TCONS_00073193 (transcript) - C. hemisphaerica

Overview
NameTCONS_00073193
Unique NameTCONS_00073193
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length9708

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00073193 ID=TCONS_00073193|Name=TCONS_00073193|organism=Clytia hemisphaerica|type=transcript|length=9708bp
gagagtttccatcgaaaaaagtggaatctaagaggtgtatcacgaaaatc
attttctagccacttttttcgacctcagccgcgcgactaaaaGATCGAAA
GGAAACCAACTCCCGCAACAGCGCCCGGCTTTGTAATTGCGGACCTCTGT
GGAGTAAGTTTAGAACAGTTTTAGGTCAGCAAATTACACGCCATGCCAat
acagcgagcggcagcgaaCATAAACACacatcactttcgttttcagtttc
TTGCATAACGTGTCCCACGACCAGACGACTGATCCATTTCCCTGGAGTTT
GACACTTGAGATAACGAGACAATCACAACCATTGCAGTTTCAGCAACATT
ACAGTAAAGGTATTTCTTTCTACAGCATGTTTCTGTCCATTTCAAGAGCA
ATACGGCCATTGTCAGGTGCATCTACTCGACTTCTGAGACAACAAATTTT
ACCATCTTCTTTCATTGCTGCCCAAAATGCTGGCTCTGTACGCTGTCTAA
CAGCTTCCTCTATCAGAAATGATGACAAAAAAGATGATGCAGGCAatcca
ttttcagttgatgacatGTTTTTAAGCTCATCAAAGAAAGatcttgagca
ttttgatgtgcCAGACCCTGTTGTTGTCCATGAAAATAAGACTCCCGAAC
ATTTGAATGAGAATGAAATTATATTAAACAGTGCTTCTGAAAGTAACATA
GAAGATTTCAATGTCCCTGACCCAATTTCTGAAGTCAAAGAGTCTTTAAA
TGAGGATGAAATGATTTTAAACAGCACTTCAAATGAAATTGAAGAGAATG
AGGAATACATGAATGATGATGATATTTCTGCTGAAATCCTCAACGTTGCC
CTTGAATTTGTTTCAACTCATGGCTGGACACAAAAGTCCATTGATGCAGC
TGTGGAAGCATTAGAATTATCAATGAGCACAGCTGGTATGTTTAAACGGG
GACCAGCAGAATTGGTTTTACATTTCATTGAAACCTCAAATGCTAAGCTA
TTTGAAATATTAGCAAAAGAATCGAAAAGATTTGATGAAAACAAAGGAGT
ATCAACAGCCAATTTCATTGAGAATGCTGTGAAAGAGCGCTTGAAAATGA
TCATTCCTTACATGGATTCTTGGCCACAAGCTCTTGCTTTAATGGCATCA
CCATCAATGGCTGCTGAAGTTTTAGAACAGGGAGCAAACATGGTTGATGA
AATCTGGTACCATGCTGGTGATATGTCATCAGACATGAGCTGGTATAGCA
AACGTGCAGCTGTAGCTGCTTTACACCTTTCAACAGAATTATACATGTTG
CAGGACAAGTCAGCAAACTTTGAGGATACTTGGGATTTTCTTCATAGAAG
AGTCAAGGATATTGAAACAGCTGCCACAGCCAAAGATTCTGTTGATCATG
CTCTGCAAGATGCAATGAGTTTGGTTGGATCTGGTNTTTTAGAACAGGGA
GCAAACATGGTTGATGAAATCTGGTACCATGCTGGTGATATGTCATCAGA
CATGAGCTGGTATAGCAAACGTGCAGCTGTAGCTGCTTTACACCTTTCAA
CAGAATTACACATGTTGCAGGACAAGTCAGCAAACTTTGAGGATACTTGG
GATTTTCTTCATAGAAGAGTCAAGGATATTGAAACAGCTGCCACAGCCAA
AGATTCTGTTGATCATGCTCTGCAAGATGCAATGAGTTTGGTTGGAGCTG
GTATAACAACAATCCAAAACCTACTCGGTGTCAATAATCGTATTCGTTGA
ACATGGTATTCTAATTTAAACTGAAGTTGAACGTGGAGAAGAATGTACTC
TTGCAAGTTCATTCAGATATGGATGAACTTGTATCTTTGTCTCTTTATGT
GATTTAATTTTATGTATGTCACGTCGtgtatgtttatttttcttactttt
tgtaATTATGATGTAGATAAGTATATCAGATTTCTAaaataatttgtgtt
tttcttttACTCTAGGTTCAATAAGGCATGCAATAAAGCTTAGTACTCAC
ATGTTTAAAAAAGTGGCGTCTAATGTAAGTGGCATATGCAACCTTTATAG
CAAAGATTGATAGGAAAAGAAGGAAATCTAATGTTTAAAAGACCTGCAGC
TAGTGCTAAACGCCACTTTTTTAAATaagtgagtaccaagcttaaAGGGG
AAAGGAAAAGATGCTTATTGATGAGAAAGCTTTGCAGACCTAGCCTATCT
AGTGAAATTTACTCCAATTTTGTCACATtgtagttcccaccaaaatgtTC
TGTAAACTTCAATTTATGTTTGAAACTATCCCAGGTTGCAAAAAGCTGTT
TACTTTTCCGTCTTATTGTGTATGCTATCCACTTTATGAATTTATTATGT
TTGTATATTTCGTTCAAGGTATTTAAAAGTaaacaagaaaaattacaaaa
tcccGAGAAGATTCAATattatcaaaacaatggaaGAAAATGAGCAAATA
TTGTATGATTTGATTGTTCACGAAGAATGGAAACAAGAACCACAGTTGTT
GGACCAAGTTGAAAGTTATTTTTGGCAATATCGTGGTTCACTTCTAAAGA
AGCTATGGAAAGTTTCACAAAGTTCTGCAATTTATATGTGGGACAACTTG
AAGACACAATTCAGATATCAAGCTACCTTTGGTTGCCCACCATTGAATTT
TATCAATCTGATGAACAATTGCTTGCCATGGCTTATGGCTTTGTCACCGG
ATGGAAATTTTATTGCCATCCTTCAAGATTCTGTTATTGAAATAAGGACT
GCTGGAAATTTTGAGCAAGTCATTACAAAATATAAGATTGAAAAAGATAT
GTTTCCAAGATGGCGTAAATTGATTTGGAATCATGACAACACCTTACTTT
GTTATTCAAACAGTTTTGGAGATTTGACCATTTTGGATATTACCGGCact
aaaaaacattttattccaTCATCAAATAATGTCAAGTTAAAAGTGCCTGG
AACGCTGAGTTTGGCATTGTGTCATGTTGAATTTGTAGCCAAAGGAAATa
gCTTCTTGTTATATACCTGCACCTATCAAGGATTTTTTACAGTTTATGAA
GTGAATGAATCCTCCTGCACAATAAAATGGGACTACTCTTTCATAACATT
CCATCCATATGGATTAGCTGGTTTGGTTATTGATCATAAAAATGGGTTAT
TGGTTGCAGCTGGGAATTATGGGAAGGAACCATTTCCTAATGTCATGGGA
GATGCATGTTATGGATCATATTCTGGTATCAGTCTCTGGAGATTTTTGAA
TGACACACCTCATCTAACTCTGGTTGAAGACCAGGGAAAAGCTTTGAAGA
AGGTATCCAGAGGTGAATGGTTAAAGAGTGTTGTTTTAAGACGTGGCGAT
GAAAAAAACGAAATGTTGAAGCATGGTATTTACAAGTTGAAATTGTCAGA
AGATGGTACACAAATTGTCACACTGCATCTTGATGGTCGCATATCTTTTT
GGAGTATCCCGTCAATGAGGCTAATCAAAACTTGGAGTAAATCTGAACAA
CCTGATGCAAGTGGCGGCTCAAGTGAAGGGTTCTCCTTTGACTCGCAGAA
AAAAGAAGaTCTCACCAAAACAAGGAATTCAATAGATGTCAGCTGGTGGT
CTGAAAAGGAGATTGCTTTGGCATCTGGGAGGGGTGATGTAACGATTGCT
TCGACTGACAGCTTGAAGAATTTACTTGGAGAGTCGAGTGAGAAATTTGA
TCCATGGCCGTCACTCAGCCAAGTGGTGGATGGAAGCATTCTTGTGCTCG
AGTGTGAGAAACGAGTGAACGATCCAAACAACAAAACGAAGACATCTTGG
AAATGGACTTCAGAAGAAGATGAAAGCCAAGATGAAGTGAACTCGATTCG
TTATCGATTCAAAGAACTCACTAAACAGATGTTATATTTCATCACTGAGG
CTGAAAGGTTTTTACCAGCTGTCAAGCCTCCAAGAATTTTAACCAACGTT
TATCGTTTACTATGCTTGAAATCTACAACACCCGAAGAATTATACACGCG
GAAAATCAATCTTGAACATTACGGAGAGGCCTTGGACCTAGCTAAACGTT
TTGGTTTGAATACTGATTTAGTTTATCAGCGACAGTGGAAAAAGAAAAGA
GTTTCGAAGATTACCATTCATGATTATCtgtcCAAGATTAAAGATCGATA
TTGGGTTTTGGACGAGTGCCTTTTACGAGTTGCCGATGACTTTGACTCGA
CAGAAGAGTTACTGAAATACGGTTTACTCGGTACAAGTTGGGAAATCTTG
CAAAGGATTGATGAAGAGGGTAAAGGTGatgcaaaggatgatgggaAGTT
ATTACCTTTTAAATTTGACGCCGCCCCACATGACGAGGATGACGAAAACT
CAAGTAGAGAATTCCAAgggagTCTAACGAAGAAGCAATTGAAAATCTGC
CAATATCGACGGCAATTATTACATTATCTTGATCGGCTTTCCACTTATGA
GGTTGTTTTGGGAGGCTCATTCAAAGCACGAGATAAATTCTCAAAAGAGT
ATTTTACCAAATTTCGATCGTGCAATATGGTACACCAAGCGGTCGAGTGT
GCCCGCGACGAGGACGCTTATACTCTGGAGCATTTGTTTTCGTACCATGG
GAAGCAGTTACTACCTTATTGGCTGCCGATATTATCAAACTTCCCGGAAA
CAACCGATATCCGATATTTTGAGCCGGTCATCCCTGAGATTGGAGAGCCA
CCAGAAGATCCAGAGATTTTACCTTGGTTAGAGAAACACCATCGTGAAGA
GGATTGGGTCGAGCAATCGAATATTGTCCAACAAATCAAGTCTAATGAAG
AAGGTGACGCAAACGAAGATATAGGCTCATTCATTTTCGAATCCGATCCA
GAGATacgaaaattttacaaatgtGAAACAAAAGCTCAACTGAGAGAATG
GTTTTTACATCGTGTACACTTGATTGATGAATATTCCGGTCAGATTGATA
AATGTTGCGAGCTGTTAGATGTGGGAATCAAAAGAGGCTTGGAAGGGCTC
ACTAAGGTTCACCAAGAAATGGAAGCATGGAGACTCTTAGTTTACGACGT
TGGAATTGACAGTAAAATGACTGCAAAGAGTTTCGTGGAATTATCTGAAT
CATCGAAAATCAAATTGCTAATGTTCAAAACCTCAGATGTGACATTCGTT
AACGATTTCAAGCTATATCTAATGCCGTATTTAAGAAATATTGGAAAGAA
GGATTTTAAGAAACGCCAAGATTTACTTCATGAGTTTTTGGTGGAAATCG
CTAAAACTGATTTGACATGCTGCTTGAAGTTATTGGAAAAGTGTTCGCCA
GAGCTGCCAGAACCACTGCTTCCTGATATGGCGGAGATAATGAAGATTGG
GATTGATTGCGTTTACGCGTGCAAGAGAACGGATCAATTGAATCATTGTT
TCAGCATTGTCGAATGTTTGCCTTCGAGAGAAGAGGGAGTCATTAGCCGT
CCCGTGGAAGAGCTTCACATACAACTGGATCAATTGGAACATTTGCTGAC
AGGAGCGGAAATTTTACAGTATTACAACAACCCTCAGACCATCTCTTACA
TTTCTGAAATTAAAGATGACTCTACTATTTGTAAACAACTCATTCAGCAA
TTGGTGAAAAACGCTGTTTGTAAAGGACGTTGTGTTCCAAAGGAATTGAA
CAAATTACTCGGACATTTGATCAAGCTTTCCAAAGAAGTTTTCCGGTGCT
GTGATATCAAGATCGTTCACCAGATTTTCGTTGAAGAATTACTACGGTCC
GGTTCACGTGAGAACATAACAGTAGCTGAAGAGTTGATCACGCCTTCCAA
ACTTGCCGGGAATTCACCTCAAAGTAAGAAACCAGAACAACATTTGACGT
CTGCACTCTACCTCCTCAAATATGATGTTTCGGTTACCGTTGTGTTGGAA
GCGAGTCGTGAATATTTCAATGCAGCAATGTCGGGTAATGACTCTTCAAT
GGAACTGGCTAGATTGTGTCTAACATTGGTCAAAGATTGTCCAGAGAGTG
TTCAAGATGAATTGGATTTGATCAACTCGTTGGGTTTATTGTATGAATTC
AATGTATCCATGCTACCCTTACAAGTTCGCCTTTGCGCTGATAAATTGGA
AATTATCGATCTTTGTTTGAAGGAGAAGAAGAATGGGTACAAGAAAAAAG
ACAAGCTCATCCAATTGAGTAATCTTTTGCAAATCTGTGGCCATGACAAC
AAAGAACGGATTGGACAAGTCAATATTAAAATTGCTGAATCAGCATTTGA
ACATAAAGATTACACATACGCTGGTATCGTTTGTGTACAATTGGTGGATG
ATAATTATTCTAATGCTTGGTATATTTGCAGGAAACTTGGTGAATGTGCT
AAATATACCAACTTCACAATCAGGCAAAAGTTGTTGAGTTTTGCGTTAAC
TTATTGTCCAGTACATCACATTGAAGAAGTTTTACAAGAGAAAACTCAAC
TGGAAACCCAGGTTTTGTACGAGAGGTTGGGTGTATTTACGAAAGAAGGC
AAGAAAGACAAAATTGTGACCTCATCTAAGAAAGAAACTGAGGAAGAAAA
CGACGAAGACAATGTTGATGGGAATAACATATCAATCCTCAACAAGACCA
AAACTACAACAAAGAAATTGATTTCAAGCGTCGCCAGCGTGGCTGATAAC
CGCTGGGTTGGATCCGCAATGAATTGGGTCAAACCGTCGTCGGAAGGGTC
TGGTAACGAAGTTGATGTTGTTGAGCGGGAAATTGAAAGCGTTCGGCATA
ACCCATTTTATAGTTCGCTGGATTCGAAAAAGATTGACGAAGATGTTCAA
AGATTTAATTATAACGAGTTCAGCGACCATTTGAGGTGCGTCACAACCGA
AGAAAAAGTATTCAATCAGCTGGTGTTAAGAAGTCAAAAATTGAACGAGC
AAAGAACCCTGGGTAAAGAGCTCGAAAACACTGACCAAGCAATGCTATCG
TTGAGTGATATAGCTTATACTGAAGAAAGTTGTTTGTGTCTGGCTTACAT
GATGGCTATTTCTCAGCCAAAAGAAATCCATTCCCTATCGACCAAGCATC
GGAAAAACACTTTCACTTTCCTTTTCACTGCTTATTACTATGCATTACAA
GAATAtgttaaaaacaacaaaatcgAATTCGATAAACAAGCACAGATTTA
CAGCGCGCCTCCGATTGATGTGATTACATGGATGCTAAAAGTGTTAGGTA
AGAAGCAAGgagaaaaggaagaaaaagaaaaaggagagACTTACTTTCTG
TCTAACATGAACAAGTTGCAAGACTTGATGCAAGCAAAGATGCTACAAGC
TCTTGACAAAGgaGTGGACATCGAAAGATTTTCAGTTGATAATGAATATA
AACGTGAAACTATACTCGGATTAGCTATGAGTGTCGAAGACGAGTTGATT
AACACAAGTTTGCTGCTAGCAGAGAAATATGATATCCCCGCATGGGAAGT
GTTGTTATCACACGTGGAATTTTTATTCACTGATAGTGGTCTAAAAGCCA
AAGCTATCCGCGAATCACTAAACAAATGGAAAGTTGATTCCCATTTGAAA
CCGAACGGTGATAAAGTCTTTGAGCGGATGAAGAAATATGTTTACCCAGA
AATCAATGGTAAAGACCACAATGCATTGCTGTTGTTCTACGTTTTCCTAA
TGAATTGCAGCTCGCCCACTAAAATATTGGAGGGTACGCTTACATTAGAT
GCTCATTCcaaacttttgaagaaaatcaaGGCTGCTGCATCATCCATCAA
TTACAAACTTCTCGTGCATGGAGATTCACCTTTGGAGGTGATTAGAGACT
GTGTTGATGATAACAATGTACATTTGTTGGCTAAAATTGCATCCAAAATC
CCCCAGGCGGATGGTAGTTACCTGTCATCAAACAAGATCTTCTTAGCAAA
CGCCATTCGGatgttttggaagaaaaaagaGAACAAGGATTGGTTGAATA
CATTCGAAAACTGTAAACAACACTTCACCAAACTCCTGATAGAAGACGTT
GTCACTTTTGCTGACCATGCAATTTTTGGCGAGGAAGCTTTAGACTCGCT
GACCCAAGACACCAGACTGGAGATTGGTAAAAGAGtaataaaatatttga
gacaacaACGTGGTCAAGACGAGACCAAACAAAGAGGAGCTGACGATTAT
GATTCGCTTATGGAGCGCTACGATTCATCTATCAATGATTTGGAACTTTC
CATCGAACATCTCAAAACGCTGACTGATCCAATTTTCAAAGCAGTCTTTG
GTGACGATAACGAACTGAGCAAAACCTTTGGACGAGTATACGACTTATCA
CGTGGTCGAAAACAACCACTCGAAAAACTATTCCGTGATTTGTTCATATC
GNTACAACCATTAGACAAAATTTCGAAACTGCGGAGTCTTTGTCGCAATG
CATCTATTGACGTCCGCACGTGTTTCCAAGATGCTTTGCGCGGGATCCTG
AGTGACATCCAAAGCGATAGAGATTACACAAAACTACAGACTTTAACGGA
GAACATCAAAGCGCATCAAGAACATCAAACAGACCCTCTTGTTACCCATA
GCGACGTCTTAGATGTGGTGCGGCCATTTTGTTCTGATGTTACAGCTAGC
ACGGATGTGAAGAGTCACGTGTTACATNTTTTGTTCTGATGTTACAGCTA
GCACGGATGTGAAAAGTCACGTGTTACACATATTGGAGAGTACAATTGAT
CTAACGGATGATGACGTCAGTTTATTATTATTCTACCAATCACAATCGAT
CATTGTTCCGGTCTGGAAAATAGAGGTTGAAGCGTCAGACGTAGAAACAA
ACGATAAGCGTTCAAAATTATTCGACAAACTTCTCACAAACACCACTACT
GATGAACACACTGAAGGCTTGGAAAAATTGCTTCGATCGTGGCCTGTATT
CAGTGATACGCCTGACGAAGAACATCCCTGGATTCGCCTAATTCTTAAGA
AAATTACACTCGAACATGATAGCAATATTATCGACATTTTGAATTACGCT
AAAGACACTATACCGTTTAATGAACAGGCTTACAATGTGGTATACGACAA
TCTCGtaagaaaacaacaaacaatACAATCCATGAAATGGATGTTATCAA
GTCAAACTGAAAAACTTCACAGCCGTTTGTTCAAAGATTTAATCGAAATA
AAGATCCCAGAAGACGAAAATTTGAAAGTCGATAAAGAACTATTAGAACT
GATctgcaaaacaaaaacattgcatcGCTTCGTTGAGGCTGCTATTTACC
CAGCACTGATAAACCTTATCGTATCACATCAAGAGTTTGTCAAGCCTGCG
ATCACTCATCTACGAAACAACGGCTATGAAGCAGAGGCTGGATATATATT
GATGAAAACTCGAGAaatgaattcttcttttttcacgttgaataatgctt
tagatattttgaattttagatttcGATAAATTTTTATAATGATCTATTTA
TTTACATTATAATATTTTTGGGCTTTCTGTTTTGAGGATTTATAATTGAT
GAATGAAGAACTAAAATTTCATATCGAGAACAGTGATTTGATCTAACAAA
CATTGAAGAGTTAGGTTCACTAGGATCCAAGCATCTCCTCTGATatgtat
cgtgtataaaattctcgTCTGAAAGTATCCCCCGTCCTTTTGTTTTTCAG
GTTCagaaatttgattaaattttaataaattgtatatgagagatctttaa
ttttcatt

protein sequence of TCONS_00073193-protein

>TCONS_00073193-protein ID=TCONS_00073193-protein|Name=TCONS_00073193-protein|organism=Clytia hemisphaerica|type=polypeptide|length=2069bp
MEENEQILYDLIVHEEWKQEPQLLDQVESYFWQYRGSLLKKLWKVSQSSA
IYMWDNLKTQFRYQATFGCPPLNFINLMNNCLPWLMALSPDGNFIAILQD
SVIEIRTAGNFEQVITKYKIEKDMFPRWRKLIWNHDNTLLCYSNSFGDLT
ILDITGTKKHFIPSSNNVKLKVPGTLSLALCHVEFVAKGNSFLLYTCTYQ
GFFTVYEVNESSCTIKWDYSFITFHPYGLAGLVIDHKNGLLVAAGNYGKE
PFPNVMGDACYGSYSGISLWRFLNDTPHLTLVEDQGKALKKVSRGEWLKS
VVLRRGDEKNEMLKHGIYKLKLSEDGTQIVTLHLDGRISFWSIPSMRLIK
TWSKSEQPDASGGSSEGFSFDSQKKEDLTKTRNSIDVSWWSEKEIALASG
RGDVTIASTDSLKNLLGESSEKFDPWPSLSQVVDGSILVLECEKRVNDPN
NKTKTSWKWTSEEDESQDEVNSIRYRFKELTKQMLYFITEAERFLPAVKP
PRILTNVYRLLCLKSTTPEELYTRKINLEHYGEALDLAKRFGLNTDLVYQ
RQWKKKRVSKITIHDYLSKIKDRYWVLDECLLRVADDFDSTEELLKYGLL
GTSWEILQRIDEEGKGDAKDDGKLLPFKFDAAPHDEDDENSSREFQGSLT
KKQLKICQYRRQLLHYLDRLSTYEVVLGGSFKARDKFSKEYFTKFRSCNM
VHQAVECARDEDAYTLEHLFSYHGKQLLPYWLPILSNFPETTDIRYFEPV
IPEIGEPPEDPEILPWLEKHHREEDWVEQSNIVQQIKSNEEGDANEDIGS
FIFESDPEIRKFYKCETKAQLREWFLHRVHLIDEYSGQIDKCCELLDVGI
KRGLEGLTKVHQEMEAWRLLVYDVGIDSKMTAKSFVELSESSKIKLLMFK
TSDVTFVNDFKLYLMPYLRNIGKKDFKKRQDLLHEFLVEIAKTDLTCCLK
LLEKCSPELPEPLLPDMAEIMKIGIDCVYACKRTDQLNHCFSIVECLPSR
EEGVISRPVEELHIQLDQLEHLLTGAEILQYYNNPQTISYISEIKDDSTI
CKQLIQQLVKNAVCKGRCVPKELNKLLGHLIKLSKEVFRCCDIKIVHQIF
VEELLRSGSRENITVAEELITPSKLAGNSPQSKKPEQHLTSALYLLKYDV
SVTVVLEASREYFNAAMSGNDSSMELARLCLTLVKDCPESVQDELDLINS
LGLLYEFNVSMLPLQVRLCADKLEIIDLCLKEKKNGYKKKDKLIQLSNLL
QICGHDNKERIGQVNIKIAESAFEHKDYTYAGIVCVQLVDDNYSNAWYIC
RKLGECAKYTNFTIRQKLLSFALTYCPVHHIEEVLQEKTQLETQVLYERL
GVFTKEGKKDKIVTSSKKETEEENDEDNVDGNNISILNKTKTTTKKLISS
VASVADNRWVGSAMNWVKPSSEGSGNEVDVVEREIESVRHNPFYSSLDSK
KIDEDVQRFNYNEFSDHLRCVTTEEKVFNQLVLRSQKLNEQRTLGKELEN
TDQAMLSLSDIAYTEESCLCLAYMMAISQPKEIHSLSTKHRKNTFTFLFT
AYYYALQEYVKNNKIEFDKQAQIYSAPPIDVITWMLKVLGKKQGEKEEKE
KGETYFLSNMNKLQDLMQAKMLQALDKGVDIERFSVDNEYKRETILGLAM
SVEDELINTSLLLAEKYDIPAWEVLLSHVEFLFTDSGLKAKAIRESLNKW
KVDSHLKPNGDKVFERMKKYVYPEINGKDHNALLLFYVFLMNCSSPTKIL
EGTLTLDAHSKLLKKIKAAASSINYKLLVHGDSPLEVIRDCVDDNNVHLL
AKIASKIPQADGSYLSSNKIFLANAIRMFWKKKENKDWLNTFENCKQHFT
KLLIEDVVTFADHAIFGEEALDSLTQDTRLEIGKRVIKYLRQQRGQDETK
QRGADDYDSLMERYDSSINDLELSIEHLKTLTDPIFKAVFGDDNELSKTF
