaatgtt tgatgttgatttcatgtaaataaaagtaaaagaaaagaatattggaaaga aaagcaaaacaaatagacaggcagctgaggtcacaaaaaaattggacggg gtGCGAACAATCCAAAActacttttaattgaaaatcctaaatatctagaa accatcaaccggagttgttgaaattaattaccggacgtgtccggtaatat tttagagcctgatgacgtcatgcgtgcccagaagacttttaagtggatat atatGATTTCTCAACCTAATTCGAGAAAATCGATCTtaaagaaagtgtaa atatgacgtcatcaaaacttcggaagcttttaactttttatcatCAAATC TTTAGACATAgttactgacctttttcttaatctacgtcaaaaaacgcgtc gattggtatataatatgtctatactttttttcataaaaattttcaatttc cttgtgacgtcatcaaatacgaaaatattttcggacgcgtctggtaatta ttttcaaactgtccggttgatgattttgtgttcagaaaggtcatatctat tgaaaacaactgtttaaagtttgctcgcaaactttgtagctactgcactt ttttagttgacctcagctgcctgactaAAAGAAAAGGAAACACAAATGTa ctaacgcactttgtaataccaaAAGATGACTCACTTTGTAATAACACCTG AGGCACTTTGTAATACAAAAAAAgctgacgcactttgtaataacatctga cacactttgtaataataTAGAgaattttaaacgttttttacgACCTGATG ATGTCATCCATTTTGCCACCACTTAAAAAAAGGGACTCCTCCTCTAACTT TTTTACCACTTTaatggggggggggcgtacggagTTCACGATTTATACCG Aatagttttgccaaaatttccgaaattccgtaaaaaaatacttgcaattc tgataccaattttttgggtatttttcctctttttgactaatttttcatca aattttgtaCGGAGGGTACCCATATCAGGTaacatttctttcaaaaatcg gATTATCGGGGAGACATTTCGGAAATATCGGAAAAACTATTTTCTCTTAA TTGACAACAGTTATACATTTTTCTCCGAAATCGCATAATCGGGGGAACTT TTTTCCAAGTTgggaaaaataaggaaattattatttttaatcatttttga cGAAATTGGTTAATCGGTGAGACATTTTTTCTGAAATCAAAAAATCGAGG ATACTTTTTTCCAAATTCTATAAGAATTGCTCAAAAGTTTGAtaaaagtt tgttgatatttttcaagttgatgataaaccagttatcTGTACACTTTTAC TCGTACAAATAATAGGATATATAAAGGCTCGaaaaatatgacgaaaaatc tgaactcgaaaagtatatcccatattgtactcggtACCATGTCTCCGTGT AATAACTGTTACATATACAGAATACATTAAAATTTCCCATTATTTTCCGG ATTGTAATTGTTCTGTATAGtctaaagaagaaaacaaaaacaagtaGTGC ATTAACATTTGTCGTAATGTTGTCTGCTTTTTGAAATGCTATATTTTTTC TGTAAGGACTATCTTTGAACAGATCCTACTCTCAGATAAGATCTGTTCCT ATGAGATGAGGAAATACCTCGATTTATCCGTTTATCTATCCAATCAGTAT TGTATCTATCAAATAATCATATATTTTTGTAATGGTTGTGTGTTTACTTT CCTATATACAGGATACGCATTAAGATTCCTATTATTTTCCGGATTGTAAC TGTTCCGAGtctaaagaagaaaacaaaaacaagtgCATTAAGATTTGTCG TAATGTTGTCTGCTTTTTGAAATGCTATATTTTTTCTGTAAGAACTATCT TTGTCTTTATCCTACTCTCAGATAAGATATGTTCCTATGAAATGAGGAAA TACCTCGATTTATCCGTTTATCAATCCAATCAGTATTGTATCTATCAAAT AATCATATATTTTTGTAATGACGATGTGTTTACTTTCCTATATACAGGAT ACGCATTAAAATTCCTATTATTTTCCGGATTGTAATTGTTCCGAGtctaa agaagaaaacaaaaacaagtgTATTAAGATTTGTCGTAATGTTGTCTTGC TTTTTGAAATGCTATGTTTTTCTGTAAGGACTATCTTTGAACAGATCTTG CTCACGATAAGATCTTATTTCTTCTTTTCTCACCCATTTTTTttacccct