GRVYDLSRGRKQPLEKLFRDLFISXQPLDKISKLRSLCRNASIDVRTCFQ
DALRGILSDIQSDRDYTKLQTLTENIKAHQEHQTDPLVTHSDVLDVVRPF
CSDVTASTDVKSHVLHXLF
Run BLAST on NCBI

transcript from alignment at scaffold_88:58872..146871+

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00073193 ID=TCONS_00073193|Name=TCONS_00073193|organism=Clytia hemisphaerica|type=transcript|length=88000bp|location=Sequence derived from alignment at scaffold_88:58872..146871+ (Clytia hemisphaerica)
gagagtttccatcgaaaaaagtggaatctaagaggtgtatcacgaaaatc attttctagccacttttttcgacctcagccgcgcgactaaaaGATCGAAA GGAAACCAACTCCCGCAACAGCGCCCGGCTTTGTAATTGCGGACCTCTGT GGAGTAAGTTTAGAACAGTTTTAGGTCAGCAAATTACACGCCATGCCAat acagcgagcggcagcgaaCATAAACACacatcactttcgttttcagtttc TTGCATAACGTGTCCCACGACCAGACGACTGATCCATTTCCCTGGAGTTT GACACTTGAGATAACGAGACAATCACAACCATTGCAGTTTCAGCAACATT ACAGTAAAGGTATTTCTTTCTACAGCATGTTTCTGTCCATTTCAAGAGCA ATACGGCCATTGTCAGGTGCATCTACTCGACTTCTGAGACAACAAATTTT ACCATCTTCTTTCATTGCTGCCCAAAATGCTGGCTCTGTACGCTGTCTAA CAGCTTCCTCTATCAGAAATGATGACAAAAAAGATGATGCAGGCAatcca ttttcagttgatgacatGTTTTTAAGCTCATCAAAGAAAGatcttgagca ttttgatgtgcCAGACCCTGTTGTTGTCCATGAAAATAAGACTCCCGAAC ATTTGAATGAGAATGAAATTATATTAAACAGTGCTTCTGAAAGTAACATA GAAGATTTCAATGTCCCTGACCCAATTTCTGAAGTCAAAGAGTCTTTAAA TGAGGATGAAATGATTTTAAACAGCACTTCAAATGAAATTGAAGAGAATG AGGAATACATGAATGATGATGATATTTCTGCTGAAATCCTCAACGTTGCC CTTGAATTTGTTTCAACTCATGGCTGGACACAAAAGTCCATTGATGCAGC TGTGGAAGCATTAGAATTATCAATGAGCACAGCTGGTATGTTTAAACGGG GACCAGCAGAATTGGTTTTACATTTCATTGAAACCTCAAATGCTAAGCTA TTTGAAATATTAGCAAAAGAATCGAAAAGATTTGATGAAAACAAAGGAGT ATCAACAGCCAATTTCATTGAGAATGCTGTGAAAGAGCGCTTGAAAATGA TCATTCCTTACATGGATTCTTGGCCACAAGCTCTTGCTTTAATGGCATCA CCATCAATGGCTGCTGAAGTTTTAGAACAGGGAGCAAACATGGTTGATGA AATCTGGTACCATGCTGGTGATATGTCATCAGACATGAGCTGGTATAGCA AACGTGCAGCTGTAGCTGCTTTACACCTTTCAACAGAATTATACATGTTG CAGGACAAGTCAGCAAACTTTGAGGATACTTGGGATTTTCTTCATAGAAG AGTCAAGGATATTGAAACAGCTGCCACAGCCAAAGATTCTGTTGATCATG CTCTGCAAGATGCAATGAGTTTGGTTGGATCTGGTNTTTTAGAACAGGGA GCAAACATGGTTGATGAAATCTGGTACCATGCTGGTGATATGTCATCAGA CATGAGCTGGTATAGCAAACGTGCAGCTGTAGCTGCTTTACACCTTTCAA CAGAATTACACATGTTGCAGGACAAGTCAGCAAACTTTGAGGATACTTGG GATTTTCTTCATAGAAGAGTCAAGGATATTGAAACAGCTGCCACAGCCAA AGATTCTGTTGATCATGCTCTGCAAGATGCAATGAGTTTGGTTGGAGCTG GTATAACAACAATCCAAAACCTACTCGGTGTCAATAATCGTATTCGTTGA ACATGGTATTCTAATTTAAACTGAAGTTGAACGTGGAGAAGAATGTACTC TTGCAAGTTCATTCAGATATGGATGAACTTGTATCTTTGTCTCTTTATGT GATTTAATTTTATGTATGTCACGTCGtgtatgtttatttttcttactttt tgtaATTATGATGTAGATAAGTATATCAGATTTCTAaaataatttgtgtt tttcttttACTCTAGGTTCAATAAGGCATGCAATAAAGCTTAGTACTCAC ATGTTTAAAAAAGTGGCGTCTAATGTAAGTGGCATATGCAACCTTTATAG CAAAGATTGATAGGAAAAGAAGGAAATCTAATGTTTAAAAGACCTGCAGC TAGTGCTAAACGCCACTTTTTTAAATaagtgagtaccaagcttaaAGGGG AAAGGAAAAGATGCTTATTGATGAGAAAGCTTTGCAGACCTAGCCTATCT AGTGAAATTTACTCCAATTTTGTCACATtgtagttcccaccaaaatgtTC TGTAAACTTCAATTTATGTTTGAAACTATCCCAGGTTGCAAAAAGCTGTT TACTTTTCCGTCTTATTGTGTATGCTATCCACTTTATGAATTTATTATGT TTGTATATTTCGTTCAAGGTATTTAAAAGTaaacaagaaaaattacaaaa tcccGAGAAGATTCAATattatcaaaacaatggaaGAAAATGAGCAAATA TTGTATGATTTGATTGTTCACGAAGAATGGAAACAAGAACCACAGTTGTT GGTAAGTGCAGCTTACTTATTTTCAGTTAATTAGAAATAGGCACAAGTTT GTAGTGactaaaatttttctctaattttatTTAATCCAGGACCAAGTTGA AAGTTATTTTTGGCAATATCGTGGTTCACTTCTAAAGAAGCTATGGAAAG TTTCACAAAGTAAGTGAAATTGGTaaaataccgggtgacccacgaaaaag ttcagacgtttctcgacgtcttgaggccgaacaaatgtcccaaagtgctt ggagtttagatatttagaaagNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAAAGATTTTG CACTCGTtctttttgcaatgttttttatttaattaggCCTGTACtctgtc aaaaaataaggataaagaaatttttgccgTTAGATCtcctttaaacaaaa attacttttaaaggtgttttattaattattaatgtcataaaactcgttaa ataagtcaatttgtaagtgattttctaattgattgcataaatttaatacc tcttttttacgtgtttttcactttctgaaaagtgaattttgactttaaaa gctcataagtagataACAATtcggtcaaatttaaaaagtgatagctcaaa ttttaagttaggatatctactttctaaatatcaaaactccaagcactttg ggacatttgttcggacTCAATGTCGgaaaacgtctgaactttttcgtggg tcacccggtacgaAAGTCAAGAAATTGATTTATTCAATAACGCAAATCCG CAGTTCTTTAAAGAAGGGGTGAAATTATACATACTAAATGGATCCATaac tattttttgttttatcaacATCAAATCTTTCATTCTAGGTTCTGCAATTT ATATGTGGGACAACTTGAAGACACAATTCAGGTATTTAGTTtacatattt ttcttattttttacttattatttcttttaatgtctttttaaaatcattcc TTGATGTcagtaaaattaatttttaaaatatcaaCTTCTAATAAAATGAA CAATGTCCAGGAtattttttctatcaattctTCTACTAGATATCAAGCTA CCTTTGGTTGCCCACCATTGAATTTTATCAATCTGATGAACAATTGCTTG CCATGGCTTATGGCTTTGTCACCGTAAGATACTATAACAAAGAtagtttt tctttgatttcttgaGCATTTTATTACATGATGCAAATCTTTATTTCTTT ACCGTTTTGTTATTTAATTGAAAACTGAGTCAAAAACATTGAGACTAACT CCTTTGGAAAACGAAACTTTGACTTTCCGAATTATTTTACATATATTATA TTACTACATTACTAGATTTTAAAGGCCGGGAAATGGTTAAAGATGGCTTT AGGAGATCTGTTTTAAGGCTCGTGTTTATAGTAAAGCATTAAAATCAGAT TATATTTACTTTTCAGGGATGGAAATTTTATTGCCATCCTTCAAGATTCT GTTATTGAAATAAGGTTAGTCCCCCTtctcttttttggacctacctccgg gtacccgatggaggtcctttaaattaacccatgtccgtccgtccgttcgt ctgttgccagcttttctcaggattggctcattagttttttctgatttttg gcataaAGATGCAAAATCGCAATGCATAAAATGTGACGGGGcccgatttt cagaaaaaaaatttaccggccgaaaataccggaaatatgccggaaaagct gtttttttggcattttctcgagattttatcattagttttttctgattttt tgctcaaagatgcgtattaacaatgcccaaaacatggccgagtccaatta aaaaaaaaaaattgccggtcgaaaatgccggaaattgctgtttttctgga ttttcattggatttttttcttataattggttgttttttcattcaaaaaca ttatcaatagcaatgcccaccatcaagcatgtttcaattttcaaaaattt tgttcattttcattCTTTTCATCATTTGATTGAAAGCAATGTTTTTGACC AAGCTTCCTTGAAAATTAAGGAATCGTTTTTAATGCCATCGCTTTgttaa tattttaatatttaacTGAAGGATACTTCTCAAGATAGAgatcctttctt tttttaacCACCAAAACTAATACAAGATTTTTTAACTGTGTAGTTTCTAG AAGTTCTTCTGAAGAAAAAGGAAGTTCTTCTTTTAAAGGAAGTTAAATCT TGTAAAGGAAAATGATATATTTGGTTACTTGCTTCATTTTAGGACTGCTG GAAATTTTGAGCAAGTCATTACAAAATATAAGAGTAAGTTcaagtctttt ttatatattatttctTTCTGACAAAGATgttgattttttgaattataAAC ATCACAATTCATTAAACAgtcttttaatgtttttaaaaacaagaaaaatt cgGATTACTTTTTTGGATGATTATCATGAATTTTGTCCTTTGCATATTTC AATCAAATTAATGCTTTGTACTCCTAAACCAAAAGCCTGTATAAAAATCA AACCCACAATCATGCCATGCGCAGAAATCTGCTGCACCATTGATCTCTGG GTCCATGTTAACTAGATGTTTTTTTCTACAGTTGAAAAAGATATGTTTCC AAGATGGCGTAAATTGATTTGGAATCATGACAACACCTTACTTTGTTATT CAAACAGGTTTTTAAATTTATCCTTTTCAACAATAATaacgaaaaaaatt tcatgtcaataTGACCTCTTGATAAAAAAGAATGGCTATGTCAGCCACAG CCATCCTTTTTTGGCTGATATTTTAAGAATCAGATGGAATTCTCCTGACT AattattgttatatttttgtAGCAAGAATAGAAATAACTGTACTACATAT TAGAGTTTCTTAACAGCCTTTCTAATTCAGATTTATTTTTGTCAGCAAAA AATTCTGGCATTTGTGTTGATTGCTGACACAAATTAGAATGGCTGCTCTT TCATTTTAGTTTTGGAGATTTGACCATTTTGGATATTACCGGCactaaaa aacattttattccaTCAGTGAGTTTATTGTttatttctttatctttttat ttaatgTACATTGATTTGAAGAtctaatattttgatattttgataaaCCT GACTAATAAAGGTGACTTTTTATTTCAGTCAAATAATGTCAAGTTAAAAG TGCCTGGAACGCTGAGTTTGGCATTGTGTCATGTTGAATTTGTAGCCAAA GGAAATaggtttgtttttatcttattttcaaGCTTATGTCAATTTCCTTC AATTTCACTTTAAAATTTAAGTACACGTTTCGTTTTGTTTCCTGTTTTTG TTTTACAAAATTGACAACAATATTTAGTAGAATTCATATCTGTGttatct tttgattttctttgattttctcaattttCCCAGATGTAATTTATTATATT TCACTTTTTAGCTTCTTGTTATATACCTGCACCTATCAAGGATTTTTTAC AGTTTATGAAGTGAAGTATATCTTTTTTAACCTTATATTTAATTTCTAAG AACAGGTCATTGCTTTACTGTTTTGAATTCTACCAATTCTACCAACTATA ATTTGTATTATGACTTATACTATGTGAATTCTTTTCATTGTCtcaacaat gttttcaatatgttttgaaaacagttctgcaattttgttgtttttaggcT GAGGTAAGAAAGCCCTTCAATGAAAATTGTTCACTTAGATCTCTCAATTA AGAACTTGAATGAAATTTTAGAATTCAGACAAAGTTTAACTATGGAAGTT CCTTCCATAACCAAAGGTGGTTAAAAACTTTGCAATTATTTATTGTTATA GTGAATCCTCCTGCACAATAAAATGGGACTACTCTTTCATAACATTCCAT CCATATGGATTAGCTGGTTTGGTTATTGATCATAAAAATGGGTTATTGGT TGCAGCTGGGAATTATGGGAAGGAACCATTTCCTAATGTCATGGGAGGTA TCGTGTACTTTAGACTCACTCACCTTTTTTTTAGATTCATTTCtccaaga atttcttttgaaacaaagaaaccaaaatttaCAACTTATATTTGTAATCc gaaacatttttttatgaaatttcacATAAAAATGTCAAGTGTTATTATGA AATTCTTGTATGTACCAAAATTCTGTctcatttcaaatttcattttttgc atcATTATTAAGAGTGTTTGTGGTTTTATTTCTCACTCAATTCCAATTTA GTGTAATTAATTAACGTAATCATTGTACAATAATTTAAAGGTAGCCCCAA AAACtgcaaaatttatttataattaTTACTCTAGATGCATGTTATGGATC ATATTCTGGTATCAGTCTCTGGAGATTTTTGAATGACACACCTCATCTAA CTCTGGTTGAAGACCAGGGAAAAGCTTTGAAGAAGGTAATTTCTGTTTTT GCATGTGAAAAAGGGCTTGTGTGTTGGACTGATACagctccttctcacag acccgatagGATTTTCTCagacagtggggataaaaataacggcaGATACT CGATGGGGATtcgggattgatattcccataattcttatggctggggattt catttttttgttttcaattcaaaaGATTCACTGGGAATGGGAAATAAAGC attatattttgcagtgaggattggtttatttgattattttcagtggggac aaaaactgGAGGACAATTTTCCACTGGGacaatattttggacaatttttc cactgggaagggttcccagtgggtctgtgagaagggggtgatAGTAGCAT TATTTGATATTGCCAGGTTGAGAACGCTTTTGTTTTAAGTTCTTTCTTTT GAATGGACTGCAGCATAATAAGCTATATAATAAGCTGTATTTTATATCTT CTTTATGTAACTTTTGAAACAGATCTTCGCTTTATTGTAGCATTGTATTA TGATGAGCCTCCTTTATGCTTATGACATGGCTTTGGTAGATTGTGTTTGC TTTCTGTCTGGACTTTGAAACATCCTACTCCTGATAGGACGTCTTCTTAA AGCAGTCGATCGGTTCATATCATaacatcttttttttaatgttccaGGTA TCCAGAGGTGAATGGTTAAAGAGTGTTGTTTTAAGACGTGGCGATGAAAA AAACGAAATGTTGAAGGTACCCTTTGTTTTCTTAATGCCTCTACCTTAGC TTTTTTACTGTGAGTTGTTGAAAGATTTTAAGTGTGGATTCATAcccgaa aaaataattttttttatattttattataacCAATTATAATCTCTCATCAC CCATACTTAAATCTAGGTCTATGGAAGACCAAGGTTGGAAATCTCTACCA AGTGACTTTAGCATCTAAATGAAGCCTTTTATTAAATGCTAATTATAAGA TTGTTATGGTAGTTCTTGTTTTTAAAAGGCCAAAAAGACCAAAAAGGCAC TTTTTCTGTTGTTATTTTTAAGAGAGGCAGTTTTTACCTCAAATTTAGAG ATTCCAAGAAAGTTAGGTATTTGATAATCAGATAATTGAAATGAAAGACA CAAAAATTGAATACGTTTAGGTGTTTTTACCCAGTGATATTCAAGTTATA AGTTTAGCCACACGTAGATCTTGTGATCCAAGCCACAATAATCTTCCTTT ATTAATATGCATTTAAGCTGGTATGTTGGTAAtcctttgaattttttatc ttctttatAGCATGGTATTTACAAGTTGAAATTGTCAGAAGATGGTACAC AAATTGTCACACTGCATCTTGATGGTCGCATATCTTTTTGGAGTATCCCG TCAATGAGGCTAATCAAAACTTGGAGTAAATCTGAACAAGTATTAGAAAC ATTTCATTCATAACGTTAACAATTCAGAATAGGTATCCCTGCAATaaact ttaaagatttttctacccaatatttcaattttccatAATTTAATTGACGT TTCAGGTAGAAACCTTTCTTACCGCTTTTGGATAAGgctaaaataaaaca taagatgGCTGGGTAAAATTTCTGTCTGTAAAAAACCTTTTACCAATAAT TTCCTTCGGATTTATGTTTTTGgcttattttaattttcaatttatttctt TTAGCCTGATGCAAGTGGCGGCTCAAGTGAAGGGTTCTCCTTTGACTCGC AGAAAAAAGAAGGTCCAATTCTCTCTAGATTTATGTTTTAAGAGAATAAC TGTTCAATTTACGTTGGATAATAATTTAATGTTTTAGAATTCCTTAATAT TAATCTAATCTTTtgacttaaaatcttaaaattgtataataataatattg gCAGAAATGTTGGTAGTCACAACTATAACTTTCGATACCAAGTAAAGCCA GTCATCACCAAAATCATCATGGTGTTTGTAGCAAACAAGTTAAAAATAgg tttttaaattcattttagaTCTCACCAAAACAAGGAATTCAATAGATGTC AGCTGGTGGTCTGAAAAGGTACTGTACATGAAGACACATGATTATGCAAC ACGTGTcacctctgatatgttttgatataggttTAGCTTATCGtctataa aattcccgtccgagagatAACCCCGTTTttgttttagaaacttgataaGT GCgattagtaagttttatattagagatctttcaatttcattaaaataaaa atttgaatggctagagatgataaataaataaataaatggatGGAATCGAA TGACAATTGGATTTCTgtagctttaaaaaaaaattgaaacaggttaACTC ttggacgggaattttatacacgtaatgcatcccctatatcaaaatcaatt ctgTGGATGTGCGCAGCCTAACACATAATCTGCTTGTATTTGATCAAAGA CAATTGGTTGTGGTATGCGCTCGACTATTCTGTCTGCTGCCAAAAAATGA TTCCTAGAAAAtctaatcaaaaaataattgatttgtAGCAAAAGTTTACT TTGAACCGAAGAATCGTCAGCAAAATAGTAATAGGTTTCTCTAAACTAAG TTTGGCCGGCCCTTTGTCTGGCCCAAATGTTTTTATCATTCATGACAAAT AAAGAATTATTTGTTAATACATTTTATTGTAGGAGATTGCTTTGGCATCT GGGAGGGGTGATGTAACGATTGCTTCGACTGACAGGTATTTAGTATTGAT GTTAGTGTggttaatatttcaaaatcatgAATCGAATCCTTTGGTCTATT AATATTCCACCTTATAGTAAGAGTTACTTGTATGACCACAAAAGCAATCT TCAAATCAAAGTTGATTGAGCCACCGACTTTTCAGTGGCCTTAAAATTGC CGTAATAATCTATAATGATCTTTGCTTGATCAATGCGTTACAGTTAGTAA AATGATATTTCACAGTATCGTAACAGTATCGTAGGAAGCATTTTTTAATA TTGAGCGGGGCTGAGGTTTAGTGCCATCGCAAGGGCCAATCAGCTCAAGG ggggaaatttgaaaagttcaagATGGCCTTTATATGCAAGCACTCCACTC TGCGGTATTTACGGTactgcttttttatttttagttgaaGGAATAGTAAT GTTGAATTGACTTTAAAACCAAATGTTTTTTCCCAATCTAAAATTTCATA TCTCCATTCCAGCTTGAAGAATTTACTTGGAGAGTCGAGTGAGAAATTTG ATCCATGGCCGTCACTCAGCCAAGTGGTGGATGGAAGCATTCTTGTGCTC GAGGTACACACTTTTGCATAAGAGCAATTTCATAAGAGGCGTAAGAATAG ATTAAAATCAATCTGAATTGAAAGTCTCTTATTACGAGAGATTATGATAA gatagttttttttaatgatcATTTAAGGCAATTGAAAGTTTAAGGCTATA TTATATGCGCAAAGGTTTTAAAGACGCTAATGTTGAAACAGACTATACAC TGTTTCTTGCAAACGAATTTTTTTCAGTAACGATACCGACCACGGATTTC TAAAGccggaagggctagatgtcgtgctttggctgaaaagtgtgccgtat cTCGGTAGAAAATCCTActtaggtcacgtgacattacaatagaatgtctt cgaAAACAATAATAATATAGCAACTATATTTCTtgcaatattcacttttt ttgactgCGATTGCTTCACGcatgacatctagcccttcgggctttacaga aatctgtgataTAGACCGCATGAAAACCTTTCAATATGGCTTTAAGATTt gatatacaccttttcgaccgtagccgccaattgccttGCGGGcattttta tcccactaaaaccgtcccagtccttttttcgcccctatagacaatagaaa aatgtgtcaaaaaaggactgggacggttttagtgggataaagcagacaaa aaatgcccgctcggcaattggtggctacggtctaAAAGGTGTATTGATCA TAAAGTATTTACTTATTTCTTTAGTGTGAGAAACGAGTGAACGATCCAAA CAACAAAACGAAGACATCTTGGAAATGGACTTCAGAAGAAGATGAAAGCC AAGATGAAGTGAACTCGATTCGTTATCGATTCAAAGAACTCACTAAACAG GTTTCAAAGCTTtatataaattaacccatgtccgttcttCCGtctgtttg ttcgtccgtccgtccgtccgtccgtccgtccgtccgtccgtccgtccgtc tgttaccagcttttctcaggattggctcattagtttttctgattttttgc acaatgatgcaaaatggcaatgcccagaacgtgacggagcccgatttttg agaaaaaatttatttgggcaaattNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNatagcttttctcaatgttgacttgt tatttttttctgattttttgcacaacgatgcaaaatggcaatgcctaaaa tgtgtcggagcccgattttcgaaataaaatatatttgggcaaatttgggc caaaaactgcctaaaaatagggttttttggactttgtgcaaaatcctgtc attacttttttctgattttttgtacaaAGATGGAGGGCAAGATTCTCTAA AGAATGGCTGAAGTGGTTTTTCCCCGGAatattcttattcgccttaaaaa acggattttcgtattttggggaaattccctttaaccaaataagaaaatat agcttttctcaaagttgactcattattNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNtaaaatggcaatgcctaaaatgtgac