aaattgcttgaaattgattAATTTTAGGCTCAACATTGTtcctaaattgt tcttattttttggagattttgagcctctttgttcttataaaaaattgttc ttaattgttaATGTCTTAAACtattgtttttattatcaattttttcCCAA GagcattttattaattttttttcattcgtAACGGTTTGCAATTTCTAGCA TAGTGTATACATCTTATGagagaaaattttatttgtagTATAGTATATCT GATGATCGCACAAGGCGTGAAACTGACAGTAATATATGGATTTTAAATCT TAACAAATTAAAATATatgtaaaattgttcttataaaattgttcttatag aaaataagTGTAGGCTTCTTAAAAAATCATACTGTTCTGCTAAAATGAAT TAACGAGATGTATGATGAAGTTGAGGCTGTAACAATCGGATGGGCGATTG GAGATGAAAAAGGAATATTGTAAAAAATCGGAGGAAACTTCGTAACATAA TTTCTGACGGATGTTTCGGAAGTTTAGATNAGGAATATTGTAAAAAATCG GAGGAAACTTCGTAATATAATATCTGACGGATGTTTCGGAAGTTTAGATG GTGGAATTTTTACAAGcatttatttgatttggttggtcgttaacctgtaa taaaacaattttgttactttttctaaagaacgcgtcatctctgttacttt taatgaccaattaatgaagtatcttataaaaactccagaacaCCCCGAAA GTTTAGATGGTAGAATTCTCTTGTTCTGGtttagacggtttgacggaata TAACGATCAAACTGACACATCTACGGAATCGGGTATGCCCTTAAATCCCA TTCTGATTAAGATAAAACCACTCCTGCAAATATTAGAGGCAAGTTAAGAG GCCAAGTTAGTTTCTTACATCAGAGGCATGtgttatttttgtaaacaaaa gaaaCTTAATAATAACTCATTTGTTAGTGGTTAATGAGAGAGTTAGCCTT TAATTGGATGTTTAATAGCTTCCTTTCTTAATTTCTTGAGAACAAGTTTT CTTGATAACTTGTAATACATTGTTTTGCATACATGGTCATGACCACGATT GAATGCTGCTTTTCCTGATATTCAATAATCGAACGAAGATTTAATCGAAT TGGCtttatttttggatttgaaatCTTGGTGAAAACGCATCAATACTTCT TTGCAAACCTACTTTTTTTAACTCAGAAACTGATAAGATTCAAAGGTTCA GTGCCTTTTATAGACTTTTCAGCACAAAGTGAAGACCTCTCCTTAGCAAA ACCAAACATATTATTGAAGACAAGAAAGAAATACTTTAAAACAaacaagt tttttctttcaaaagggaTTGACCAATATGAAGGATATGAAAGTAACGTT TATGTTTCTGGTAATGTTTGTGGTAACGATGGTCCATATCTTCTCCAAAA CCTATGTTGAAGAATTCCGTCTATCTGTCCGTCTGTCTACTAAATCTGTC ACCAATATCACATTGCCATCAGATGAAGATGTTGTACAGACCATCATGAA TTTGAAAAAGCTGAAATCAATGTCTGGACGTTTGGAAATCGAAACATCAA AACAGATCAATGTACTGGATAAGAAAGCAAGTGTTTTCATGAAGATCGAT TCAAAATTGGGCGATTATACTCCGAACAGTGATACACAGATCTCCTGCGC CAGTGACAAAACTGTTAAACTTTTAGTTTTAGTACAAACACCTTATAAAG ATATCACTAGAAGGATGATTATTCGGGAAGCTTGGAAGCAACAAATGGAC CATGATTCGAACCGTTTGAATTGGAAAATGGTATTTGTTGTCAGTTCGCC AGATCAGGGatgggaagaaaaaaatttctttcgtACTGAGATGAAATTCA AAAGAGATATGCTACTTGTTGAACGTCCAGAACGCCAAAGCGAGTCTGCT AAGAAGCTTTATTCTGCACTCCGCTGGTCGGCTAATGGATGCAAATTTGA ATATTTGTTAATGACAGATTCTAACACAAAGCTGAATTTCAAAGCTATCT ACAACATCATGCATTCACCAAACATGACTAAAGGAAACCTTGTAATGGGG CACAAACTAACTGAAAAATCATCCATAACTTTTCGTCCAGTCAAAACCTC AATCACCAAAACTGAATTGATTTCAAGATTCTCCAGCACTCAATTCCTAA TGTCCAGGGATGTTTTGACCAAAGTCCTCCACCTTTTGAGATGGTATTCT