ggagcccgattttcgaaaaaaaatttatttgggcaaatttgggccaaaaa ctgcctaaaaatagggttttttggactttgtgcaaaatcctgtcattact tttttctgNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNtt ggggaaattccctttaaccaaataagaaaatatagcttttctcaatgttg actcataatttttttctgattttttgcacaatgatgcaaaatggcaatgc aaaggagccagatttttaaggaaaatttttttgggcaaatttgggccaaa aacagattGAAAGCTTTtctgggcctgaatggtttaagcgattttcgtat ttggggaaattcctttttactattttacattatttaacacacaagcttta tttttccattctgaatttttgtacaattattgtcacttttttcttatttt catccgatgttaatcattaggtaggtccattcagcatgttgcttgttatc aTCGCTCTGACTATCTTCTCATCACATAAGAATCAATCTTAAGGCGtggg aaagttttttttcgcgtcggtgcaatgcaacatgctcaaTCATACCAACT TGAAACACtatctcgtgtctccaccccatttttctttttaccaatAAAAG TTAAATCTCACTTTTTTCcctgggacaaaatcagcgtcttttgggtattt cctgcactttttgtcccatgaaacaaaaaaagaaaccatgggacgcacac tttttttcttgtgttggtgggaaagagtatgttgcattgcaccaacgcga aaaaaaaatttctcgtgtccccaagcctttacttAATTGTGCTACAAACT TTCCTAAGATAGTAGCGGGAAATATGTAAAATCGtgcgacttttttagtc aaatacATTTTgtaattaagattagagatatattgcaagcataaaatccc ttaaaagacagaaacagctattttgtccactttttgcactttttgacgAT TACTAAGAGGTTGATAGCCAACCCTCCAAAATCGAATCCTACCCTTTGTC ACCTACCCGCCCTTGAATAAGAATTTCTTCTAAACCTCAGCCCTTTCAAA GCAACCTAACCTATGAGCAGTAGAATAACTACGtttctcgaaaaaaaatt tttcgactTGTTTGGAAAGTCGTTAACTCCACCATCTGCCTAGAGTGAGC CGAAATTCTCTTTATTTAGAATAAACTCTTTTTAAATACACTTTACCACC AAACCCTTAAAGTGTGAATAGACTTGGGGCGAGTTTCCTCACAAAGATTG ACGTCAAAACCCTTTGTTTATGAGAAACTCAATGCAAGACATTTCGGTGT GTTCTGACATCACTCATTCCTTGTAAACTCGAACCAAGTCTCCTCAAGGT CTAGGTTTTGATAGGTGAGTTGTTTTGGTCATTGACCTGTCTTCGTGGAA ATTTCATTTAGATGTACTTCTTGCTAATTTCAGATGTTATATTTCATCAC TGAGGCTGAAAGGTTTTTACCAGCTGTCAAGCCTCCAAGGTGAGTGTTTA GATTTCATAGAGATTTGAAAATTACTTTACACAAAGGTGAAAAAAGTCTG TATAATATTCACCTTATAATCCAGGGGTTGTGTAGGTTCaatccccggtc accgccaactcagcgaatactgagtttatgtatcggaggatttCGAGGGC GACGGTATAAAGTGagatcgatacaaaacaaagtcgatagttgatgtacg gctctatgtcgcctttgctcacctaaacagacgacggtattttggtgttt ttacagTCGTCGAGCAAAGTCGACTGTGATTTTGGAGACgtgtcaacttt gctttttaCCGTCCCCCTCACTTTActtcgaatacataaactcgctaatg agTAGCtcagattgggtaatctgatttaagagccattttttttaaaaatc ttcagaataaagaaagtctgatacctcaccctcttagattttgatgaaat tttgaccaaatgatctatcacacaagaaNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNcagggtcttattttcttgtgtgatagatcatttggtcta aatttcagcaaaatccaagagggtgaggtatcacaccctgaagactctta aaaaaaatggctcttaagcgGTAAGGCACTAGGAGCTGATAGTAGTCGTG GTGCTTCACCTCAGCATTAAGCCTCCGTCTAGTGCAAATAGAAAAGCGGA TATGCTCCCTCACTCCCGGATTCACAGACAACCACAAGAtaaaacttact tacttactcttTTCTTTAGAATTTTAACCAACGTTTATCGTTTACTATGC TTGAAATCTACAACACCCGAAGAATTATACACGCGGAAAATCAATCTTGA ACATTACGGAGAGGCCTTGGACCTAGCTAAACGTTTTGGTTTGAATACTG ATTTAGTTTATCAGCGACAGTGGAAAAAGAAAAGAGTTTCGAAGATTACC ATTCATGATTATCtggtacacttttttttaattggaatacatgtttttta tataagcaagtgtatgccccttggtcaggcttgtgtatgcttaagttctc aaagcatccaggcatagctcATGCTTATTATTGAATCATACTTATGATTC ttcccgagccaagtttttaatgaaatttcagaaattttgtaaaaatgtgt tcagattttgggagcagtggaaagTAACTAGCCGTGGAATGTGGAATtat tttacttgacctctaccaaacctttttaaacagataaaaatgaaaacttg aaaaaatttcaggctgacatatacgtttatgttatgcttaggaattatgc aaatctgagccttcatatgcttataagcgttatgcttataaagaaaaaca tgtatccAAAACTTCTGAAGCCTTTTGATGttctttaactttttaaattt aagcctaagaatgttcttagcatgttcttattctcTCATAGATTACTATA TATGCATGATTATCTGTAATAGCGAATTCTTACTCTTCGATATCAATATA ATAAGCATCCTAGAAAGTGTTATAGCCAATCTATACATATGTTAGGTCCC TATAGGTTAACAGTGTAGTTTGACCGTAACCGAGACtgttttcctttttc aaaatttcatgattatatttttttccttattaAGCCTTTTTTGTATACCG TAGCTTACATTAAGCCCATCAACTTAgctccttttcttttttatagtcCA AGATTAAAGATCGATATTGGGTTTTGGACGAGTGCCTTTTACGAGTTGCC GATGACTTTGACTCGACAGAAGAGTTACTGAAATACGGTTTACTCGGTAC AAGTTGGGAAATCTTGCAAAGGATTGATGAAGAGGGTAAAGGTGatgcaa aggatgatgggaAGTTATTACCTTTTAAATTTGACGCCGCCCCACATGAC GAGGATGACGAAAACTCAAGTAGAGAATTCCAAgggaggtaataaaaaaa agattaaaggccggtctccactttcgcgcgaaatgagcgaagacttttta aagtttttgtaaggtcattggtcggttgaaaaatgaagtaattccattag tcaaaaaattgacgtaacggttgaaaaaagttgattttccttcaactttt ttttttgttcgcgcgaaacttttttataacgtcatcttttctttaggcaa aaaaggttgagaaaaaaactgtcgcccatttcgcgcaaAAGTGGATGCCG GCCTTAACTTCTAGTGTTCAATACAGTAgatgctctctaatttgattttc aagtgGAATCGAATATAGGAGCTTTTCGAATAGTAAAGAATTTTTATGAg aatttcttgttgacggttGAAGAATCTTAGCAACAataatttgaaaacga ggcccacagtgattttatcaattttgagAAAAGTGTCTAAGGACTGAGTC TGAATTTACCCCAATCTTGTAAATGTTCTCTTAATGAGATATTCTTATGA ATTGTTCCTTATCGCCTATTACTGAAAGTTTTAACTGGGATTTAGAGTTA ATCGGATCCAACGAAACTCATTTTCTTGGTCTAGGTGCCAGAACTTTATT TCGATTATTCTCGATTGGTTCACAACACcagtagcgagcacctcactaaa aaccgggatttttcatctcgtttcttagtgagttccactttgacgatttt cgaaaaatagaagcctttcaagcgGCTTTCAAGTGTATTGAcgaaaattc tattttttccCTACTGCGAAAGCTTCGAAGGTATAAAGTGGAATAGAGAT TATTACGTAGAAAAAAAGCTACCTTAGGCTACTTTATCAACTGTTTTACT CAGTAGTGTGTTACGGAGAAGAAATTTGAAATCTCCGTAGAAATCGGGTA TGTTTACAGCTATTTATGATCTGAATAGCAGAAGGAATGGGAATTTTTAC TAGGAGCCTCTTGTTTGACGCAACAACACCTTTTAGATCACTCGCTCATA AACAGTATTGGGTGTATTGTGTCTTGAATTTACGAAGATTTATGAAAtat ctttgtaatttttctttttgaaggcTCTCTTATATTTGGACCAAATAGCT TTTCTTTCAGTTCTTCTGTCTTAGTCGGATTTCTGTGTCAGCAAGATACA AAAAGAGGCTTTTCTCTTTATAAATTCAACATGCTTTGACCACTGTTCGT TGTTTCTTTCACTTTATTTATAGTCTAACGAAGAAGCAATTGAAAATCTG CCAATATCGACGGCAATTATTACATTATCTTGATCGGCTTTCCACTTATG AGGTATCGTTCATTCTATTTATATGGGTGTTTACGTTTTGTATATACCTA TCaaccacagatttctgtaaagcccaaagtggtagatgtcgtgctttaag tttttccaagcaaaaaaaatgtatattGCAAagaatattgctgctattgt tttcgaaaacctgcgaagcttgttattggtcaagcactgaaattctattg caatgtcacgtgacctaggtagtatttcctacctaacctcggcacacttt tcagccaaagcacgacatctagcccttcgggctttataaatctatgctaT CAACCCTTAGCACCGCTGTCACCTTTGAGGAAACTGGTaacgaaaatacc aaaaaaaaacgGCGTTTACCATCTCATCTGTCGTTTATTTAATTACACAT TTTAGCACTAGGATCTTCTGCCACAGTAGTCTTTATTGCATAAAATCTGC AATTCTAGTCAATTTTCACCCCAAAGACAATCCACCAGGTTTTTTTCTTT CGCAGCTCAACTACTCAATTGAACAGTCTTGGGGCTCTTCTTCCTAGTCA ACCAAATACATATGCAAGTTTTTGCATATTCCACTTCCATAGCAAAGAAG gtttaaaattataagaacgaCAACTTTGACATCCAAGCCTAAGATCTCAC ACAAATCACATTCAGTTTGTTTCGAGATAATTTCGGCCTTCTAACACTTT ACAAATAATCCTATAATCTCTGTTATTACAACTCCTGATGTGCATGACCG GCCATCATCCAGATGACTTGTATCATTTTGGGATCCGTCCTACTATGATG CTTGTCTCATCTTGATGATATTATTAAACACTTGAACGGCACTTAGAGAG CGATCCTCACGCGAGGCTGTTCTATATGAGTGCAACGGCACGACACAATG CTAGTCTAATCTACagacactcttgtatcagagtaatggtacccaattcc cctcacatgacaTGGGTTAAACCGGGCGAAAGTATATTcgcttgccaagt gaatcgtagggACACTttgggtatcgaactcgggcctcccAGGCGGAAGT CAAGAATGATAGTTTGACTATACTATTTCGTCTATTAATCAAAATCCCCC AAATTTTAGGTTGTTTTGGGAGGCTCATTCAAAGCACGAGATAAATTCTC AAAAGAGTATTTTACCAAATTTCGATCGTGCAATATGGTACACCAAGCGG TCGAGTGTGCCCGCGACGAGGACGCTTATACTCTGGAGCATTTGTTTTCG TACCATGGGAAGCAGTTACTACCTTATTGGCTGCCGATATTATCAAACTT CCCGGAAACAACCGATATCCGATATTTTGAGCCGGTCATCCCTGAGATTG GGTAAGTAAAATTTTATAGCAACACAGTGGTCAATTGTcgtttttttggg tgtttctGATATGAAAAATGACGCAATCTTGACTTATATACGCATATCAG GATACGATTCATCTCAGCAAGCACACAACGTTGtcttaacgtttatctaa cgttcacaacgtccatataatgtgagatgaacattgaaacaacgttgtct gTCTGGTTGGATGATATTTGTGCTGTGACTCGAAAACGGTTATGTTATAT TGTTTAAAGACAGTTTGCTTTAACAACTGTAAGGATTTTTGCAAGTTCTT TTGATAGCGATAAAGTCAATCTCGACTTTAAAGCGTAAAAAAGACTAggt aaatgttttatttttacaacaGTATTCCCGTtccatatcagacacatgtt tcatgtcagggcagtgtctgcctattgttacattgtgctgatataaacaa aaatgtatttcttttcctctttctggccaatcttgctccacatccgtgtc aattctaTGTGAAGAAGCttgtaaattatttttgtaaattaattCCCTTC CTCGGAAGAAAGGCGCCGCGCGATCACATTTTGtgagaaattcttttctt tattttgctttgtcAGAATAAAGGCGTGCCTCCTTTCTATGTCATGAGGA AGAATATATTTAAATTCACAATTTCAGAATTGagaaaaaacatataaaaa atattatcaTCGTTTTCTTTGTTCTGTTTCTCCAGAGAGCCACCAGAAGA TCCAGAGATTTTACCTTGGTTAGAGAAACACCATCGTGAAGAGGATTGGG TCGAGCAATCGAATATTGTCCAACAAATCAAGTCTAATGAAGAAGGTATG TtatatacactggatatacactGCACCACTGGAGTCttttgagaactttt aaaatNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN TCATCGTTTTCTTTGTTCTGTTTCTCCAGAGAGCCACCAGAAGATCCAGA GATTTTACCTTGGTTAGAGAAACACCATCGTGAAGAGGATTGGGTCGAGC AATCGAATATTGTCCAACAAATCAAGTCTAATGAAGAAGGTATGTtatat acactggatatacactGCACCACTGGATTCttttgagaacttttaaaata ttccacccaatacgtcacttaaactatagaaaaagtgacgtattcgGTGA AAAAAACacacagaaaagttgcataatctCGTGAAGTCATTACAGTGGTG CAAATCATGAATACTGGAACGGAGCGTCACTACAATTCACCTTTATATAC CCTTGACTAAGTTATATCCGCCATGGGTGTTTTAAAAAAAGTGGTAGCCC TACTCGGTGTGTGTCGATTTATAATTTAGTTAAATTTTTCGGTTAAAATT TTTTCACGAACATTGAGTAGAGCTTCTATTCGGATACCACTCATCATGAA AAAGTTGTGACCAGGGTATATAAAAGTCATTACGACCACAGTATGAGGCA GCGCGAAGACTCCTCTATCGATAGCTATTTATCCGAAGATAGGGGAGAGG GTCACTCTTTCTCCTGGATTGTTCCACTGACCCTTTTAATTATTCTCTTA ATCTGTGAACATTAATTAAGCAAAGAgccatcaagtaccattttgttATT AAGCTTGAGGTCTTTGGTATGACTCAGTCAGGGTTTGAACCCACGGCTGT GCGCACCGTAGCCTGATGCTCTACCCTCAAGCCACGGTTGCTTAAAGATA AAGTAACACTCGATAAGTCGAGCCTCATTCACTCGAATTTTCTCCTTAGT TCGAAATCCATATTAACACTCAAACTCTCAGGAAAATTCGAGTTGTAGGC AGATAGAACTGTACTTCCATTAACAGACCATTATAAcgaattttaaattt ctttgtAGGTGACGCAAACGAAGATATAGGCTCATTCATTTTCGAATCCG ATCCAGAGATacgaaaattttacaaatgtGAAACAAAAGCTCAACTGAGA GAATGGTTTTTACATCGTGTACACTTGATTGATGAATATTCCGGTCAGAT TGATAAATGTTGCGAGCTGTTAGATGTGGGAATCAAAAGAGGCTTGGAAG GGCTCACTAAGGTAAAAACACTAGCAATGTGGAGATTGATTTCTCCCAAT TCACTGTCTCTCTGTCCagtcagtagacaagaattcacttcTAGCTCTAC CGAGGGGCAATTGACTCCTCGGGGTCCATATGGACCCGTAGCACAATGGT AGGGCAATTGCCCGCGAATGACATGGTTGTGAATTCGAGTCTCGctggat ccgttggttttccaacggttctggtggctggtcagaagtcaacatgagag cgactgtattcacttcattgacTCATTAAGGTAATATCACTGATCTTTAT AAAACCTGGAtcaagctatatccaccattCGGATACCACCTTCGAAAAAT actcgatcaaagattttgcttggtcaGGATCGAGAAACTGTCCAGGGTGT AAAGGTTTTGTAGTTTTGACTTTTGTTTCAAACATTTAGTAAAAGATAGA ACCTGCATTATCGAGAAATTCTTTGAAGATGAAATATTTGAATAAGCAAG TCTCCCTTTTTGTAGGCCTATTAGGTTCTTCTTATTCTCAAAAACGGTTG GATAAATCTAAGGAGGAAGTAACTTTTTCTTCCTTTCTTACCTACAAAAT TTGCAATTATTTGGCAAAAAACATTTGGCATTGCAAAACATTTCCCCTGA AGTTGATAGCCGGGTTGATTATTTACAATCAGTTCCTTATAAAGGAAGTA TTTCAATATAGCTCACGCGTAGAGAGAGAGAAAGTAAGCTTTAGAGAAGT TATTTCACTTCAATTCATCATTACATAAAACGTTAGGTAATTTTCTTTAT GAATTTCATCCACAGGTTCACCAAGAAATGGAAGCATGGAGACTCTTAGT TTACGACGTTGGAATTGACAGTAAAATGACTGCAAAGAGTTTCGTGGAAT TATCTGAATCATCGAAAATCAAATTGCTAATGTTCAAAACCTCAGATGTG ACATTCGTTAACGATTTCAAGCTATATCTAATGCCGTATTTAAGAAATAT TGGAAAGAAGGATTTTAAGAAACGCCAAGATTTACTTCATGAGTTTTTGG TGGAAATCGCTAAAACTGATTTGACATGCTGCTTGAAGTTATTGGAAAAG TGTTCGCCAGAGGTAANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNtttttcct ggaaaattcttattcgccttaaaagacggatttttgtattttggggaaat tccctttaaccaaataagaaaatatagcttttctcaatgttactcataat ttttttctgattttttgcacaatgatgcaaaatggcaatgcccaaaatgt gacggagccagatttttcaggaaaatttttttgggcaaatttgggccaaa aactgcctaaaaggttttttgggcctgaatggtttaagtgattttcgtat ttggggaaattcctttttaccattttacattattcaacacacaagcttta tttttcNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNtttatttttctattctgaatttttgtaca attattgtcacttttttcttattttcatctgatgttaatcattaggtagg tccattcagcatgttgcttgttttcctGTGAGATCATCAATATCACGACA AGTggctgaaaattttcatttttgtagcAAATTGGATCTTCTAACTACTG TCAACTCACTCTAATTTCccactaccttatcggggaaaaatatgtcggag ttttatttagtcggggttttttttcgtcggggaaaaatttcgtcacctag aggcattttcgtcacttttccccgaccaaaatttcaaattcgtcactttc acccgactaaattgtccaaaagaaatggtttccttcactagctcgaaaat gaatcttgtaattcgacgtttaaagcactaatttcggtaaataaaggtgt aaaaaagttagatttgaattttggttgcggtataaaatttcgggtaaatg ttttggtcggggataaaaaaatcgggtacaagttttggtcAGGTGATAAA ATGTCAGGGAAatacttcgtcggggaaaaatttcgtcaccccctcaacaT TTTCGTCACTTatccccgacatttttttccccgataaggtattcgaattt tctgtaattcgaaataAAATGTCGGTCCCCTTagctggaaagtggtttaa attactctctgtaattcgaatcttctaATTCGAAGAGTTCAACTTTTTCT AATTCTAACCTCTACTGATGTTAGAATCTTTCATTAATTCGAACTATATT GGTTCCCTCAGCTAGAAActagtataaaatactttctataatttgaatct ttctcgaatttgaagaaaattgttGGTCCCTTAAGGGAAGAAGATTGAAC GTTACTATTTACTAGTAACCCCTAAATCTAAACTaacttataaagaaaat gttttcgTAAAGCGGTGGAACCTAACGCGGCTATTTGGGAGTGCCTTAGG TACCCTGAGCATCTGTCTTGACTATTATAGAGATAATTATCCATTTTGCT CTTAGCTGCCAGAACCACTGCTTCCTGATATGGCGGAGATAATGAAGATT GGGATTGATTGCGTTTACGCGTGCAAGAGAACGGATCAATTGAATCATTG TTTCAGCATTGTCGAATGTTTGCCTTCGAGAGAAGAGGGGTAAgtcgttt ttttcattttaaaaactctGAAACGTCTCTTACCGACATGTTCAATATAA TGAACGATCGTATTTTTTACGTAACGGTAAGTTCTAGAGCTATCCAGGGT TGTCCTGATTACGGAGTGAGTGATGTAAGAAATcttaaattaaataaaaa atattagtTAAAGACGATGGAGCCGATATTTTGAGTAGATAATTCTTTCG ATTGTTTCCACTGGGTCAACGGCCAGCTGACTCAGTTGTcaatgaactga acggaacataaGAAGGCGTGAAAATTTAAACTGCAGAGACTCGATACGTG GCCATGAGGCGTCACACCAATAGGCCGTCGCTCTAGATGTGTGGAAAAAT GTgtggaaatcgaaaaaaaataaaatcaacaccCGTGTTGTTTGCGTAAA GGTTAAGGACTACTAATGCGTTCGCCGTCACGCGTCTTATCAATAGGCAA TCCGTTTCTTAGAAAACCCACTGGTTCTGGGTTCATAGTAATTAAATTTC TTCTCTATATGTAGAGTCATTAGCCGTCCCGTGGAAGAGCTTCACATACA ACTGGATCAATTGGAACATTTGCTGACAGGTAATCTGTTATAGAGTAACG GGTGACTCACGAAAATTTGCTTTGTATGCTGGTGTATGGTTTGCGACTGG AGAAACGTACCAAAGTTTTGTAGTTTTAATATTTAGAAAGCAGATATCCT AATTTACAAtttgaattattattttatacCTTCAATACGACTCTCTATCT AATCTATcgttttagggaaaatgagcattttttGTGATTGCCTTGGTACT TTATTCTAATTTTTTAGTTTGCATTTTCTGACTgtagttgaaatttttct attttcttattcCATTAGCCTACAGGTAGTATGTAACTATCACTATTACA GGTAGTGGTACTAAGTACTATTTTCTCGATTTCAACCCAAATGATTGtga tgggcttttccagaaatttttCGTAACCACCCCACCTGTTGAGAATATCC ATTTTTCGTGTTCCTCAGCCCTCTGaatgttttgtttgaaaatgaagacc CCCTTGGATATCCAGATAGCATTGGACCCCTGGATCTCCGATATCCAAGA AAAGCCCAACGtacattttttaatgaaaatcagTTTGCTTGTTCTTAGCt tagtttttattgttttcactTTCTAACAGGAGCGGAAATTTTACAGTATT ACAACAACCCTCAGACCATCTCTTACATTTCTGAAATTAAAGATGACTCT ACTATTTGTAAACAACTCATTCAGCAATTGGTGAAAAACGCTGTTTGTAA AGGACGTTGTGTTCCAAAGGAATTGAACAAATTACTCGGACATTTGATCA AGCTTTCCAAAGAAGTTTTCCGGTGCTGTGATATCAAGATCGTTCACCAG GTTTTTATTACTGATAAAAtattacagtggagtctctataactcgaactt cCTCGAAGTCGTCttaactcaaatatctcctAAATTCAATCAAGGTTTTT GTCCTCTTCGATAGCATACCGcagtgattctaaaaatagacatcaaaagT ACTGTTTGTCCGCgttttaatcccatcatccATTACATTAATTGCTTTTG AAAGTCAATTACACTTATTGACAATtcaaaagtaataacttgcacgcact acgaatcaagatgaaaaggattgtgggattgaatttcggtcaaatgttaa aagtaataattatgacgtttgcatagcggCGGTGTCTCTattataactcg aaatttccataactcgaataacAAAGTTCTGTTCTTCATggttgttcgag ttaaggagactccactgtaaaaACATTACCATTAAATATTTAGTTTTCAA CAAAAGTATTTCGTTCTATTTTAACATCTTCTGACAGCACAGATGAAAAA CTAGGTTTATGTTCATACCCTGTTCTTACAagaaaagttttacaaaaaac aGGTTCGAGCCCTTTTTCTTTCAACATTTTGTTTCCTTTTATTCCCAAAT GAATTGTTATATGTTTGTCTTAACTTCTTCGTAAGTATTCCCTGAATATA TCTATTtattttcagccaaaatattGTATATAACATCCATTTTTCTACGC TTTCATTCAACTTGATAAAGACAAACCGCCGAAACGCCGCATACACAACT TTAAAATAATTACGAAGAAGTTTAAGACCAACAATTAAACAAGAGGCcca agggcatgaaggcccagagtctaaaaacatatatagtttgtttttgctTC CGAAGGCCGGGTCCTTACTCGCACAAATTTTGTACTCGCACAAATTTTGC ACGGTGGGATCGCAAAATCATGCTTTGGAAAATTTAGAAGGGAACAGGTA CAAGAAATGAGAGTTAAATAACAATATCaatgtatttatttcttttaaac aGAGCAAACTCAAGGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAGCAAAC TCAAGGAATTCGAATTGGTTGAGTAAGCTGTAAGATGGGTCGAATTCGCT ATATAAATCTGAGCCGAGTAAACCGAGTAGATGCCGAGTATATCAATTTA AGCCGAGTAGATTCAAGTTTAGCCGAGTTTTCCGAATAAATCAGTGTAAC AGAGTTAAACGGGTTTGCCGAGTAAATCCGAATAAGCTGAATTCCAGATT AGCTGAGTTTTCAAAGTAAATCCGTGAAAGCTGAATAGATGCAAGTTCGC TGATTTATAACTATTGTTGCACTCCacctgatgatgatgatgatgatgat gatgatgatgcaaTGATacctaaaacagaaaaaattcaatatattaAATG TATACATCTCAAGATCTTCAATTAAAaggggtgttttaaaattaaacaac attGATCTGTTGATGTGATTCTATGCAATTGAGCCCcctacaaagaaaaa ttacttaaTTTTATCACTGCCATGGAGTTTCATTaattatataacataaa taTTTGTTGCATCTCTTTTCTATGGAGCTTTTTCTCCCAGACCCCCCTCT TTTGCACTTTAAAGTCTCTTTTGAAGGGGTTCGGACTATGACTGACTCAT CTTGGGGAAATAGACCAGGCCATGACTCGCTGTCCCAACACCTTCCAATA GAAAAATTCTCTTAGTGTTTTTTATTCCCACTGATACGTAGAAATCCACA GGGTTGGCGGGCCAAACAAGCCCAGTTTGGGCCCTACGGGGGTCCCCGGG CTGAAATGGTCATCAAGGGTCCCCTTTACAAACGAAAATTTGAAGGTCTG AAATTCTCATATCTAATATGACCAACTGGTAGGGCTTGAAGAGTAGANNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNATTTAGAATC ACTCAAGCATTTTCTTCCACTTCAATCTGTGAAAGTGACAGAGAACTCAC CTAAAATTGGGTACCAGTATTGACCTTCTGTTGCCTATGCCTTGAAGGTT GATTGAGCTGACCAGGAcactgtaaagaaaaaaaaaagattattagTATC TGTCTGAAAATAAACCCTCTCCAGGGTGGTAATTTTTTCACTGATTACAC CCTACTCAGTTCTCGTCAAAGTAAAAAATCTTATACATCCCCTATTTTGT ATGCACGCGATagataagaaaatttaaaccacTATTGGGGCTGTCCACAT TATTTGTGCactgaaaatatcgaaaaattgGTACCCCTGCCCCTGTTCCA ATGCGTATGCAAATGCCTGCCATTCCAATCTGTAAATGGGAGGGGTGGCA ACAGGTGGCAACACAGAATTTAagtcaaaatgatttttgaaaaacttggg ATTTCTaagacattttctgaaaaatgagaaaaacatggaatttcCAATAC CTTCCTCTAAAAAAGTGTAACTTACAAAAGTATTTACATTTTAAGAAGGA ACCAGACCTATGTGGTCAATCCTATCGACCATCGGGATGGCTTGATGACA gatcgatatgtgattgatggattacttatcgatccggatagggcggcaaa aacaaatatcttcgtttcgtgtcgcccgaccgactcctgaaaattgagta aaattgagtcggagagtcggtaaatttttcggactttttgttttgatgac gttttatttgctcaaaaattttatttttgccgatttttgtgagcgatttc tagcgcattcgcagcattttaactttgtttttcaTTACACGTGCCATTAT GTGTCAAAGGTCACAGTGTTTAAATCTCATAATCTGAAACCACGCAAAAC ATACACGGGATTGGGCCTCCTGTCGCCTCAGTTAACGTCCTTTTACCTTT TACCGCCTCACagaccaattttaagaaaacccgaaaatttttactaccga ccgaccgaccgactgacttTTTAAatccaacgaggacgcgaaatgaagat atttgtgattgcgcGCCTAGGAGATTGATAGAGAGATCAGCCATAAAAAA GTCCTTTGCTGATTATTTATCGAGCTAGAATTAGTTCAATCAAGTATATC GATTGTAAATCGATAGAGCTCTATCATTAGAAAGAATCGATAAAATCAAT ATGATCGATAAAAGATTACTGTAGATGATGAATCGAATGCATAATCGATA ATAAATCATAAGCTTATaaagtcttgagtatcaatCTTtgatcgatctcc tatccgaatcgataagtaatccatcaatcACATCTCAATCTGTCATCAAG CTGTCCCGATGATAGATCCTATTGTattccagacgtccgcgctcgatagg atcgatcattgGAATgtctcgatgacggatcgatatgtgatcgatggatt ataTAACTATCCGGATTGGAGATCGATAGAGggtcgatactcaagatttt tttaagcttatgattagttatcgattatttatcgatctatcatcgatctt ttatcgatcttatcgaccctattgACTNTatcaattatttatcgatctat catcgatcttttatcgatcttatcgaccctatcgactcatactcggttta cgatcgataacaaatcgactaacgatcgatgacgaatcgattaacgatcg atgacgaatcgattaacgatcgatgacgaatcgattaacgatcgatgacg aatcgattaacgatcgatgacgaatcgattaacgatcgatgacgaatcga ttaacgatcgatgacgaatcagtatactcgattgaaatactagctcgata atggatcaacgaaggagaTCGATACTCAAAAGTTGAACATGTGTCTGTAA AGTTGGATgcatgtaaacaaacttttttagtTCCTCACTTTTTTGAGTCT TTTTATGTTTGCCTGcgagtgaggtaaatctattttgacgGCCAGAAAAA AAGCAACATACCTTTCAAAAATTAATCCTTATTGTTCATGGCACTTGGAA GCAAGAGAGATGTTGCCACAACACGGTTGAGtgacaaaaagaaattaaac agAAATTGTATAAAAGcatccttcttctttctcgataagattttaaaaga aagtttcgcAGAAATCCAACCAGTTTGTTGAGAGCTAGCCTGGGCATAGG ctgatttgattataaataaCGAACATTGCGGTCTGAACGAAAATCTAAGT TCTAAACCAAACTGACAGTCTTTCCcgaacaaaaaatatagcgCGAAGCT GTAGATCTcaattattgttttatttatctGTTCAAGCCTCTCCATTATAG CCAAACAGCCTGGatggttttttattttatgacagAATGCGGCTAATAGC TTAGCGTTACACACGAACACGactctctttaaaggcccagtacgctaaag ctctgggccaaaaaaaacaaaaacaaaaaacagtaAAATACAGTTAACCT TCTCTAATTCAAACCCCCATTAATTAATTATTTTGTAATTTGATTTCATT TAATAATGTCAGTAGCACTTAATTGTACTAGAGCCTTATTTGGGTGCTGG CCTAACAAGTGAACAAGACCCAGTGGATGAGTGAGACCGGACCACGAAAG GAACGGGCTTAGAAACCTAGGGGAGCAGAACCTAATCTTATTTAATGTTC ACCTTACTGTTGTTCTAACGTTTAGATTTTCGTTGAAGAATTACTACGGT CCGGTTCACGTGAGAACATAACAGTAGCTGAAGAGTTGATCACGCCTTCC AAACTTGCCGGGAATTCACCTCAAAGTAAGAAACCAGAACAACATTTGAC GTCTGCACTCTACCTCCTCAAATATGATGTTTCGGTTACCGTTGTGTTGG AAGCGAGTCGTGAATATTTCAATGCAGCAATGTCGGGTAATGACTCTTCA ATGGAACTGGCTAGGTATGTTACGCAATGTTTTTTGTGAAGTTTTCGTTC GTTTGTcgattcattttttttctcaacaaCTTTGAAAACTTGGAATTTAA TCGTTTGATGATAAGGACCTACGAGGCCTATattatcttttcatttttaa aatcttttctaGATTGTGTCTAACATTGGTCAAAGATTGTCCAGAGAGTG TTCAAGATGAATTGGATTTGATCAACTCGTTGGGTTTATTGTATGAATTC AATGTATCCATGCTACCCTTACAAGGTATTGTTTCTTTGTTGTTATCAAC GGGGGAAGACTAGAAATAAACCGGAAAATTTGCTAAACTTTAATTAAGAA AGTAAGTCTGCAAACGCAGTCGGAggcaacccgaaggctcctttttcgat agctatccACCCGAAGGTAGAGGAGGGCATTATTCTTTCTCCCTGGATAT CtacacttacccttgatccttgtCTTAATTGCTGAGCTTCAAGCATAGAG TCATCGAGTACCATTTTGAAATCTTAGGAATGACCCGGCTGTGAATTGAA TCTGCAACCTTGCGCaacgtagccggatgctctaccactgcaccacGGTC GCTTTAATTAATAGGACATCAGGGTTGTTGGTCTTATATGACCTCAGGGT TGTGGGCCTTATAGGGCCTCAGGGTTGTGGGTCTTATAGGACCTCAGGGT TGTGGGCCTTATAGGACCTCAGGGTCGTGGTTCTTATAGGACCTCAGGGT TGTGGGCCTTATAGGACCTCAGGGTTAAGGGCCTTATAGGACCTCAGGGT TGTGGGTCTTATAGGACCTCAGGGCTGTGGGTCTTATAGGACCTCAGGGT TATGGGTCTTATAGGACCTCAGGGTTGTGGGCCTTATAGGACCTCAGAGT TGTGGGCCTTATAGGACCTCAGGGTTGTGGGCCTTATAGGACCTCAGGGT TGTGGGCCTTATAGGACCTCAGGGTTATGGGCCTTATAGGACCTCAGGGT TGTGGGCCTTATAGGACCTCAGGGTTGTGGGCCTTATAGGACCTCAGGGT TAAGGGCCTTATAGGACCTCAGGGTTATGGGCCTTATAGGACCTCAGGGT TGTGGGCCTTATAGGACCTCAGGGTTGTGGGCCTTATAGGACCTCAGGGT TAAGGGCCTTATAGGACCTCAGGGTTATGGGTCTTATAGGACCTCAGGGT TGTGGGCCTTATAGGACCTCAGGGTTGTGGGCCTTATAGGACCTCAGGGT TAAGGGTCTTATAGGACCTCAGGGTTATGGGTCTTATAGGACCTCAGGGT TGTGGGTCTTATAGGACCTCAGGGTTATGGGTCTTATAGGACCTCAGGGT TGTGGGCCTTATAGGACCTCAGGGTTGTGGGCCTTATAGGACCTCAGGGT TGTGGGCCTTATAGGACCTCAGGGTTGTGGGTCTTATAGGACCTCAGGGT TGTGGGTCTTATAGGACCTCGGGAGGTTGGCCTTATAGAACCTCAGGGTT TTGGGTCTTATAGGACCTCGGAGTTTGGATTCTATCGCTTAGTAattagg cttttccagaaaaaaaccgtataccccctgttgaggaggtccatttccgt tccaagggggtaaggtttgatatgtggcagaattccatagggagatacaa aaatctgtcaaaaataactggaattccatggtagcttttaaatcctacta aaatttagaattccagggggttacagcatttctAGCCAAagagggatgga cctcctcaacgggggtatacggtttatttatggaaaagcccattagCGGA AAGGGAAGGGAAGGGAAGGGCGTCTATTCgaaatttcaagaaatgaaATG GGTCGCTTCAATTAAATTATGTTGGATTTCCAATAATGAAGTTTGCCaac tcaacaaaaaaaaacgCTACTAAAATATAGGTTTTGTCActtctttagaa attttataGGGTTAATTGTAAAATGTTATGGGTGATCTCCCCCGCCCAAA GGAATGATGAGCGAAAGCTTGTACCCTGGCCAACATGAAATATATTCCTT AACAAAAAAGtacttttctttaaaaatttttcgtTTTCAGTTCGCCTTTG CGCTGATAAATTGGAAATTATCGATCTTTGTTTGAAGGAGAAGAAGAATG GGTACAAGAAAAAAGACAAGGTAAATAGAATGTTTTAGTGTACATATTGT ACAatgaacgttttttttataaacataacGCTTATAACCATATCCAGTCC GTCTCAAATCTTTTTAGACATTGGCTTTAGTTAATTGGCATTGGCTTTGG TTAACGGAAAAACTTAAGCATTGGCTAAACATATGCTAAGATTTGGTTAA CGAAATCTCAAATCTTAACTTTATTATAATTTCGAAATTTACCCTATTAA TTTGAGGATCAGAAAAGAATTTAGCTAAGCGAGGCTTGCGAGAATTTATC CTGTGCTTATAGAAAACGTGTAGAGGgatttcaaggggcctctgacTACT TTTTATGTATGTGACCAAAGAAAAAGAACTGCCataagacttttcaaaaa tttactggttcttaaaaaaaatgtatcGAAACCCAACGATCCCTAACTAA AGATATACCCTAACTATCCAGATTGCTAATTATGAACATACAGCCGGATG TGATTTGTTATTATTAAGACTCGTATAGAtcgataaaaaattttctttct tcttttatttatattagAACCCGCGAATTACAAATTacctaattttttca tttttatcaacaaatttgaaaaatccctaggaaagtGAAAGAAATGTGTC CATAACTGAGCAAAACCGCAAAAGTTAATTTCCGCGAAATGCGAtagtta agatttttttttttgggacatacTTTAGACTAGGAGCACTTTCCGAGGTt gcaattttgaaacaaatactgaaaatccaaataatgatgaaataattatt taaaattgaaaaaatatgccAATTAAAAAAAACCACGCAAAAGCTAAACA TTGAGACCGGGCCACTTATTAGCGCCACCCTGTCTATCAAAAAAGCCTTT TTGTGGTCCCTGGGCTCGGAAACTTTAATTGTACTGTAGTAAAAACTTTG CGCGTTATTCTATTCTATTTCACAGCTCATCCAATTGAGTAATCTTTTGC AAATCTGTGGCCATGACAACAAAGAACGGATTGGACAAGTCAATATTAAA ATTGCTGAATCAGCATTTGAACATAAAGATTACACATACGCTGGTATCGT TTGTGTACAATTGGTGGATGATAATTATTCTAATGCTTGGTATATTTGCA GGTACACCTTTTTCTTATtgatgatatgcaccattgcaatgtcttttgAC ATCACATCTTACATctcggacccaacagctgattggtttgtaagtgacgt aataaaatcagtcaatacgtcactttcaaccaatcagatgttGGGtctgt ggaagacattgcagtggtgcatatcatgaatatagaACAAAAACtaacta ttcatgatatgcaccactgcaatgacttcacgaaattatgcaacttttct gattttgttccacccaatacgtcactttttctattgtttaagtgacgtat tgggtggaaaattttgaaaattctcagaagactctccagtgttgcatagc atgaatataagaacataaagtttcgatggccaaaatatttgaataagaag ttaagaacattttaaaggctCTGCGGAttctaaaacaccaaatttcaaaa acatttttaggcataaaacccaaaaagttaagaacatacggaggcttaaa aatcttttgatgttcttataaaaaaatgttagcCTATcaagtttttagtt tttgaggCCTTGTTTGAGGCCGGTTGCCGTATCAATTCAAAAAAGCTTAA ATTCAATGAAGATCTTTCGGCGTGTTCAGTAACATTGGGTATCGATTTAA CCTCCAACTCTCCACTATTACAGTTGTTTcaattcagaatttttttttct atttgaacAGGAAACTTGGTGAATGTGCTAAATATACCAACTTCACAATC AGGTATGTTTTATTGAGTAAACACAATTGGTTAAAGGGATTATTAAATGG TTTCAGATATTCCTTCGAATGTCCTGAGCAAATCCTCCAAATCTCTTTGC ctaactacaatcatggtcaaaatctaaTGAGAATTTAGCTGATtttctcg tttttcgaaatttcgagTTCGgtcgagaaagtcgattttgggccatctct taaatttaatcggatTATTTCAATTTAGCACGGGTTTATAGACTTGCGCT TTATTATGggctatttttgaacttttagatcctcagatcctaaaatctta agttttaagtcttagcgttaaaactcacagttaaaactctacccttccaa cctaacttagagcactgccaaatcgtttgtggttttaaaaatttgtacga atttcccttttttctaaaatattacgaccatgtaCATGATTGTATTTTGC AAAGTCGAGATGTTCAAATtacaagtttttcatttttacaatagaatttt gacgtgagaaccgtgtaagaacccatttttagaaatttcaaattgtgacA TCTCAACTTTGGAACATAGTTAcgcaaaaataacttttaatagCACCAAA CCACGCTTAACGTTTTTCCTTTTCCTAATTTTTCGTTCCCTTATTGAAAA TAGAACTAtggagaatatttttttctctcaaattttCCAGGCAAAAGTTG TTGAGTTTTGCGTTAACTTATTGTCCAGTACATCACATTGAAGAAGTTTT ACAAGAGAAAACTCAACTGGAAACCCAGGTCAGATattatttgaaatctt ttttaagGCCCAGTTGTGGATCTGAGaggttcaaaatttatgacgtGGAG TCTTCNGCTTATGAATTTTTAGGATCCAACCCAGCCTAATTCTACCATGT AATAGATACCTTGAGCAAAGATTCACAAAAGATCTTTGTGAAAGCTTTTA GCATTACTGGGGGATAATTGACAGttattcttagcatgttcttatatttt atcttaaattcatcatgaatattcttgtaaagtatattcttattaaaaaa acgtgtaacttaTTTATTACTCCGCATAGGTTTTGTACGAGAGGTTGGGT GTATTTACGAAAGAAGGCAAGAAAGACAAAATTGTGACCTCATCTAAGAA AGAAACTGAGGAAGAAAACGACGAAGACAATGTTGATGGGGTATGtcgtt tcttttttatttaagaacaaactagataagaacataaggcttcgatggcc aaaatgctaagaacaagctaagaacattttcatcAGGCTTttgggactct aaaacacccggtttcttaggaaaacagaaaaaataccaacaaaatggtga aaataagaacatgttaggaacatttttaggcttaaatctcgaaaagttaa gaacattcgaaagctttaaaaattgtgaatattcttataaaaaaaacgtg tatgtcgtttctttattataatttttttataagaactactctacgaggct caaaaatgtttcagagaataagaacaatttacgAATAGTGCTGAACAAGG AATGACTGAATTTTGGCCTAGAAATAAGAAtagaatgaaaataatttttg ctcaAATAACCAAAATAATAATGACAGCTCTTATAAACGATTAAATGATG ATTACTAATTGCTTCCGAAAAGCACTTTCTCAACCTCCTGTTAGTAAAAG AGTTGTGGTGCATTTACactgaaagtttcaagctaatggtccttttaatc ataaaattgttttgttgATAGAGCGATGAAAGTCTAGAAAAGAAGACAAT TTTTACTAGTTCTTGCTGATGTACGTGAAACGTTCGATGGAAAGTAATAA TTGCCTTTGTTTCTTTGAGGTAGGCTCGAAAATACTTGAAATGTTGAAAC AGTGAACTTTAATTGCCAAATGGTTCAAAAAACAAGGAATTGATATACAC ACAAGGATTGCCTTCTCAATGATAAAGGCATGGTCATGGTTTTGACTCGA AGTTTGCTTGAGATACGATCACGCGATCGTGCAAacttagataataagag acaaaggaaAATATCGTGCAATTCTTTGTTCCATATTTTCAAGCAACTTT CAACAGTAACAGTGTGAATACACCCTTAGTACAGAGATGTGTGCTGCTGC ACGTAAAATTCAtatttaatgatgataaaaacgTCAGCAACGGAAACCAA TACCAATTATGTTGTTATGACGTTTGTATGCATTGAgagaataaaaaaac atgtaatcaaGCATGTAGATACACAGTTCTTATTTCTTCTCCATTGGTTA AGctaacagaaaaatcaatgaaagAATTCTTCGATAGCATATTCATCAAG TTATAAATCTTCTCACATTCTCTTTCTTTGACTGGCTGGCACTGATAAAT AATCCAAATAATCGAAAAGTTCAAGAAAAGGATTCTACTGCAACAAACAC CATGACTCTATCAACAAAGTACAACACAACTTTCTGTCACGACCTTCCGA TCGCTGTTGGTAATAAAACATTTTGTGATTTAACAGAAAAGTGGACACCT CGATTCAATCATGGAACGTTATTGGCAATGACGTTGACTCCAGTTTTGAT TTACTGGTTAGTTTTACTTCTGACGGTGAGAAAGCTTTTCAACAAGCTTC GTTTATTTAGACAATGGCGAAAGACAACTGTTAGATATACTCGAAAGAGA AAGGCGTTATTACGTGTGTATTACAAACAAGTTTATCCAAATAGTGATaa catttcttttttatgtGAATTCGTTCTTCCTAAAGGTGGTGGGTATGAAA ATTTGGAAGGAGTTAAAGAACTGTTTGATGAGAACTCAAATCAAGACAGc