ACCCATGGACGTGTCCAGCAACCAATGGCCATGCTAGCTCTGGCAATGAA AGATCGGCTTATATCTCCACTGGAGTATAAACATTTCTTGACCAAACTGC CTAATGATTGCAAAGTCACAATCGAAAAAACATTGTTGATGCAAACACAC AATGACGATTGTTTTAGAAACCCTTTGATGAAGTAGTGTCACCACACCAC ACTGGCACGCAATGTTATTTTAATaatcatctaacgttatatggacgttg tgaacattataTAAACGTTTAAAGAGCATAGATTATTTTAAGAATGTGAA TATTTTAGTGTAATTTGTTATTATTTATCCAAATCATGTTGGtattaaat caaaaaataaggCTTTACAGGAACGCTGTAAGGGCTCCAAACATATTTTC CCGGGTACCTATTAACCAATCCCCCCGGTtgataaatgtttttaaaaaat tttccttttactTTTTCAGCTGgtaaacaacgttgtttcaacgttcattt aacgttttatggacgttgtgaacgttagataaacgttgaaacaacgttgt gtgccagctggggtagGATCATTTCCCgacttttatataattttaacaAT TTCCACACACCCGCTTGTTCCAGACCCCCAGCTCAGGTGCCCACAAACAC ACCTGTCTCAAAGCCCCGGGGGAACTTTTtctctcagtggggataaaaat tcctaataaaatcccaatgggaatagaaattcctttgttccaaggttaaa agatttagtgggaatggttttaaagtccaatttttaaacattaaatttcg aatgggacgaaaaaaaaattaatttccaagtggggccatagtggggctga aattctaacGTATTTCTGTCAATCTTTCCAGTGTGGCTGggctcccagcg ggtctgtgacacaggggtcaTCGGCATTTCCTTTGTCGAATGTTGCACAG ATTTTCCATGAAATGGCTTTATTGATTCGAAATGAGGATAcattttcaag ccaaaaagGAATATTTACTTCTTTCACtttgtaatttgattttaatattt ttgaataattttataTGACGAAGAATGTaatgcaatgtttttgtttttaa attgcaattatttttattttgtaaaaaagaaaaacttaagcATTTGAGAA AATATACAACAATTAGTGTATGCTAAATGAAAAATG

Coding sequence (CDS) from alignment at scaffold_89:135088..150573+

>TCONS_00073251 ID=TCONS_00073251|Name=TCONS_00073251|organism=Clytia hemisphaerica|type=CDS|length=1059bp|location=Sequence derived from alignment at scaffold_89:135088..150573+ (Clytia hemisphaerica)
ATGAAGGATATGAAAGTAACGTTTATGTTTCTGGTAATGTTTGTGGTAAC
GATGGTCCATATCTTCTCCAAAACCTATGTTGAAGAATTCCGTCTATCTG
TCCGTCTGTCTACTAAATCTGTCACCAATATCACATTGCCATCAGATGAA
GATGTTGTACAGACCATCATGAATTTGAAAAAGCTGAAATCAATGTCTGG
ACGTTTGGAAATCGAAACATCAAAACAGATCAATGTACTGGATAAGAAAG
CAAGTGTTTTCATGAAGATCGATTCAAAATTGGGCGATTATACTCCGAAC
AGTGATACACAGATCTCCTGCGCCAGTGACAAAACTGTTAAACTTTTAGT
TTTAGTACAAACACCTTATAAAGATATCACTAGAAGGATGATTATTCGGG
AAGCTTGGAAGCAACAAATGGACCATGATTCGAACCGTTTGAATTGGAAA
ATGGTATTTGTTGTCAGTTCGCCAGATCAGGGatgggaagaaaaaaattt
ctttcgtACTGAGATGAAATTCAAAAGAGATATGCTACTTGTTGAACGTC
CAGAACGCCAAAGCGAGTCTGCTAAGAAGCTTTATTCTGCACTCCGCTGG
TCGGCTAATGGATGCAAATTTGAATATTTGTTAATGACAGATTCTAACAC
AAAGCTGAATTTCAAAGCTATCTACAACATCATGCATTCACCAAACATGA
CTAAAGGAAACCTTGTAATGGGGCACAAACTAACTGAAAAATCATCCATA
ACTTTTCGTCCAGTCAAAACCTCAATCACCAAAACTGAATTGATTTCAAG