acttcattttttgaaaagttgagaAATATTCATATTGCTGGTTTGAAACA AAGTTATCGCACAGGGCTTTTATTCAACCTTAAAACTTATTTCTCTTTGA TTGTATTGGTTTTTCTGAAATACTTATGGGATGCCATCGATTTAACCTTG GATGTTTACATCTTCTACCGATTGGAGCGAGGTGAGATTTTGGATGATGC AATTTACCGAAATACCAATGTCAATACTGCTATTTATGTATTCGCCATTC TTGGATGTATTGTTAAGATAGGAGCTTGGAAAGCTTATAGTAATACTGAA AGAGGACTTAACAAAACAGGCGAACGCGAATTTGAAGATACCTTCAATTT CTTGAAACATGCAATTTTTGCGGTTAGCTTTTTTTATGAAGACGGACCTG AATTGATTTTGGAATATTTCTACATTGAGAAATATATCACGTCCTACACA CCGTTGATTATAGTCAAAGACACTGTTGTTGCTTGCCTCTTCATCCTCGC ATTGATCATGATATTGAAGTCCAGTATAAAGGGAATCACTTCACACTACA AATATTTTAGCTTCATAGTAGCCGCTGTAACCAGTGCTTCTATATTACGA GTTGGTGGTGCTTTATATCAATGTATCACCAAGAAATTGAGGAGATCTTG CTTCTTGGTTGACAATGGAAGGATTTTACAAACACCTTTTAATATCGAAT GTTTGAGAGGTGTGGATTATGCTATTCTTGTATTAGTTGGTGTACCCTTC TTATGCATACTGCTCTCGCCtatatattataatattttgGGACCTAACAC GTCTTTTTGGAGGTCCAATGAAACCTCTGTCCtttcgttagttcgttcgt ttgttcgttcgttcgttaccaacttttctgaagattgaatcataggaatc ttttgatttttggtacaaaggtgcaaaatggtggtggccaaaatgtgacg gagcccgattaaaaaaaaaaaaaatttgtgcaaatttgggccaaaaaacg gctaaaaaacgggtttttttggactttgtgaaaaattggatcattaattt tttctgattttttccattaaagtagggtaccattatAGGTAAAtaaagat tattattattattattagtttttttaagatgaaaatgtaCGGTGGggcaa tggtttgagttttctagaaacatttattattttttggctgaaaaacgaat ctttatctataagaattactatttataagcatagatcaatgttcttagcc aaattattattttattattttttctaaacaaagaaaatgtcaccttagag cgcgatggtttgagttttctagaaacacttattatttttttggctgaatg Ntatctataagaattactatttataagcatagatcaatgttcttagccaa attattattttattattttttctaaacaaagaaaatgtcaccttagagcg cgatggtttgagttttctagaaacacttattaattttttggctgaatgac aaatctttatctataagaatcactatttataagcatagatgaatgttctt agccaaattattatttgtattattattttttctaaaagaagaaaatgtca cggtagagcgcgatggtttgagttttctggaaaccttatttattaaggtg tgtatttttctgatagtggattgtttttataaagaaaagcgtttaatagc ttttttatttctttttcaaaagtctttttcaatagtgttgatagtttctt cCAATatagaaatggcgaccacgaccagcgaccacgaccggcgaccagat aaatttgggttatcgagtttatttGCTCTCTCCGCCGTAGATaatgttta aatcaagtcctcagaatactaaaaagtgacctttgaagtaaccagtcatt ttctcgacaaagtgacactatttgacaaaaatattgacagggtcattaac cctttaactgcccatgtcggcatatgccgacatgagcattttcgatttct ttgcccatgtcggatgtcgggatttgccgacatgagcattttcgatttct ttgcccatgtcgggatttgccgacatcgGCGCTTTCCATTcctttgccca aaaatttaacacttctacaaagattttgtattagatggtttgaaatgaaa aaagataatagttaaaagcttttttatgttgaaaaataactattcaacaa tgttcaactcaaaattatagtccttggctgatacttcatatattattcag aaaatgaagtcaaaatcgcTACCTTTNNNCGAACTTTTATTTTTCCcgcg gcaaataggtcgaaccttaaaaaaaacgacgggcagttaaagggttaagt aTGATGTTTGTAAGATTTGttaaaccaaatattttaatcatgctgaatga gatgcctttagtatgaatagatagaacttgtcagtaggaaaaaattggga aggcctgttttagagatatgaatctaatcaattattctattgtctttatg ctgacaaaatgactaatttcgacagaaataacgATCTGATGATGCAATAC AAAGCTTTTCAAACCATNGCAAGAAAGCTAATAAAAGAGAGAAGAAGAGG TAAagcatttttctcttttattttaattttgaaagacTCATCTTTTCGTA ATGCAAACTTGCATCTACCAGGTTTTACAGTGTATGTGGTATATGTTTTG TCTAATTGCTCCaggaaaattttatgaagagtggtacttttcaaatcaca aacagctttttttacaaattaatgcattatttttctttatgaattttttc ttaattttcataaaaggcataattgttggttttgattttttgtctacaGA TATAGTTTAGGCAAGCCAATATAATTTGTCCTTTTTTTACAGACCGCAAG CTTTAGGTAAATTTTAGGTTCTGTCGTGGTGTgcctgtaaaacaacaaat caaattggtcccACCTTATAGTCTACCAAAACCAAGTCCAACAcaggaaa aattcaatataaatcATTCCATGACTTNAACGATTTTGAGTAGGCTACAA GAAATGTCCGATAAGGGTTActttagactatgctatagtctaagacgagt ttcatctaagaggaacaaacgtgaagacggtaattttttacgggagtagc tgttgtcttagactatatcaaTTCGGTAGAAAAgcggaaattttggattt tggttagCGGTGTGATCGGCCGGCCCGGTTCNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAtagtga aaaattatacaagtaggtgctaaaactttttatttttagaaaggtGTATA TAAACCTTTCCAATGATGTTGACACCAACTTGAATTGTGGACGAAAAAGC AACCATTATCCTAGCAAGATGGCCATTAAGAAagacttttgtttatttat atTCTTATGAACTGCTATATGTCTGTATGTTAATAGTTGCTATTTTGCCC TTCTGTATTCAATATGGGCATTTACTGTATATAAAAGGCATTATTTACAA TTATCATANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNAAAAATTACCTTGACCTTTTAGATGAATT GGCGGTGAAAAACTGTTAATCTTTCAATAATGACATGGTGATTAGCTGAA ATTTCACCGTAAATTTAATAAAAGATTGCCGGTTTTCACCTTGAATTATC CTACGGTCAGgagaaatttttatatcttGCATTCTGTGTATAGTCTGATT GGGTAGCCGATATAATTTTGCATTTCTCCAGAAGAATGTGGaaatttgaa gtgaaaaaagattcttttcgaTACGATTTTTTCtgatgatgtaatgttag aaatGTGTCCTAAAaaattttggttcaaattttacATAGACCTCTGAAGG CTTCGAAAAGCTGTTTTTGATCGAACCAGCTGCttgctaaaaatatattc aaaaagaaattttttgttcCGATATTTGAAGATGCTTGAGTACTGCTCTT GTATCATAGAAGGTGTCGTTGTTCAGACGTTGTGGAAAGTGTTGTTCAGA TATCGTGGAGGGTTATTCCTTCAGTCACAATGGAAAGTGTTGATCAGCCA CCGTGGAAAATGTTGTTTAGATATCGCagaaagtcttgtttagacacGGT GGAAGGTGTCGGTCTGATATTgtgaaaggtgttggttgaattttgtagaa atgcattggttgaaatatgctagataaccatggtttttaaaatattgctg GTACCACTACTTTCACTCAAGTGCCAAGCTGAAAAAATgattatcaaaaa atataaaaagatagctaaacatcaaactcaatcaagtccaacaaaaaaat aaacaggaagtaaaatctgttaaaatttagactatcttagaaaaaacttt acagagattgaaaatttttagcGCGCACAAAATCATTTCATTACTTGACA GAACTggaaaaagtcaatatttcagTCTCAACTGACACTGATTCCTGCTA CCATAAAAGAAACTGCGAAATCCAGTGAATATAAACCTTACCTTTAGATG TTACTTCAGGTGTCAGGCATcaagttgaataaaatttccaaaaaatcaaa gttaGAATTTGTTTGTGGGCCTTGATTGAGGAAAACAATCCCTTCTAACT AATATTGTCATAAAAGCTAAAGATGAATACGTTTATGTAAGGTCTTATCT TCAGCCTCCAAATTATCCTACAAGAACATTCTTCTTCACCAGACCCAGAA CCACCATGCTCaaagaaaacaaccattttTTGGATAAAGTTCACTTCCTA CTTGCATCCTTCCCTTcgattttgtgttgttttgattttctctacCAAGT TCGTCTATAANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNAAAATCAAGAAAAGCGCCAAATTGAT ATCGtccgtaaacacagactctatccgccgcgaaacatattacgttttat aatatacaaactatgttatatcttatatcataataacatattatacggac gatagcatcgtctagggttactttagcttgaaaattatgacttCAGACGG ATCTCATTATATTCTTACCATAGTAtagtttttgtgtgaaaaataaAACG TTTTAATGAAGATAATATACACCACTTGTATTCTTTTCCTGGTAATTTCA AAAGTTGAAATGGTCCGGTTGGGCCGGTTACGGAATTCGTCCTATTTTTG TCAATCCGATATTAAAATTCAACCCGACTTGGAGACTAATAACTGCACGA ATATCAGACTCATATGATTAGGGTTTGGAGTAATTCAGTGTGTCTATGGG TCCCACAGACCTTTGAAACCTgagtatatttttaaaaaatgtaaccCTCA TGTCTcagatttctttgaaattattaatgagaaatgaaaatcctgaaaat ttcagcctTGTAGCTTTTTTAGTTCCCAAGATATCgccatttgaaatttt gcccCTTTTTGCTTTGCGGTcccaaaatccgccattttgaatttacgttt tctttaatatttcttttatgAAGAATGCTACAGGGCTGAAATTTGGATTC AGGGTAATTCTGAGGTGAGGAATTCAAATAAAGCATTTAAAACCATCAGA AATGAAGAAGTCTTGACATGCTATAGAtctgttttaatttttcacccttG ATAGATCATGTGACCAAAAAAGGGGCGTGGCCgaactttttttgagaatt ttttttttcatctgaaTTTAGAGTACTTGAACTGcaatttgaccaaaaaa ctaagaatgttCTCCTTTAGATCAGTCATAATCAAAGATCAAAGACAGGG TATTTATCAAAGATTCAAATGGGGAAAGCTAGCAAATATGGTTTTAAatg ctttttttaaattccTCACCTCAAAATTACcttaaatccaaaatttcagc ccTGTAGCATTGTTCATTCATGAAATATTAAAGAAAacttaaattcaaaa tggcggattttaggaCCGCAAGGCAAAAAGgggcaaaatttcaaatgatA ACTTTCCTAGGTTAAAATTTCATAGAAATCTGATATATAAGGGTTACATG CCCTGGATGATTTAAGATGGGATTACTCACCTTGGAAATTTACTATATTC TTGGATTATGTTTTTTCTGCAAAATCTTTCCAGTTCGCTTTGCTCATAAT TATGTTATtacctatttttaaaatttaatataataaatttttaatatgGA ATTGGATAAGATATTGGATTGAGATATTTCAAAAGCTATAACACATTTCC TAGGCTTCAAAAAAGCTGAATCGATTACTGTAGTCTGTAAAGTAAAACGT CAACAAACTGACGTCAACAATGTCTTTACGCCGCTAATGCTTGAACTCTC AAAGTAATTTTGTTTCTAGAATAACATATCAATCCTCAACAAGACCAAAA CTACAACAAAGAAATTGATTTCAAGCGTCGCCAGCGTGGCTGATAACCGC TGGGTTGGATCCGCAATGAATTGGGTCAAACCGTCGTCGGAAGGGTCTGG TAACGAAGTTGATGTTGTTGAGCGGGAAATTGAAAGCGTTCGGCATAACC CATTTTATAGTTCGCTGGATTCGAAAAAGATTGACGAAGATGTTCAAAGA TTTAATGTAAGTAATAGAACCGGGGGATTAGTAACTTTTAAGTTCTCTTT TATCTGAAGAAGctaatcaaatttcagaaaacgcTAGAACTTTTTCCACA TCAAATGACAATGaattttaacaaattattttCGGAGCTGATTATTAACG AattttaacatattattttcGGCTGAGAAATTAAAGTTGAGACAAGATTT CAAATGGGTAAAGATTTTGTCACTgatcaaaatttcatgtttcaatgaat ataCATCACCTTTTTAGTAGTGCTACTATCAGGGtaccactttaaaaaaa ctccgatcaaagattttggctGGCTGGGATTAAGAAACTGCCTCCTGGGT CAATATAAAAAACCAGTGAAGCTACGATGTAACGTTGCCTCAATGCTCAT TTAATGATATATACACggcgttctaaatctaaggTCTTACAAACGTCTTC GGAGAAGTCACCTGAATCGTTTAAAAATCACTGGGTCTGATGAGACTCAC AGCCATTCCATTGGCGACCAGTCCCATCGGCTGATTCTCGTCCGGGTTTA AGGTTGTTTAATTTTGATTCATCAGTATAACAAATTCAGCAGCCATTTGA ACAGCCTGTGCCACAGACCCGCTaggccccagccccactggaaaatttgg caaagatcTTGtctccggtgggaaaataccctggaatttcagccctactg ggaaatggactttgattttatccccactcgaaattccatgtttaaaaatt gcactcaaaaactatccccactgggttttttaaccttggaacaatggaat ttctatccccattaagGTTGTCAAtaggaatttctatccctactgaggaa aaaagctccaccggggctgtgagacaggggtgtatttgaTATGCGTCACA AACACTGATCTCTATCTGCTTGACCAAGctatctttgatcgaagtttttt tttaattggtacccgtaaagaagccattgcagtgttaaaaatcaacgtat aacggcgctacatcatcaaacgTTTTCGAGgtaaagtagatctagcgctc tcaaTGCATTTACACTGCTATTgtgtagtgccgccattagggtattactt ttcaaaaaaactctgatcaaagattttgctcggccgggattgagaaactt ggttcAGGGtgtataaaggtcagtggtcacAACCACTGATCTCTCTATCT GCTTGACTGGATCGGGTATAAATTTCTACACTTTTAACTTAACAGTATAA CGAGTTCAGCGACCATTTGAGGTGCGTCACAACCGAAGAAAAAGTATTCA ATCAGCTGGTGTTAAGAAGTCAAAAATTGAACGAGCAAAGAACCCTGGGT AAAGAGCTCGAAAACACTGACCAAGGTAAGTTAGACCTACATGCTAGACG ACCAATTCTGACATAGTAAGAAATAAAGGAAAAAGGAACAAATTGTAGTG GTTTATAGAAACTGATATTATCATGTTACGATTATTGTATTATTACATAT AACAAcgatattactgtattacatggattataaacgactcctgTCTAAGT AGGCAAGTAGCTTGTAATGAAAAAAGTCTAACTTCAACTAGGTTTTTCAC CATATGGTTTTTGTCcagttgaaaaaagtcataagGGCTTGGCTGAAAAg tcaaataattttcaatatttgataATTTTGTCCTTATCTGAAAATGCATC ATGTTTTTGTTAGCCCACCTCCCCTGAATATtgctgggggctggacccct TGCATTCTATGACAAACCCTCCGAAACATTGCAGTAGTatagccaagagg ggcgcaaaatttgtttaggagagcagatttttatgcaattataattatct ttaataccatgaatatataattacagtgtcatgaaaatctgctctcctac acaaattttgcgcccctcttggctacgctactgcaTTGACATTTCTTGGC TCTTTTTTTCAGCAATGCTATCGTTGAGTGATATAGCTTATACTGAAGAA AGTTGTTTGTGTCTGGCTTACATGATGGCTATTTCTCAGGTAGGTTGGAG TTCATCTATTCATATATGATTTTGCCAACTGATCTTGTAAAATCAATTCA CTTACTTAGTTGGACCATCAAAAATGCAAACCATTCGTCTCAAttcttat tcaacatttttttagCGTGCTTTCATTAAAAGGTTCTAAATCAATGGTCT ACGTTATGTAATTTTAGAAATAAGGTATGTCATTGTCAATAAAACAATCA ATTGACAAAGGGcgtgctgttttgttttgattaccTTATCGGTAGAAATT TCGTCGGTAAAGAGTGACGAAAATATCGCTTAGTGACGAATTTTTTACCG ACGAATATTTTTTGCGCGGACGAAATTTCTACCGATAACGTACACTCACA ATTCCTATGATCAATTACTAAAAGAATACTAAACCAACGGTTATTTCAAT TACAGAAAATCTGATTAGTATCGGCTTATTAGACTTATTACTTATCAGAT ATATTAGGCAAGAAAACTGGAACATTAATGAAACAACTGTTATATTTCTA GCCAAAAGAAATCCATTCCCTATCGACCAAGCATCGGAAAAACACTTTCA CTTTCCTTTTCACTGCTTATTACTATGCATTACAAGAATAtgttaaaaac aacaaaatcgAATTCGATAAACAAGCACAGATTTACAGCGCGCCTCCGAT TGATGTGATTACATGGATGCTAAAAGTGTTAGGTAAGATCGTAAAAATTT TGGTACTGTCCTTTTGAACAATAAAGTTCTATTTGTCTGAGATGAGttat ttagaaaatgagcattatggagCAGTatactttccattcatgtttcaata aataggatctcctctacagatcacattttacaaactactcATCTCAGACG TTTTTTCCGTCTCAATATAAATGGAACTAATGAAATTTAAATCTGATGCT ATAAAAAAGCGAATTCTTAATGTGAGTAAAGTGAGCGGTATTTCATCCGG AAATTTCTATACACATTCCAACGACTGTAGCACAAAGGTAGAGCATTCAG CTACGGTGCACGAGATTGTTGGTTCAACCCAAAGGATGGTCCTACCGAAA CTGGAAAGGTTCTTCTAATGCTAAGCAACTGAAGAGTAGACGTAGTCTTT TCCTACCTTGGGGTCATCAGCAATATGAAATCGACCTTTAGTGCATGGAA GCGAAACTTCATTCCTTAAAAGACGATTATTTTCTAGGTAAGAAGCAAGg agaaaaggaagaaaaagaaaaaggagagACTTACTTTCTGTCTAACATGA ACAAGTTGCAAGACTTGATGCAAGCAAAGATGCTACAAGCTCTTGACAAA GGTTCGTTCCAGCATTaagaattttactttcaatcNACTACAAGCTCTTG ACAAAGGTTAGTTTCAACATTaagaattttactttcaatccgacGTTTAT GTGAAAACGGTCCCAAGTCAAGGGTGGGAAacatagatatcttatataaa acacaaCATGGAGCTTTTCCTacaaaataatgcgccatcttgGATGAAGT GCTGTCACAATTTTGTTTACGAGATCTTTGAAATGTTTAAGTCATTGCaa tgtcaaaaaagtttcaacagtgaaaaccaaggtttctactgtgacctact ttcagcaaagatggtggattatcccgggggggggggggcactgggtttgc agactgacggtatgtgcgggccaaaaattggcttttaaaattgcaccctt acagtgcagcagaaatcagtgaaaatcatccccttagagtgcattttccc ccaaattttcgatccttttcgtgcaaaaaatggtcaaaattctagcattt ttggtcaaagtatctagatttttcaagaattatctgaaatttctaccctt acagtgcatctctagtttttccgacacttacagtgcatttttaacatatt ggaaaaggtacccttaggacccgcacatacccgtcggtccttttgcccag ctgccccccccccccggggggggtatTTTGCTTCAACTGctgtttcttga aaaaaatacagataagctctatctagtgttttaaaTACGAAATCTGTGGT GGGAAATGGGCTTTACTTCCCATCCATAAATGTTTCATCTCTGTCCTTCT GGGATTTAAACTCAGTGTTAATCACAACAACCAaaatatttaaaggtttt gtttttaaataagagtgatatcgtttgcttactcaattttaattcacaac cTTTTTCATATtcgattgacacggatgtggagcaagattagtcagaaaga ggaaaagaaaaacattttttgcttatatcaacataatataacaatgagca gacactgtcctggtatgaaatatgtgtttgatatgaaacgggaacactta tgtaaaaataaaacctttaaaatatattttatgatttttaggaGTGGACA TCGAAAGATTTTCAGTTGATAATGAATATAAACGTGAAACTATACTCGGA TTAGCTATGTaagttaaattttgattttaattttaaagcGAGCGTAGAAT GAAGGTCAAGCATCCAGCTACGATGCGCAAGATTGTCGGTTCGACCCCCT GTCGGGTCATATCAGAGATTTCCAAAAGGATACTCGATGCCTATTTGCTT GATGCTCGGCAACTAAAAAGACGGATCAAGGTTAAGTGGAGAAATTCAGG GAAAGGAGTAGCGCTCTCCCCTACGTTCAGGTAGACAACTAGAAAAAGAG TAGCCTTCCTGTTGCTCTCGACAACCTCAGATTTATTACCTGCTTGAATG CTTTTCAATTTTCCCAAATACTGTATCAAGAAACTTTCGTGGTTAGCCTA AAATTGATTAACATTGCCCAGGTTTCGTTTATTAGAACTATCTCAAGAAT ATTAGTTGAGGCCATAACAAGTTACAATAAGAATATCCAAACCTAATCAT TTCAACGTCAATAAGAGAATAAAGCTAATATTATGAGGAACAATTTCAGA ACATTGGAAATCACTGAAAAACAAGAACAACCTATTTCAATAATTTCGAG CCTCAGAACAAATTACAGTCAACTGTCTCTAATTTGAATCTCTATTATCC GAATAATTCTGTAAtttgaactaaaatattggtcccctcagctggaaatt actcctctctgtaattcaaatatttctctaattcgaataaaatttttgat cctttgaagatcgaattagagagagagtcgactgtacctgtttcttttaa aaacgaaaatatttttagactaGAGAATTCTTTTCCTATATTCAGGAGTG TCGAAGACGAGTTGATTAACACAAGTTTGCTGCTAGCAGAGAAATATGAT ATCCCCGCATGGGAAGTGTTGTTATCACACGTGGAATTTTTATTCACTGA TAGTGGGTGAGTCGGTTATAACTTTTGTTTGGGCTATTCCAGGATgggtg acgtccagggtggtctggaagataagaataaagggggggggggggtggtt