ATTCTCCAGCACTCAATTCCTAATGTCCAGGGATGTTTTGACCAAAGTCC
TCCACCTTTTGAGATGGTATTCTACCCATGGACGTGTCCAGCAACCAATG
GCCATGCTAGCTCTGGCAATGAAAGATCGGCTTATATCTCCACTGGAGTA
TAAACATTTCTTGACCAAACTGCCTAATGATTGCAAAGTCACAATCGAAA
AAACATTGTTGATGCAAACACACAATGACGATTGTTTTAGAAACCCTTTG
ATGAAGTAG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_045444XLOC_045444Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073251-proteinTCONS_00073251-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073251-exon-scaffold_89-1491911889:135088..135123TCONS_00073251-exon-scaffold_89-1491911889:135088..135123Clytia hemisphaericaexon
TCONS_00073251-exon-scaffold_89-1510915933:135088..135123TCONS_00073251-exon-scaffold_89-1510915933:135088..135123Clytia hemisphaericaexon
TCONS_00073251-exon-scaffold_89-1575043694:135088..135123TCONS_00073251-exon-scaffold_89-1575043694:135088..135123Clytia hemisphaericaexon
TCONS_00073251-exon-scaffold_89-1491911889:148503..150573TCONS_00073251-exon-scaffold_89-1491911889:148503..150573Clytia hemisphaericaexon
TCONS_00073251-exon-scaffold_89-1510915933:148503..150573TCONS_00073251-exon-scaffold_89-1510915933:148503..150573Clytia hemisphaericaexon
TCONS_00073251-exon-scaffold_89-1575043694:148503..150573TCONS_00073251-exon-scaffold_89-1575043694:148503..150573Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_89supercontigscaffold_89:135088..150573 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0.0775059 0 0 0 0 0 1.50388 2.15135 1.11712 1.13768 0.735072 1.33431 2.711 3.56835 3.98693 2.15868 0.0522348 0.260988 0.179015 0.00599925 0.0877092 0.0548591 0.19887 0.190651 0.102511 0.158973 0 0.0732562 0.118222 0.138832
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR002659Glyco_trans_31
Vocabulary: Cellular Component
TermDefinition
GO:0016020membrane
Vocabulary: Molecular Function
TermDefinition
GO:0008378galactosyltransferase activity
Vocabulary: Biological Process
TermDefinition
GO:0006486protein glycosylation
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0006486 protein glycosylation
cellular_component GO:0016020 membrane
molecular_function GO:0008378 galactosyltransferase activity
Blast
The following BLAST results are available for this feature:
BLAST of TCONS_00073251 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 0
Match NameE-valueIdentityDescription
back to top