tTTCAGGATGGTTGGTGAAAATAaatcgaaaatccagggtggtccaaaag tCCTGGGTGgttctgaaaaattgaaaaaaaagaaatccagGGGGTTGCCT TCCCCAAAAAGCACCTAAACATAAAGGGTGTACAAACTTTTTCTGGAACG GCCCTTTTGATTTCACTATTATTTTGTATGTGCTGTTGTCGTGGAGTAAC GTTAACACATTTTAATTTTCCaccttttaaataaaaaaaagaaactatca tttTCATTGGCCAAataatgttagatgaacgttagaAGAGCGTTTTACCA AATAGGATTTACCAAAAAAAACTAAAAGCTCTCAATGGATTGATCAATGG AATACTTTAACTcgaactacaatcatggtcgtaatatttgagaaaaaagg aaaattcccgcgaaatcttatagccagccacaatcgatttggaagcgctc taacttaggttggaagggtagagttttaactctgacttTTAACATGAGAG ACTTGATCTGacgatccaaaagttcaaaaatggtccaataagactcataa tatagcctggaagtctataaacccgaggCACATTAAAATATCCGATTACA TTTATaagatggcccaaaatcgactttctcgcccgaactccaaattttga aaaacgaggaaataagcttaattctcaatagatttcgaccatgattgtaa gtTTAAAACATCTATTTTTCATCCTTTCTTCCAGTCTAAAAGCCAAAGCT ATCCGCGAATCACTAAACAAATGGAAAGTTGATTCCCATTTGAAACCGAA CGGTGATAAAGTCTTTGAGCGGATGAAGAAATATGTTTACCCAGAAATCA ATGGTAAAGACCACAATGCATTGCTGTTGTTCTACGTTTTCCTAATGAAT TGCAGCTCGCCCACTAAAATATTGGAGGTAACGAATTAATGTTGAAACTG TTTCTTTGATTTCGTTTGATTTTTGCGAATTAAGAGTTCCGTGCTCTTTC AAGTTATAGAAAGAATgcgaatttcacttttttaatttttttgaaattta attaaaCACCTGGTCGGCATTTTGTGTTTTGTGAtgttacttgaaatttt gatatgGCATCACTTTTTTGGATCACGTCACATTTTCCTATGCATTTTCT TTAAGTTAAATTTCATGGAACCAAAACCATGTAGTCGATTTCGTTCTATT GTttctttttgcttatttaaGGGTACGCTTACATTAGATGCTCATTCcaa acttttgaagaaaatcaaGGCTGCTGCATCATCCATCAATTACAAACTTC TCGTGCATGGAGATTCACCTTTGGAGGTGATTAGAGACTGTGTTGATGAT AACAATGTACATTTGTTGGCTAAAATTGCATCCAAAATCCCCCAGGTAAg attattggcccagcgctagcgatagggcctttcatttgcaactttccgtc cgtccttccgctgtctgtccgtccgttttggtagaaacggcgcttaaaac cagtacNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNTAAATAAAATGATcaattctggatctgtcgcattaaacgga cggtggcttgatttttcaaactcgactcacataccGTCAACcgtctctaa cttgggacgatttgTCGAAACATTGGACTGTTGCATAcctatctggtctg tattttcacttactgtaaaatcgaaagagaaatcgtgtatttttaaatac gcctttccttaactcaaatcaaatgattttggaagtttggtgaaatggtg gccgaattgccgtcccatgttttttcAGGTAGTCCCAAGTTGAAGCAgtt gatagtaattatttaaagtatataaactgattctggaatctgttaatgga cactaaaatgcagctcatgggtaaattcaaactagattgaaCATTTCTCA TGGTTGCAAggcatgaacagtgaaaatggtcatttctggatcttcgcatt aactgttaactcacattaaccacatgaattttattaaCTTGGATAtgcta acctgagatcagattgtggttgttttctgcccaccacgctgaagctctaa agggatgggtgaaaacatacaatctgacgaatatgcaatctcgaaatcgt NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN Ngacaagattcttgttgtagaattttccgcgggaggactattttcctcag atgtataattttcaagtgtctttagaggtttaccgtgcacgtaagaaaat taNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNtaaaaactatttcaccgtctagttctttaaagatca tttttctggtctacggtctggtccaactaacatgcctgcagggatatttc tccctgcatatgggagtgcacctaattcgttaaaaagtgcccactcacta agcagaatattcggggaatttttttatttttttctatgggcgcgcataat ttatggaaaaagctgaccttgtgaaaaaagatgaacaactgaaaatgaaa acacaggctcatttctaaacaaaatggcNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNa agttttttgagtttgtaaaagaggttatatggtaagttaattatgtgtgt ctgcctgggttttgaTAGTCTGNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNtgtcttcacttt gatccatgtcaacggggtcatacatttgctgttttgcacgcttgttttca acacgttacttttcgctgggccttcacgcccaacgggcttcttgtgtTTT ATACAAAAAGTAATTCTTCAGTCTTTTACAGTGCTCGATACATGAGTAGA GCGATGTCagtcaggaagaaaagacatttttggacctacctccgggtacc ccggtggaggttctataaattaacccatgtccgttcgttcgtccgtccgt ccgtctgttaccagcttttctcaggattggNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNttaccagcttttctcaggattggctcattagtt ttttctgattttttgcacaatgatgcaaaatggcaatgcccagaacgtga cggagcccgatttttgagaagaaaactatttgggcaaatttgggccaaaa actgtacctaaaaatagggttttttagactttgtgcaaaatcctgtcatt acttttttctgattttttgtgcaaagatggagggcaagattctctaaaga atggctgaagtggtttttcccggaaaattcttattcgccgtattttggga aattccctttaaccaaataagaaaatatagcttttctcaatgttgactcg taatttttttctgattttttgcacaatgatgcaaagtggcaatgcccaaa atgtgacggagccagatttttaaggaaaatttttttgggctaatttgggc caaaaacagcttaaaaggtttttttgggcctgaatggtttaagtgatttt cgtatttggggaaattcctttttacattattcaacacacaagctttattt ttccattctgaatttttgtacaattattgtcacttttttcttatattttc atctgatgttaatcattaggtaggtccattcagcatgttgcttgttcagT TTTATCTAAATGTTACTTAACGCAAGAAGACATGCCATTCTGAAGAGAGC GAGTTTTTATACAACCGAATACTTACACCCTTTTTTCTAACTAATActac tatataagaacataaggcttcgatggccaaaatgttaagaacataagtta agaacattctaaggctttaagtactctaaaacaccatatttcttaagaaa atggaaaaaaatactcacaaaatagtgaaaataagatgATGTTACGAATA TTTTcaggcttcaaactcaaaaagttgagaacatccaaaGGAATCgcaaa tttggatgttcttataagaaacgtGTATCTATAATAAAGAGGATTTCTAG AATGggtaattcaaatttttgtagtTTTAAGTAGATGCAAAATTGAGAAC TACAAAAAGGTTTAAAGTTACTAAAAATCTAACTTTGTTAAATCTTATAC TTTACATTTACATGACTTTTTTTTACAGGCGGATGGTAGTTACCTGTCAT CAAACAAGATCTTCTTAGCAAACGCCATTCGGatgttttggaagaaaaaa gaGAACAAGGTAACAATCTAGCATTTCTTCTTTTAGGTTTAAAAACTACG TCTTCTAGGTAGTCATTTTTCTTATCCAATTCTCAATTGTAACGAATCAT CTCTTGTAAATAATAGCCGGTATGTCCAAGGCACATTGTACTACTTtaca tcaactttaaagaaaagaaacataaacataacaTAAACATCCCACCTCTT ATCTGGCATATTTGGAAGGTTTAGAtaacggaattttgcaagaccgctTC AAGGATTTtacagcgggaggtctggtaacccagctcTCGTTTTCGGGGAT ATTGGTGgatccaaccgaaatattttcagGTTTACCTGCAAGGGTAGTTG AACTCGACTGGGGATGCGGTACATCAAAGGTCGACTACCATTCCTCTCCG ATCGGAAATTGGTccactcctttagagctttagcgtgggccaatcggcca tcggaatatcagataactacCTCCCCCCGAGAGTGAGTGCACTTTGTATT CAATGGTGGTGTAGAGTTAAAGTCTTAAAGGCCGGTCTTCACTTACgtgc gctgcgatcgcactttttggcttcaatcctttttgcgtcataaaaatgta gcgcgcgctcaaaaagaaagttgaacacatttcaacttttttcaaccgtt atgtcAGAacgcgccaatggaattgcttcatttttcttttgaccaatagc gtggaaactttgctcgaaaaagtgcgatagcagcgcgcgcaagtggagac cggcctttaaggCTCTTGTCTTTTGTTTTCAGGATTGGTTGAATACATTC GAAAACTGTAAACAACACTTCACCAAACTCCTGATAGAAGACGTTGTCAC TTTTGCTGACCATGCAATTTTTGGCGAGGAAGCTTTAGACTCGCTGACCC AAGACACCAGACTGGAGATTGGTAAAAGAGtaataaaatatttgagacaa caACGTGGTCAAGACGAGACCAAACAAAGAGGAGCTGACGATTAGTAAGT TGAATGAGTCTTGTTTTGAACTTACTCTTGATTTTAACTTGGGTAGCAAG TTGAGCAAATTTACAACCCTATTGGAGATATTCACTGATCTCTAACTAGT TTGGCTACCCATATATAtgtgtgcggacgggacctccgaataCCGACCTT TTTTTAGTGAAATCTTTAGTGAAAAAGTTCCCCTTACAAAGAGTTTAAGA AAATTCGATTGTTTAAAAATGTctcacccttagagagacttttttacaat ttttctctcgaaataaaaaataaaaatcgtgaattttccgatCCTTAGAG GGACTTGATTTGTGTAACCTTTTGAGAGACTTTGTAGGGTGTAAAAATCG ACCTTTATCGTCCGCACATACTCGTTTTTGCCCCCGCCCGGATTTGAAAT TATTACTTCTTAGACAATTCGGCCGTCCCTTTATTGACTTCAGTTCATTG CATTAATTTGTTTTCGTATCCATTCAGTGATTCGCTTATGGAGCGCTACG ATTCATCTATCAATGATTTGGAACTTTCCATCGAACATCTCAAAACGCTG ACTGATCCAATTTTCAAAGCAGTCTTTGGTGACGATAACGTAAGTAAAAG ATTATCATATGGCTGCGAAATATCTCTTTATTAGATGTTATCACTTATTT GAAATGGATATGAGAATCAAGgcttgaattatagaaagtatattgTGCCA TCATTGTTATGTGATCAAGAATCAATTTTGACATGAGCTTAGAGTGATAC AAtctaaacttttcttttttcaccaaGGTGGaggttcaaaatttatgaca gAGAGTCTttatcatagatttataaagcccggctagatgtcgtgctttgg ctgaaaagtgttaggttaggtaggaaatcctacctaggtcacgtgacata aCAAAGAAATttagcgcttgaccaataagaagaagctttgcgggttttcg aaagcaatagtagtaatattttttgcaatattcacttttttttgcttgga agagcttaaagcacgacatctagaccttcgggctttacagaaatctgtgg tcTTCGTTTTCTCATAAGGGGTTATAAGGAGCATGGCTACAAGAAACAAT CTCCATCATAAATTTTGACCCTCCCTTCGATCCGACACTGTAACTGTAAC TGATATTTATAAAGCACAATGTATCATCGGGAAGTTCGTAAAAGTTGAAT TTTATTACAACGGATCTGTCCAGTAGGTTCCAAGCAATTCATGATTTGCa caattgcaatgtcttccacgaacccaacaactgattggttgaaagtgacg tattgactgattttacgtcacaaccaatcagctatttgggtccatgatgt aatattagaagacattgcaatggtgcatatcatgaataatccCAACAACA GACATATTCTCAATTTTACTATTCTCAATTATGACTGTCATGCTACAGAA AGAAATATCActgattttaattatttttttcccttCGAATTAGGAACTGA GCAAAACCTTTGGACGAGTATACGACTTATCACGTGGTCGAAAACAACCA CTCGAAAAACTATTCCGTGATTTGTTCATATCGNATCACGTGGTCGAAAA CAACCACTCGAAAAATTATTCCGTGATTTGTTCACATCACTACAACCATT AGACAAAATTTCGAAACTGCGGAGTCTTTGTCGCAATGCATCTATTGACG TCCGCACGTGTTTCCAAGATGCTTTGCGCGGGATCCTGAGTGACATCCAA AGCGATAGGTAAAACCTTTTACTTTTTAGACCTACCTCGAAGGTGCTTGA ATTTAACCTgtgtctgttcgttcgtctgttaccagcttttctcgcgattg attggctcattagttttttctcattttttgcacAACGATGCAAAGTGGAA ATATCcgaaatgtgatggagcccgattttggagaaaaaattgcttttttc tGATATTTGGCAAAAAGATAAAAGTGTAAGGTTCtctaaaagatggctga agccgttttttctggaaaagtttttttgccgtaAACATCGAgaaggtcca ttcagcatgaaGCTCGTTTTCTATATATTAATaaccgtagtctgtatgtc tgtttgtgtgtcactttcgatttcgcaagcaatgttttgttctcgataag tttgttttgattaacagATCGGATAgggcctggtttagactttattcagc cttagttttgaaatttaaggcccatctacatttagtaattttaatttctg cccagctttACCCGAccctgtttttctcttttcttttgtttgaaatgttt tcgaatgtatttaacgaacGTATTTATTAATggcattcgaattcttttca aaacaatacaagtttcttttatagaaaagaacatttcaaatgtaaatcaa aacataaaaattaaaaagtttgtcgaacaataacagcattcacagggcga taaaaagcaagaaaagaaattagtccatctcttacttcatataaaaacat tcaagtggttgatactgttaaaaactgtacgtcattttacatgtttaaat tcgaaaagttatgacaatggtttaaaaaaagcaatttagaattgacttat tttatctttttaaatctgataaaaactgTGGCTTTCCCGgctttttcctg aagaattgtcatttctacatttcactttctcaaattgtcgaaaacGTTCA GCTACAttttaaccggcgtgcgacgccgggtaccggctactTTCTTTATT TTACTACTGTACTTTCGGAAAAAGGTGTTTTTTTAGGGACTGAAATTATT ACGGTAACGATAAAAAAAATCGTTCATTCCATAgaagtcaaattttcaaa gacaatttaGTTTattaaaacaacattttaagATACAACATCAGTTACGA GGATTTTGGTAAAAAAGATGccctgttttgtttttttcgagTACACCTTT TGGGTACGTACCGCAAAAAACTTCAAGTTTGATtatctatgtttttgttt tactacaaggaaaataatttttgcaggaACTTATTTTCGAGGTCGGAAAA AAGATCCAAAAAATTATCAGGAATCAATATCCGCGGTTTCGCcctatttt tgacagattttttttttcactcttttagcgatttttcaattttttttatt aaaattgaaTAACATTTAGCCAAATTTGTAATTCGCGGGTTCCaattttc gaagttttttcttAACTTTGATTCATTCTTGAAATTTCATTGGTCAAATT TTATATCCACTTCTTTCAGAGATTACACAAAACTACAGACTTTAACGGAG AACATCAAAGCGCATCAAGAACATCAAACAGACCCTCTTGTTACCCATAG CGACGTCTTAGATGTGGTGCGGCCATTTTGTTCTGATGTTACAGCTAGCA CGGATGTGAAGAGTCACGTGTTACATNTTTTGTTCTGATGTTACAGCTAG CACGGATGTGAAAAGTCACGTGTTACACATATTGGAGAGTACAATTGATC TAACGGATGATGACGTCAGTTTATTATTATTCTACCAATCACAATCGATC ATTGTTCCGGTCTGGAAAATAGAGGTTTGTAAGACCCACAAGCTTAttta aaataaagaacaaattcCACCAGACTGGGTGGCAAATAAAGCCATCCTGC GGCCCGCGTAATTTTTAAACATACACCGGATGAAAGTGAaaccttttgat aaaaattcgaattacagagagtaatttagaCCACTTTCCAGTTGAGGGGA CCAATAGTTTCGTttaaattacagaaagattcgaataatagaggtttgAA TTGAGAGAATTAACGGTATTAATTTTGATACAAAAGCACAAATGTTCTAA CACTAATTATCAATTACGATGCTGAAGAAGATCTCGACAATGATACTTCG ACTTCTTTTGAGGTCAGCAATAATTTTAATATAATTCGAGGATTTGAATT CTACTGCATCTTTCCGCTGTAAGCAGTCTCCTTATCCCAAAacttattgt ttttataaaataatcttGTAATTTTCTTCaactgttgtttttttcattgt tagGTTGAAGCGTCAGACGTAGAAACAAACGATAAGCGTTCAAAATTATT CGACAAACTTCTCACAAACACCACTACTGATGAACACACTGAAGGCTTGG AAAAATTGCTTCGATCGTGGCCCGTATTCAGGTATATACTGTTTTCTTTC TCTGATTCGATCTTCAAGCGACAAAAAACgttgttcgaattagagaatta ttcgaattacagagactattttatactactttcaagctgaggggaccaat aatTTAGTTTGCATTATCGAAAGGgcgtgaaaaataaatatgacaTGGAG GACTGGGGGTGTAACCGTAAAAAAACGATTTTCTTTCCAGCCCAGCAAAT TTTCAAACCGCTGAGTTTTTCCAATTACGActgcctatactagacgtcac ccacGTTTTTCTACGAAATTAATGACTTTTCGATTTTGcgactcactaag aaacggaatgaaaaatcccgggTTTTGGTGAGGTGTTCGCTGATTTACGG CATTTGGCTTGGTTGATATAGCTGTGTTCGATGTTCTCAGTAACTTGGTG GACCGACCAAAACTGGACCAAATTACGGTGgccatttttcaaagtttggt ATCATCCCCCTATCAAAATTATTCGACAAACTTCTCACAAACACCACTAC TGATGAACACACTGAAGGCTTGGAAAAATTGCTTCGATCGTGGCCTGTAT TCAGGTATATATCAAAGGAAAAATTATGCGAGCCAAGGGAGACTTTTCTC CTCTTTTTTGCTGAAAACTGCTAGGGTTTATAAAAGCAACTAGGTgccta aaaaataaatcacagGTGTGTGTCTTTCAGTGCATCAAGGAAAACCATCC CATAAAAAATACGCACCCCTCCCACTTGTCACCCCGGTATTGATCATTTT GATGTTTCGCATATTAAGTCCAGTTCTAGGTCGAATTACggataaaaatt caaataatttgTTGTTTCACAGATAAAAGTTATGTACAAAGTGCTTAATT TATCATAAaacatataatatataataatatttaaaTACTCATGTTACTGT GTAGCAACTAGCTAAGTTTGCATTTGCCTAAAGGTCCTGCTTTTATCGTT TGTAATAAGCGCACTCATTAGTGCTTGCCGTATACACGATAGTGATAAAT CCAGTGCCTACAAAACGGCTGATTCTAATTCGATGTTCTACTactcgata cgctccattattcgataattttGAAAGTCACCATCAACAAGAAACCCTCA AAAATTACAGTCTACTGTTCGATACGCTCCGATATTCAGTGACAATCCAA TtcccttaaaaatcaaattagagagtgtcaactgtgtGTTGTGTGAATTA GGACGATTTTCGTCTGATTTTCATCTCTGTTGTTTTCAAAGCAGTGTATT GATCATAGAAAGTATCCCATGTTATTCCTTGACCCTGTACTTGCAGCACT GATGTTTGAGAGTATGGACCATTGAAATTGACACTCGCACACGCGTTAAA CCACCAACCAGCTCTGTAaaatacaacaacaaaaaatttaatgataatTT GTCACCGATCTGTAAATACTTAACTGGATTGGGCCTCCCATATAAAAGGA AGCTTGTCCAGGTTTAATGCTGActagtccgccatcttgtttttgaTTCT GGTTTTCAACAacgcgattcgaatgttttgaaattcaaacgttcgaaaat ctaaggTAAATTAAAAAGCAACATGGCGGACTAGCCGACTTCAAAACTAC ACACACTTCCAAATATGTGAGCAGTTAGCCTATCTAGTGTGTAATACCAT GTCCATTCAGTAAAGTAAAGAAGATTTAGCCCAAGTGTCGATATCGATGT ATAATCCAATTTAGAATTTAACTCCTTGACGTactcaaaaagctaaaaaa tcgcattttcaagatttttcaatGCTTAAACTTTGAATCGAATTATCTCG GCTTCGGTGATAGCTAAACTCTTAATGTTTGGCACCGTTTGAAAGCTCCT TAAGCTCGTGCCAGATTTTTGAATTAGGTCCTCGAAGCAAAACTACCGGC AGCcgaaaaatatcgtccctgaGAGAACAAAATTTTGCAAGTGGGACGTC AAGGAGTTAAAGCTGCTTTTTTTATTCATAAGTTGTGTGGACTGGCGTGG TGGGTCTAGTTTAAGAGTAATATATACTACCAGATATTAGAAAATGTCAC GCCCGATATTCTAGCTAGCATAGAACCTTTGTTATGATAGATTCTACATT CGATGTGTGAATTGGTCTTTTTACAAGTATAATTCTATTGGAACACGAGG TGAAAATTTGAGAGGGTAATCTGAGCCTCAGAAATGGCtggttttgaaat taaaataaaacagCCGTAATTACGGCTGCAAACTCCGGTCTTTGACCGCC CTCGATTTTGCAGGTTAGAATTGCGGGTTATTGCAAATCGCTTCactcac tctaccgtcctcaaaagtgaagatacataaactcgctagtgTTTATTTGG GATACAGTAATTGCTGGCTGCATATACAGCAAGAAGAAGTTTAGCATTCT TACCTGTCGAATATTCACTTTAATAACACGAAAAGCTTATGCTGGAAATA TTTgtcgaaatgttttttgaatcataactttaattttctaGCTATTTTAT TACAACAAGTTTAGCATTCTTACCTGTAATATTCTGCACAATTCATTCCA GCCAAGTCATTATCTTGATCCTTTGTCGAGAAACTCTTTGCGCTCATCTC ACCCCATGACACACAAACCGATCTGCCTTGACAATTGAATCctccaaaat tatattttgctgCCTCAGGTGCTAAAAAGAAAGGGCTATACTTAACCGAT GCTTTCAGGCCATCAAATCCGGTCGCTTCGGCTATCATTTCCACTTCTTG ACCAACTTTTAAGAATCTGTCGGTGTATCGGTGAACCAATTCATTACCAA GCCAATGTTCACCGTAAACATCTCCAAACCCTTTCTTATAAGACTCCCAA TCACGATTAAAATCAACAGAACCATCAAATCGTTTCTGCATGACAATCCA ACCACCACCCTCTGTTGTCATATCACAAAACGCTTTCTGTCGGTAACCGT TAAAATTGATATAGTAAACACCATCTTTAGTGTAACCAAGACGACGCCAA TCCAAACAATCCATTTGAGGATTCCCTTTTGGAGCTGAGATTGAACTTCC AGATGAAGGTGTTAAATGCATATTAAGATCACCCGTGAAATCGAACAAAG CGCATGTCAGGGAATCTCCAAACTTTGTAAGCTCCACATAACAGCATTTA TCAGGAGATCGTTGACATAACATATAACATTTGAATGGGCTAGTCATGGT TTCTTTCAAATATGGTTCTAACCCGGTAATTGAAAATCCATCTTTAACAG ATTGGAATCTCATTTGATGACAAAATACTAAATAGTCAACGCCGTGTAAA AGTATCAGCGATAAACCAATCAGAAATGTGTGTTTAGAATCTctcatttt gactttaatttATTCAAATGTTACCACTAACCAGTTGAAGTGGCAATTAG ATAACTGGAACTGGTTGGAAATTTAACTCCactaaataaaatgtttttga ttttaatcTTACTTAAATCGGTGCTTTCTCGGTAAACTTCAAAAGAAATG GCGAGTAAAGATATGTGGAGGAGTGCTAATAAGGGATGATTTAACCTTTC TATGTAATAAAAATGTTCTCCGCCGTAGATCATTTTTGAGGGTTTGTTTT TTACACTTGATTTCAAAGAGAATGAATAAAAAACCACATTAAATGATCCG AATCATTAGATATTCACTTTTTCTGTAAAACgcataaatttcaaatttat tgcGGCTATAAACTGGTACAAAATAATTTATATTTGCGGTTCATTCGGCC GTTTTTAACCGCTTGAATTATAAATTCTGTATGATTTCTGAAGTTTTTTT GCGTgtgaatattttattttgattcaatGCAATTTCATTTGATTTATTGA ACTTGTTTGTTGAAGTTGTTTGTCAGAATATTTTATGAAGACTTTCCCCA AACCCAAAGATCACTCACTACCCATATTTTTTGTTGTTAGAATAGCACAA ATCGGAACACCAAACAAAACGTACATCCGAtcattatctgatattccgat ggcggattagCGGCCGCCCACTTTAAAGCTCTAAAgtagcgggccaattt cccatcggagaggaatgatagtcgccTATGGTGTGCTGCATCCCCAGGGT TCAATTACAATTGCGCTTAGAGGTAAAAATCTTtcagttggacccgccaa tccccgaaaacgagggctcgGTTACCaggcctcccgctgcaaaatccttg acgtggtcttgcaaaattccgtaatctaaaccttccagatgttgaagaTT TTTCCGACCTTTGGatctttagcgtgtcggatgaaagtttctgcatctgg gtgccagataaatcCGATCAAAGAATAAATAACATGTAATATTTATGCCA TGGTGACCTTATATAAATTCAATGCTTCATATCGCCTAAAGAGTGACGGA GTTTTCGCTGGTCATTGTATAGCTTCCCGCGTGAGATTCAGTCAATTTTA GACCCAAATTACGTCATCAAGGGCTACAAGCTGAATTCTAACCCTAAGTT CATTGAATATGAGGAGTTGTCTTCCGAGGCTTTGAAATACCCCCAGAATA TTATGGTGTTTCCGTTAGATACTGTAATAGACTGTTGCCGGTTGTATAGC TTCTCAGGTGCTTAGAACCCTTCCCCCCAAAAGTCGTAACCccttttttt ataaagtttttgaaaatgtttctagtttaagattttgaaaaccCTGCTGA AGTCCAACAAAGCAGAAGATGACTCGCTGAGCTTGACTTTGCCCCCTATT CGGATAGATCCCCATCTAGAACCCatctagacgatgttatcgtctgttac agtgatagtaaaggcgggaaaatatggcggtatggcgttatggtggttta cggaaaaaaaaattctaccagctgtaaactcttttcggcagcTCAGctcg tttgcgaattttcttcagctttgggcttatttcttagatagtgatttgtc caCCCATTCTGATAGCTACTGGATGGAAGGCTCATCGCTATACCTATCTT CTATCCATGTTTTAGTGATACGCCTGACGAAGAACATCCCTGGATTCGCC TAATTCTTAAGAAAATTACACTCGAACATGATAGCAATATTATCGACATT TTGAATTACGCTAAAGACACTATACCGTTTAATGAACAGGTAATATTATT CAAAggttatatttttatataagtgttcctgtttcatatcagacacatat ttcatatcaggacagtgtctacctattgttatattatgctgatataagtg aaaaaatgttttcttttcctctttctgaccaatcttgctccacatccgta tcgatccaatgtgaaaaagcttgtttcactcttatttaaaaacaaaacct ttaatttgaTTGCCGAATAAAACAAAATCGCTCTAATCATTtcggattta aaaaaatcaggtTGGCTGAGTTTTCTGTTTCATTGGTACGGTGTCCTTTC AAcgaaaactatttcaaattcTGGGTTGATCTATTAAAAAAGTGGATACT AACTTGAGAGaagaaaatagtcaaaattttgtttctgATGAGGCAGAAAG CGAGCATTTCTTTCCCCTATGcaatacgcatcccctatatcaaattaacg atgtaaaaataatagataaccaactacctctagaaggcacttctcccaag agaacaaccattgttttcctattgaaatgagcactctattAAAAAGNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNtatttactgca aattttggattttttttcaaaagataaaggtaccaatctttagacaaatt gactacggatcggcctgataccacttaatcttcatctggataaagaaacg ctcataaaatgctgttatctgaaaaatatatgtgcgatttgaaatgccat atctcacgtatgaaaagtgcatgaaggttgcatgatacaaaataaacaga tgaatgtttacagaacaataatatctaaataaaaaattccttctgtgagg ctgcctataggaaaatacactatttctaacccaaatttgggaaaaatata catcacgattctgtccaatagaaggttgcaaatgaagcaagtttttattt aattgcactttttacgatgcaaaatgtcattaatatttttacaaccgtaa cacggatgttttttgagaatcaaagcaagttggttatctattatttttac atcgttgatcaaatcatatcagaggggatgcgtgcagcctaataCTTTCT CTCCATAGCTCAGACCACTATAAGTGAAATAGATTAATGACATTTTCTCA TCCATTTCAAAAACCGAAAACTCTACATCAACGACTCTTTATCACTCGAA CTTAgcataaaccaaataaaaagcATTccttttcagcatttttgttACTC TGGATCACAGACCTCTAAAAAAACAGTTGATCGTATTTGGAGCGCGAATA TGTTAGTGGATGTCAGAAGCCTATATTTCTGTatgtttctttttctcttt ttcaacaCCCCTTTAGGCTTACAATGTGGTATACGACAATCTCGtaagaa aacaacaaacaatACAATCCATGAAATGGATGTTATCAAGTCAAACTGAA AAACTTCACAGCCGTTTGTTCAAAGATTTAATCGAAATAAAGGTAAAAct attttttaattgtttgcCACCTTACTGCGTTAAAAGCTTTTTCCGTGTTA GACGGGATTTCAGTCTCAAAAGTTTTACATAAAATTCaccaattttttaa tttgataatttATTGTGTAAAATGAATTCAGACAAAAACCTTTCTTCGAC CACTGCCTACATTTTGGTTAAATACAGGGTATTATTTttcccgttttttt ttttcgaaaatgagTACAGCACTGCGATGCGAAATATAAATTCTTAACCT TATTGAAGTTTTTTccacagtcaactctctctaattctaACCTCTAATAA TCGAATCTCTCTTTCGAATCTTTGATTCGAACTAGAATATTGGTCCTCTC AGCTGGAGACTAGTTTAAATTGCTCtctgtaattcaaatttttctctaaa ttgaaaaaaaaagaaatatttagtccgttgaagatcgaattagagagagt caactgtattttcaGCAGTACGTTTCTAAGGGTACAGTCCTAGACATATT CAATTAtgtatataccttatcggggaaaaaatgtcgtgGGAAAGTGACGa gaattttgagggggtgacgaaattttcccccaaCGAGATATTTCCCCTAC ATTTTATCACCTGACCAAAAGTTGTAcccaatttttttatccccgaccaa aacatttacccgaaattttatactgcaatctaatttttttacacctttat ttaccgaaattaatgctttcaacgtcgaattacaagatccattttcgagc tagtgaaggaaaccatttcatttggataatttagtcgggtgaaagtgacg aatttgaaattttggtcggggaaaagtgacgaaaatggctctaggtgacg aaattttcccctgacgaaaaaataaataaaactccgacatttttttcccc gataaggtattttagATGTTTAGTGGGGCTAACAAGTCAGTTAGTTTCTT TATAGACAGCAAAAAGTAACTCAAAAGTTGTATTCTCAACGTGATAACCA TTGATATACGCTTTacgctttttttcataagaacaattttataagaacac gaggctgaaaattgaccGAAACCTAATAACAAATAAAGAACAACCTGAGC CCTAGATTTCAGAATCTATTAAGAAAATAGTGATTTTAAACCCATTtgaa gtaaagaaactaagcgtattaagaacattatagcaacatttaagcctgaa aattccaaaaaattatgaacagccCAGTCTGAGCTAAGATCTTACTGGTT AGTAAGAAGAAGCGTGTAAATGTATGTTACCCTTAAGTTGGGAATggatt tctagcaagtatttgatcgattgaatcacggttcagcacctgaattacaa tttcacagtttcagtaagttatgagcaaggggtcaatgtttgtagctttt aaggtgtaatagtgtaggttttaaggtgtattttaattttaacgtacagt tttgaaaatatttcggtaccaatgatctaattgtaacattagtaactttg cagtgaatcactgttcaaaatttgagaccaaaaaGACTATTTTATAAAAG TTGTCCAATtagcgaccgtagcatgaaggtagagcatccagctacggtga gcaaggttgtgggttcgacccccagccgggtcataccaaagattcccaaa atggtacttgatacctctctgcttgatggtcAGCAACTAaaaagaaggat caagggtaagtggagaaatccagggaaaggagtggcgccctcccctacct tcgggtagacagctataagaaaagggagccttcgggtcgccctcgaccgc ggtcgcaaacttacttactataAAAAGTTATGAAAGAAAACCATTTTTGT AGGTTTTGAGTAAATAGCTAAAACTGCACTTTTTTTACGAAGCAATGAAG ATTTTCTTAGCAGTTTTTACAAAAAACCATACCCAGGGAAGAAATTCATA GCTAGCCTAGACtcaccaaaaaaagtttcagcccTTACTGTTTTCTCTAT CAGGATATAGAGAATACCTctttttttgtaggttttaacgggtatccact ggtaggggggggcgtacgggtttgacggtgtgacggtattaacccttttt tctgtcggtgtttcggtgtcTGCGatccccgtacgcccccctccTGGTAT GATAAGTGCTCTTACCTTTTTTCAAATCCTATTTTGATTGATAAAGAATT TCCGTTTTATTATTCTTTTCTAGCTTTGGAGTGTATTTTGACTTTAGAAG tgctcaaagtttttttttcctttttgaacATGGCATAAATCATGCCCAAA TTaagtaaaatctgaaaaagattTGGTGAATTTgtaatggattttctttt ttccttgtTTGTTGAAGTCAGTGTTTGTATTTACCGACTTAAAAAGTTTG CTCTGCTTGACTTGCTAAAGGTAGTTGAATTGTAGCTGAGTGACTTTACT GCCAATATTTCTTCCTTGTTCAAGGCAATGGTAGCTGACTGACTTAACTG ACCAATATTTCTTCCTTGTCCAAAGGAACTCTAAAAAACGCTATAGGCTG ATTTTAGTGTGGATTAAGATTCAAGCAGAGTTCTTAAACAATTGATGTAC TAGTGGATTCCAGGGCTCTCTGTTTTAAGTGTCCATTGTATTCTTTAACC AGTTAGTACGTAAAGGTTTCCCTTTTTGGcctcaagtttttgaaaagttg tAAATGAGGAAAATATATAATTTCTTTCCCTTTTGATCAGCCTTTGTCAA CACTGATGAAcatcaaattttccttttttctgactTAAATAATGACTGGT GCGAACTGCCAACCAACTAATTTTACTTGTCGTTGTATTCTTCTTGTTGA CTAAACGtgactcaaaaagaaaaaagacttaaaatgctCAAAGAATGTAT CTTTGCAAATCACGGCCACATGGCCAACAACATGACCAATATGTCCGACT ACAGTACTCAGAGCGAGGAATCGTCAAGGTCTGCGACGTTTTATGTGAAA TTCCTTGGAGGTGGTCTTATGTTTGTTTTCTCTGCTCTCACAAACACTGC TTTAATTAATGGattgaaaaaaactaacaaaaaaatGACAATGTCTCAGA AATTGTTCATATATTTGTCAATAATGGATGCTGGGACATTACTGTGCCTT CTTTATTTTGGTTGGTTCATCTATTCATCATCTACCAGTTGTCTTGCTTA CGGTATCGGCCATGCAATATCAGTTTACACATTTGGAATGGACCTTGGTA TCTTTTTATTGATCTCATACATAAGGAATCATGTCACGCGGAAACCTTTA GAACACAAAGCTATcataacaaaaaagaaaatttacgcATTCATAATATT CTGGAATATATCGGTGCTTTTGTTATCAATACACGCTAACCTTTCATACA CATTAGCTTCCGTACCTCTTCACTTTACACACTGGTTGACACTAGGCGTC GGTATAATTTTTTCGGTTGTTTCGGCTTCGGTTTTGAATATTTGGTCCAA TAGGATTTTAACGGCACAATCACGAAAGAACGAAAGTGGGGAGGATATAC TAGGAGGtcaaagaaataaacaaaacatcaaTCAAAAGACAGCCGTTGGC ATTTTCAAAGCTCTTTCGATGCTATATTCCGTATGTATTTTACCGCTCAG TCTTTATTATGTCATTTCGGGTATTTCGATGATATTTTATGATATTGATG ACCCGTATCTAACCGTATTGTTGGATTTATCACCTATTGTACATATACCG ATTTTTACATGTTCTGGTCTCAATGCATTAATTTACATTTGGAGAGATAA AGCTATAGTAAAATATTATAAAGCTAtagtaaaatattataaaacaAAAC TTTGTTCAAGAAATCTTGTATCACGCACGGACTCCGAGAGAGAGACCTCT GTAACTGAACTGTAAAGTCCCATATGTATTTAACCGTTTAGTTTTCGGTC AGTTATCGGTTTAATCCTTTATATTTaaagtatttaattttgacGAGTAT TTAACTTTTTCACGAGTTGAAGAAGCTCAAGCTAATTTTAAATGTTGTAA AAGGTTTTTCATTGATTGATTTGAGGTAATGGTTTTTACCTTGTTGAAAC TGTAAGTAATGGTTAATGCAGCTTAATtcttgaaataaattttcaacccA GCCAAAATTTAGACTTCAATACCATTAAGTGTCACTTTCAAACTCAAGCA CTTTCCGAAAGGGTAGTGGCtgtatagactggagtcgtttataatgtgtG TAATACAGTAcaatttctactatgtctgaattagttgtCTAGCTTGCGAG ACTTAGTGACTGTACAGTAGATTTATTTATATGCTTTAGTATGTgacatt tgagatttttgagataatttggcatttttgaatCGATTCCATTAATCAAG TTTTCAAAACGAGATTTTtgctttcttattttttttcttatttcaaaatC TTGCTTGACTGAGGAATTTCAATGGATAAAAGaccgtgaattgaaaaaaa ttcgcgAAACTATAAATTTTCATCCTGCTTATGTAACTGAACAAAAGCAT ATCATATGCCGTTATTAATGGCTCAGTTATCAGTGACCTAGGGTAGAAAC CCCCGGGGTCTTGGAGGGGGGGTACTTatgcaaatggagggtacggtatg tgccgtccttaagggtacctatttggatttccaaagttccgctaagggtc ggaaaaatcagaaaattaaatttcagtcccattaagGGTCGAAGAAATAG GAAAATGTTAACTTTTTACCCCTGGAAAGATCgaaagttggtcaaaaatt gccccaataagggtcgtaaaattcaaaaaaacttcagCTAACCATTCCtt aaactgaaaatttaaaaattgcaataacaaagtttgatgaagaagaaaaa gaagacttttgcgaagaagagtatttcaacattgaggaccttattttcgg cgaagaaaagatattttgaaaacatgtttgcactagatggtgtatcttta aataaactaaaaatagattttcggaaaatttttgtaaaagcttctttgtc tcaaaatcttaaaaatattggcttttgaccaattttttatacaaatttct CTTAAAAAAGAGTGATAACTTTCTTTCCGAAAAATTTTAGATAGTTCATC AATCTTTTGTAgacaatttgtaaaaaattgaaacGAAAAGGTTAATTGAT GCATCGAGAAGGAACTGAGAAGtgaataatttcaatttgaagataattat tttttggggaattaaAGGGGAAGGCTCCGCTTACGCTTTTCTAAAATCAT AGTAACACTATAGATGCCAGGAATCAGAAATGACATTcaccggattggtt accgggtggaaataatctcatatcataatatcatatcaccggattggtta ccgggtggaaataatctcatatcataatatcatatcaccggattggttac cgggtggaaatcTCAAATAACACCGCATAAACGGATTCACCGGATTAgtt accgggtggaaataatctcatatcataatatcatatcatatcGACCGGAT TGGTTACCAGGTGGAAATATATCaaccggattggttaccgggtggaaata atCTTATTGATTACATCATCACTGGCATGAagaagattcaaaattttcaa taatagCGTAGCGTAGCGAAGCCAACCCCTAAATTACTACTTACATAGAC CATATATACTATAAATTAAATCAACTAAATTAACTCCACGTTTATATGAA actcaaaatatgaaaatataaataaaatgactAACAAACAGGAACTTGCa tccattttattttcaatattagcAAATAGTAAAGTTATGAAGGAAAGGTG TGGGAGGGCGGGAACCAAGACTGACGATGTTCGAAAGAAGCGTTACTAGA GACTGAGGTATTTTATATATGAGACCACGCACGAGGTCGGCTAAATTTAG AACCCAGGCTTTCTGGTCAAAGTAGATCTGGTGAACGCATACGACTGACA GGATGTAACGGGCGTTTACAAGGGCGCCGTCAAAGACTCTCTTTTCAATT AACCTGAGTTATGAATAACTCCatttaattacccattaaaactaagcact tttttaaaagagggcattataacattttattaacgtctAATCACTCTTGA TAGAATGAATTAACAAACAActtaaaaagacaattttttgttaaaagtgt aaatGAACtcaaaacacaaattttgtCTTCTAATCTAAACTATCTCACAA CTAAacttttgactatggtcagagccctgtGGTTATCGTAACTAAAATTT taagtacagggtgtcccgaaaaaaaattatcgagttgtaccacttctata gaaatgaagttcttgtgtgtgtttctctaaatttgcaatgtttaccaaag tttctctctgtgtcatattGATTGTCATGACTGgtcatgagacatctttt atgaataacttttacaaaaagcaactctcaataactttaacgtcatgaaa attgtaaataaagttaattctttttaatcataatgactgttgtaaaaagg ATTATTgcgttggtatatattttcttacattttgttaaacacatgCAACA Atctctactcagaatcatgttcgaactcgatactttttttcgggacaccc atATATTTATccaaggtaaaaaattatatttcgttgatttttttcttctc gttATTACTGCGCCAGCTACACTTTcgcttatctgatattccgatggcgg attagCGACCGCTctcgctaaagctctaaagggagcgagccaatttccca tcggagaggaataatagtcggcctttgatgtacCGCATCCTCAGTCTGGT TCAACAGCCCTTGCCCGtaaaccctaaaaatatttggTTTGGACTCGCCA ATCCCCTCTTCttcttgacgcggtcttgcaaaattcagtaatgtaaacct tccagatgttgaaaattttcccgaccttcagagctttagcgtgtcgaaTG AAAATTTCTCCATCTGGGTGCCTGATAACATTTTCGCCTCATCCCTTAGA ATTTATGGTTATGGATTATTTCCCGGAGAGGCAGTGGGTTTACTAACTGA CGGCATGTGCGACGAAAAATTGACTTTAAGAATTGCATCCTTATAGTGCA GCAAAAATTCGGTGAAATTCATAGCATTAAATAgtatttttcatcaattt ttaactcttttagagcaaaaaaatcagagtTTTCGGGGAAAAAGTGTGCA ATTTTTCCTGTATTTGcttaaaggaattatacggtgttacatacacccga ctcgtctgaaactgatgtcagcaaaattttaataaaagagtcctttcaaa tttgtaaataacaggaagaaaaaattcttgctccacatttttcttttttc attacaaaagattctatttatttcaatctgctgaatcaacatacattatc actatgtaaaaggtcaatggctttaaccccccccccttacagtgcattta tcaaaagtccacccttacagttcATTTCTGTTAGCTTGAAaaacccttaa ccgccgcacttacccgtcggtcaatttgccggACTACCCCCCCCCCCNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNCCCCCCCCCCAGGTTATTCAGACAAGCAAGTGTACTA TATTGGTATTAGAATTCAATTATAACTTTTTTGTCCCATCGATTGACTGT CGTCAGCGAATCTCCTTTTCAATACGATACCTTGGTGCTAACGAATTCCT GATGAGATAGTCCTCATTTTATTTGACCGACAGTTTTTACTTACTTTTTT AGATACTTTTTCTATTCAATAATTTTGGTTAATTTCATGGTGGTGGGATT TAcattaaaaggaaaaaataatgaaaaaaatcccTTTTTGTTCAGCTTTT GTCAACACTTATTTGgacttttttccttttctatACTCACAATAGAGATA CTGATGAGACATACTCGGTTTCATGGTATCTATCGTATTGGTGGCAATCT CAAATCTCAAATTGCCACCGTTCTAAGATTAGACTAcagatttctttcct tttttattcagcctttgtcaACATTTATTCCATCGTAATTTTTTCCCTTT CCCTTttggaaataaataaatacagCCTTTGGACCTGTCAGTTGGCACTT TTTATCGGTAATATTATATTGGCAATTTATTTAAAACAATTATAAAATGA AACCCGAATGTATTTTTGAGGAGTATTTTGAGAANTTATCGGTAATAGTA TATTGGCAATTTATTTAAAACAATTATAAAATGAAACCCGAATGTATTTT TGAGGAGTATTTTGAGAAACATTTGAACAATGCAACAAATACATCTCAAC TTGATGGCCAAATGGAATCTGGAAGTTCAACCATGTTCTACTTTCGTGTA TTTGTGTGCACTTTTATTTATCTCTTTTCAACCGCCACAAACACTGCTTT AGTTGTTGGATTGAAAAAAACCAACAAGAAATTGACAATACCTCACAAAC TGTACATTTATTTGGCAATAACGGATGCCTTGACATGTGTATTAATGCTT TATTTTGCTGTCATTGACCTTACATCAGAAACGAGCTGCTTAACTTATAG CATAGGATATGCAATATCAGTTTACACCTTTGGAGTAGGAATTGGCACCT TTTTATTGATCTCATACCTCAGAAACCTGGCAATTCGGAAACCCCATCAT GTTGTACCGGATAAATTGATTTATGTTATAACAATAAGTTGGAATGTTTT TATGATATCGCTGTCTTTATTCACATTTTTCACATATGACCCTGCGTACT CTTTCCACGAGCTTCACTACACATATTGGTTATTTGCTTTCCTTTCAATA GGTTGTATGGTTATCTCAATTATTGCTTTGAACCTTTCatctaataaaaa tttaataataCAATCGCGTACTTGTAACAATGAAATCGACACCGAAATTC GAATAagaaaacataacaaaacaGCTGTTGGAATTTTAAATGCTATTTCG TTGATCTACATCATATGTATTTTACCGGTAAGCCTCTACTATTTAGTGCT TGGCATTCTAATGATAGTTTATGAGGTAAATAATGGACTTCTTTCCTCTT TCCTGTCGATATTTTACATATCACCATTCATTCACCTACCACTTTTCGTT TGTTCTGGACTTAATTCGTTAGCTTACATTTTGAAAGTCAGAAGGattaa acaattttataaaCTTCACTTATGCTACAAACTTAACTTTTGCTACAGAA GACAAACAGCGCCAATAAATAACGACAGTCAAAATCGACAAAGAACACTG GTTATACAGTCTTCGGAACTGTGAACTATTCAAAACTTgcattttattat attttgcacATCATTGCTACATTAGTGACCGGTACAATTGCAATTAACTT AATTTCTCGTTACTTTTAGTAACATTCTTACCAGCCATGAATACTAGTCT TTTTGTAACTAGTctgagtaaagaaaacgaggTTTTGGTTAatttcatac acgttttttttttattagaacctagtttataagaacattgaggctgaaat tcgtcgaaaaattaagaacatcgtaagatgccatgcccagcctcagtttg gaaaaaaatgacaagaaactacaattttttcttcttttcaagcagtttta actgaaCTTAGAGATGGATTTTCTAagatcgagagtcaaatattgtccaa attttaccaattttaattgctctttattttgcatgatattgtcgatttat gtagaggagtctgaaaaattaagaacgcatttaagaacattttaggctga aaattgctaaaaaaataagcacatccaggctcagccaaattttaggtgtt ctaataaaaaaaaagtgtgtactcAAAGTTTAGCAATCTTCGGTGAAATA AATGTTATCTTTAAAGATCTATATTTCAGTGTCTACAAAAAACGTTTCAT AtgtcaaatgaaaattcgaaaGTACCGAGGAGAAATTTCCGTATGTGACG TCATTTGGCGATGATTTCAGTTTGCTTATTTAACAAGTTCCGACCTGGAA AGGTTGcaatctcaaatctttttttctagactttttTGTTacttgaataa aataaaattgaggCGTTGGCTTTGTCGCTCAAAACATCTAAATTGCCACC GTTCTAAGATTAGACtacagaatttttttcttttttattcagtCTTTGTC AACATTTATTCTATCGTAATTTTTTTCCCTTtctgaaataaataaataca gCCTTTGGACATGTCAGTTGGCACTATTTCCTTTTTGTTGAATTGATGTC TGGTAGTTATCGGTAATAGTATATTGGCAATTTATTTAAAACAATTATAA AATGAAACCCGAATGTATTTTTGAGGAGTATTTTGAGAAACATTTGAACA ATGCAACAAATACATCTCAACTTGATGGCCAAGTGGAATCCGGAAGTCCA ACCATGTTCTACTTTCGTTTATTTTTGTGTACTTTTATTTATCTCTTTTC AACCGCCACAAACACTGCTTTAGTTGTTGGATTGAAAAAAACCAACAAGA AATTGACAATACCTCAGAAACTGTACATTTATTTGTCAATAACGGATGCC TTAACGTGTCTATTgttgctttatttcgctatcaTTGAGCTTGTATCAGC ATCGACCTGTACTAATTTTAGTGTTGGTTTTGCGACATCGATCTACACGT TTGGAGTAGGACTAGGCACCTTTTTATTGATTTCATTGTTAAGAAATCTC GCAATAAGGAAACCTCTTTATGTCGTAACGAGCAAAGCAGTTTTCATCAC AATGATAATATGGAATGCCTTTATGGTTTTAATGTCTATATATGCATTTT TTACATACGACCCCGCATATTCCTCCCACATACTTCACTACACACACTGG TTATTCTCTGGCGTTGCAATAGGAGCTATGGTAATATCAGTTACTGGTTT GAACCATTCatctaaaaagattttaacaaaacAATCGCGTACTTGTAAAA GTGAAATCGACACCGAAATTCGAATGagaaaacataacaaaacaGCTGTT GGAATTTTAAATGCTATTTCGTTGATCTACATCATATGTATTTTGCCGTT AAGCCTCTACTATATAGTACTTGGCGTTCTAATGATAGTTTATGAGGTAA ATAATGGACTTCTTTCCTCTTTCTTGTCAATATTCTACATATCACCATTC ATTCACTTACCACTTTTCGTTTGTTCTGGACTTAATGCCTTAGCTTACAT TTTGAAAGTCAGAAGGattaaacaattttataaacatCACTTATGCTACA AACTTAACTTTTGCTACAGAAGACAAACAGCGCCAATAAATAACGACAGT CAAGATGGACAAAGAACAGTGGTTATAGAGTCTACGGAActgtaaaaata ttattttgtatATATAAACATTTGATTTTCCTCGTAAGCtttgataaatt ttgattaCATCCAGTTCTGTGACATATTTTATTACAAATAGCtaaagaaa tatttcaacaaatttgataAGGTTGAAGAAAATCAATCACATTATTGAGA AACTTCCTTTGGTGTTTAGGTGTTCTGGGAGTTATATGGTGCTTCTCCGG GGGTTGAATTTTTTTCCGGGATGTGTCAACATTATATGCTTGGAACTGGC TTATTCTAAAGtccatttcaaattagctggcagtgttttttcaaacctca ataactttcgATAGATTTGAATTagttagcggttttgtgctcatTAAAAA GAcaatccggagtggaatattatcaaaaaagaaaaatatggaaataatgg caaaacgaagatgaaaaatgaagaagaagaaaatcaacttcttgtagaat aatgcgatgatcttcatttttgtatcagaaaccattcaatcttagaacgt cataaatgcgagaaaaaaaactttcattcaatcaaaaaatacagcttaaa actttgtcctggttgactttaaaaagggctcttttttgttgatttttgat gatttttgaagtcaatcattgataaactttggactatatctttcgactga ataattttttttacaataatgatgttctaagatcaaagaatcactcgtgt gaaaatgataattatagcaaaattattaaagaaattgattttattcttct tcactttcaatcgtcattttccgatctttttttgtgatttttcattATAA CAATATTCCACTCATGTTcgtctttttaacgagcacaaaatcgctactta attcaaattctgtcaaaagttatcaaggtttgaaaaaacactgccagcta atttgaaatagacttcaATAATGGCTTTTCCTTACGGAGGATGCCCGGTT CTGTATTTAGGGGTTTAGAAATCGTCCTATTAGAACCGTCTTATACTGTA GTTTACACTGCCTGTCAACTTGCGAGACACTGATACACAGTTTTTCGAAT TGAGTGCGTTAATCCGTCGTGAACCACTTGGGAACAAGGCCAGCGCACTC TCATCTTATCCACCATGTATTGTGGAATCGATAGCTTGCTCAGTCACAGG tttatcataataatatatttaaTACCTTTTCCTAAAAGGTAAATTGTCAT GCCAATGTATAGAGTACCTTGCTTTTACGAGGATTTCAACAAGTATTTTC CGGGGAGTTACTaggtttttgaaatgactaGGATTGCCgcccaatttttt taaattggaaaTTTTAGGGTCTAAAATCCAGGAAAAACccgaaattttgt gaattttgggagtttttttctaaaatttatgcTTTTTAGGGATCAGAACA AAAATAACGCGCGTTTCATCACTTGATTGTTCTactaaggccggtctcca ctttcacgcgaaatgggcgacagtttttgttttcttaatcttttttgcct gaagaaaagattacatcatcaaaaagttttacgcgaacaaaaaaaaatgt tgaaggaagttctacttttttcatccgttacgtcaatttcgaccaatgga attgcttcatttttcaaccgaccaatgaccttaccaaaacgtcaaaaagt tttcgctcatgtcgcgccaAAGTGAAGACCGGCCTTTAGACAAGAGaatt tcttatttctaaaaTTACATAACACAGACGATTATATTAGAAtgctttaa ccctattagccccagggggggtagaatctaccacgctggagttcttttgt ttatatctcggagaaaaattttttaaacgacttgaaactttctaactttt aataaaatcttattaagagtacttgtgcaaaaattttagggtcataggtt gtccagatcaggttttatgactttattgtgaaacatgacataaaacctag ctaaaatcgcttaaaactcaaaattttaaagtgctgataacttctaaact atttattcaatcattttcaaattttgacacgtgataggcattgataatac aaatttaaaaaatctaaaaaaaatttttgaaaatgatgacgtcatcattt atgacgtcatcaaattttgaaaattttactcatcttcacttagattttaa gaaaaattcttcatggaaattgcttaaccggcaattatgttaaagaacag tcttttacctttcagaatcttcaaacagaatcgaaatatctttattggtt cgactgtaatagacatttttgtaaaccatatatttgggcttttttccgac aggtggaaattttgtgatgacgtcatcagtttttgaatgacgtcatcaat tttttttttcNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNaaattgtat catgatggagaacatctgtaccaaatttcatggccatagctcttctagat cgaaaataatcgagggtggtagattctaccccccccccttggggatacaa aagtcaaaaaagcttggggctaatagggttaatgtGAAGTGTCGAGTAAG AATAGAAAAGAATAGTCTACATTTCAGatgaaaaaaacgaaatattttgc attgctTTTGCAAGATCATCAGCAAAAACAGctactttaaaggttttatt ttcacataagtgttcccgtttcatatcaggcacacATATTAGAACAGTCT CTGcattttgttatattatgctgatataagcaaaaaaatgttttcttttc ctctttctttccaatcttgctccacatccgggtcaatccaatgtgaaaaa acttgtgaattaaaattgacgagcaaGAAAACGGTATCACTcttattaaa aatcaaaacctaTGAGTTATTATTTCATGTCCTTCTTTTTTTCAGATCCC AGAAGACGAAAATTTGAAAGTCGATAAAGAACTATTAGAACTGATctgca aaacaaaaacattgcatcGCTTCGTTGAGGCTGCTATTTACCCAGCACTG ATAAACCTTATCGTATCACATCAAGAGTTTGTCAAGCCTGCGATCACTCA TCTACGAAACAACGGCTATGAAGCAGAGGCTGGATATATATTGATGAAAA CTCGAGAaatgaattcttcttttttcacgttgaataatgctttagatatt ttgaattttagatttcGATAAATTTTTATAATGATCTATTTATTTACATT ATAATATTTTTGGGCTTTCTGTTTTGAGGATTTATAATTGATGAATGAAG AACTAAAATTTCATATCGAGAACAGTGATTTGATCTAACAAACATTGAAG AGTTAGGTTCACTAGGATCCAAGCATCTCCTCTGATatgtatcgtgtata aaattctcgTCTGAAAGTATCCCCCGTCCTTTTGTTTTTCAGGTTCagaa atttgattaaattttaataaattgtatatgagagatctttaattttcatt

Coding sequence (CDS) from alignment at scaffold_88:58872..146871+

>TCONS_00073193 ID=TCONS_00073193|Name=TCONS_00073193|organism=Clytia hemisphaerica|type=CDS|length=322920bp|location=Sequence derived from alignment at scaffold_88:58872..146871+ (Clytia hemisphaerica)
atggaaGAAAATGAGCAAATATTGTATGATTTGATTGTTCACGAAGAATG
GAAACAAGAACCACAGTTGTTGGACCAAGTTGAAAGTTATTTTTGGCAAT
ATCGTGGTTCACTTCTAAAGAAGCTATGGAAAGTTTCACAAAGTTCTGCA
ATTTATATGTGGGACAACTTGAAGACACAATTCAGATATCAAGCTACCTT
TGGTTGCCCACCATTGAATTTTATCAATCTGATGAACAATTGCTTGCCAT
GGCTTATGGCTTTGTCACCGGATGGAAATTTTATTGCCATCCTTCAAGAT
TCTGTTATTGAAATAAGGACTGCTGGAAATTTTGAGCAAGTCATTACAAA
ATATAAGATTGAAAAAGATATGTTTCCAAGATGGCGTAAATTGATTTGGA
ATCATGACAACACCTTACTTTGTTATTCAAACAGTTTTGGAGATTTGACC
ATTTTGGATATTACCGGCactaaaaaacattttattccaTCATCAAATAA
TGTCAAGTTAAAAGTGCCTGGAACGCTGAGTTTGGCATTGTGTCATGTTG
AATTTGTAGCCAAAGGAAATagCTTCTTGTTATATACCTGCACCTATCAA
GGATTTTTTACAGTTTATGAAGTGAATGAATCCTCCTGCACAATAAAATG
GGACTACTCTTTCATAACATTCCATCCATATGGATTAGCTGGTTTGGTTA
TTGATCATAAAAATGGGTTATTGGTTGCAGCTGGGAATTATGGGAAGGAA
CCATTTCCTAATGTCATGGGAGATGCATGTTATGGATCATATTCTGGTAT
CAGTCTCTGGAGATTTTTGAATGACACACCTCATCTAACTCTGGTTGAAG
ACCAGGGAAAAGCTTTGAAGAAGGTATCCAGAGGTGAATGGTTAAAGAGT
GTTGTTTTAAGACGTGGCGATGAAAAAAACGAAATGTTGAAGCATGGTAT
TTACAAGTTGAAATTGTCAGAAGATGGTACACAAATTGTCACACTGCATC
TTGATGGTCGCATATCTTTTTGGAGTATCCCGTCAATGAGGCTAATCAAA
ACTTGGAGTAAATCTGAACAACCTGATGCAAGTGGCGGCTCAAGTGAAGG
GTTCTCCTTTGACTCGCAGAAAAAAGAAGaTCTCACCAAAACAAGGAATT
CAATAGATGTCAGCTGGTGGTCTGAAAAGGAGATTGCTTTGGCATCTGGG
AGGGGTGATGTAACGATTGCTTCGACTGACAGCTTGAAGAATTTACTTGG
AGAGTCGAGTGAGAAATTTGATCCATGGCCGTCACTCAGCCAAGTGGTGG
ATGGAAGCATTCTTGTGCTCGAGTGTGAGAAACGAGTGAACGATCCAAAC
AACAAAACGAAGACATCTTGGAAATGGACTTCAGAAGAAGATGAAAGCCA
AGATGAAGTGAACTCGATTCGTTATCGATTCAAAGAACTCACTAAACAGA
TGTTATATTTCATCACTGAGGCTGAAAGGTTTTTACCAGCTGTCAAGCCT
CCAAGAATTTTAACCAACGTTTATCGTTTACTATGCTTGAAATCTACAAC
ACCCGAAGAATTATACACGCGGAAAATCAATCTTGAACATTACGGAGAGG
CCTTGGACCTAGCTAAACGTTTTGGTTTGAATACTGATTTAGTTTATCAG
CGACAGTGGAAAAAGAAAAGAGTTTCGAAGATTACCATTCATGATTATCt
gtcCAAGATTAAAGATCGATATTGGGTTTTGGACGAGTGCCTTTTACGAG
TTGCCGATGACTTTGACTCGACAGAAGAGTTACTGAAATACGGTTTACTC
GGTACAAGTTGGGAAATCTTGCAAAGGATTGATGAAGAGGGTAAAGGTGa
tgcaaaggatgatgggaAGTTATTACCTTTTAAATTTGACGCCGCCCCAC
ATGACGAGGATGACGAAAACTCAAGTAGAGAATTCCAAgggagTCTAACG
AAGAAGCAATTGAAAATCTGCCAATATCGACGGCAATTATTACATTATCT
TGATCGGCTTTCCACTTATGAGGTTGTTTTGGGAGGCTCATTCAAAGCAC
GAGATAAATTCTCAAAAGAGTATTTTACCAAATTTCGATCGTGCAATATG
GTACACCAAGCGGTCGAGTGTGCCCGCGACGAGGACGCTTATACTCTGGA
GCATTTGTTTTCGTACCATGGGAAGCAGTTACTACCTTATTGGCTGCCGA
TATTATCAAACTTCCCGGAAACAACCGATATCCGATATTTTGAGCCGGTC
ATCCCTGAGATTGGAGAGCCACCAGAAGATCCAGAGATTTTACCTTGGTT
AGAGAAACACCATCGTGAAGAGGATTGGGTCGAGCAATCGAATATTGTCC
AACAAATCAAGTCTAATGAAGAAGGTGACGCAAACGAAGATATAGGCTCA
TTCATTTTCGAATCCGATCCAGAGATacgaaaattttacaaatgtGAAAC
AAAAGCTCAACTGAGAGAATGGTTTTTACATCGTGTACACTTGATTGATG
AATATTCCGGTCAGATTGATAAATGTTGCGAGCTGTTAGATGTGGGAATC
AAAAGAGGCTTGGAAGGGCTCACTAAGGTTCACCAAGAAATGGAAGCATG
GAGACTCTTAGTTTACGACGTTGGAATTGACAGTAAAATGACTGCAAAGA
GTTTCGTGGAATTATCTGAATCATCGAAAATCAAATTGCTAATGTTCAAA
ACCTCAGATGTGACATTCGTTAACGATTTCAAGCTATATCTAATGCCGTA
TTTAAGAAATATTGGAAAGAAGGATTTTAAGAAACGCCAAGATTTACTTC
ATGAGTTTTTGGTGGAAATCGCTAAAACTGATTTGACATGCTGCTTGAAG
TTATTGGAAAAGTGTTCGCCAGAGCTGCCAGAACCACTGCTTCCTGATAT
GGCGGAGATAATGAAGATTGGGATTGATTGCGTTTACGCGTGCAAGAGAA
CGGATCAATTGAATCATTGTTTCAGCATTGTCGAATGTTTGCCTTCGAGA
GAAGAGGGAGTCATTAGCCGTCCCGTGGAAGAGCTTCACATACAACTGGA
TCAATTGGAACATTTGCTGACAGGAGCGGAAATTTTACAGTATTACAACA
ACCCTCAGACCATCTCTTACATTTCTGAAATTAAAGATGACTCTACTATT
TGTAAACAACTCATTCAGCAATTGGTGAAAAACGCTGTTTGTAAAGGACG
TTGTGTTCCAAAGGAATTGAACAAATTACTCGGACATTTGATCAAGCTTT
CCAAAGAAGTTTTCCGGTGCTGTGATATCAAGATCGTTCACCAGATTTTC
GTTGAAGAATTACTACGGTCCGGTTCACGTGAGAACATAACAGTAGCTGA
AGAGTTGATCACGCCTTCCAAACTTGCCGGGAATTCACCTCAAAGTAAGA
AACCAGAACAACATTTGACGTCTGCACTCTACCTCCTCAAATATGATGTT
TCGGTTACCGTTGTGTTGGAAGCGAGTCGTGAATATTTCAATGCAGCAAT
GTCGGGTAATGACTCTTCAATGGAACTGGCTAGATTGTGTCTAACATTGG
TCAAAGATTGTCCAGAGAGTGTTCAAGATGAATTGGATTTGATCAACTCG
TTGGGTTTATTGTATGAATTCAATGTATCCATGCTACCCTTACAAGTTCG
CCTTTGCGCTGATAAATTGGAAATTATCGATCTTTGTTTGAAGGAGAAGA
AGAATGGGTACAAGAAAAAAGACAAGCTCATCCAATTGAGTAATCTTTTG
CAAATCTGTGGCCATGACAACAAAGAACGGATTGGACAAGTCAATATTAA
AATTGCTGAATCAGCATTTGAACATAAAGATTACACATACGCTGGTATCG
TTTGTGTACAATTGGTGGATGATAATTATTCTAATGCTTGGTATATTTGC
AGGAAACTTGGTGAATGTGCTAAATATACCAACTTCACAATCAGGCAAAA
GTTGTTGAGTTTTGCGTTAACTTATTGTCCAGTACATCACATTGAAGAAG
TTTTACAAGAGAAAACTCAACTGGAAACCCAGGTTTTGTACGAGAGGTTG
GGTGTATTTACGAAAGAAGGCAAGAAAGACAAAATTGTGACCTCATCTAA
GAAAGAAACTGAGGAAGAAAACGACGAAGACAATGTTGATGGGAATAACA
TATCAATCCTCAACAAGACCAAAACTACAACAAAGAAATTGATTTCAAGC
GTCGCCAGCGTGGCTGATAACCGCTGGGTTGGATCCGCAATGAATTGGGT
CAAACCGTCGTCGGAAGGGTCTGGTAACGAAGTTGATGTTGTTGAGCGGG
AAATTGAAAGCGTTCGGCATAACCCATTTTATAGTTCGCTGGATTCGAAA
AAGATTGACGAAGATGTTCAAAGATTTAATTATAACGAGTTCAGCGACCA
TTTGAGGTGCGTCACAACCGAAGAAAAAGTATTCAATCAGCTGGTGTTAA
GAAGTCAAAAATTGAACGAGCAAAGAACCCTGGGTAAAGAGCTCGAAAAC
ACTGACCAAGCAATGCTATCGTTGAGTGATATAGCTTATACTGAAGAAAG
TTGTTTGTGTCTGGCTTACATGATGGCTATTTCTCAGCCAAAAGAAATCC
ATTCCCTATCGACCAAGCATCGGAAAAACACTTTCACTTTCCTTTTCACT
GCTTATTACTATGCATTACAAGAATAtgttaaaaacaacaaaatcgAATT
CGATAAACAAGCACAGATTTACAGCGCGCCTCCGATTGATGTGATTACAT
GGATGCTAAAAGTGTTAGGTAAGAAGCAAGgagaaaaggaagaaaaagaa
aaaggagagACTTACTTTCTGTCTAACATGAACAAGTTGCAAGACTTGAT
GCAAGCAAAGATGCTACAAGCTCTTGACAAAGgaGTGGACATCGAAAGAT
TTTCAGTTGATAATGAATATAAACGTGAAACTATACTCGGATTAGCTATG
AGTGTCGAAGACGAGTTGATTAACACAAGTTTGCTGCTAGCAGAGAAATA
TGATATCCCCGCATGGGAAGTGTTGTTATCACACGTGGAATTTTTATTCA
CTGATAGTGGTCTAAAAGCCAAAGCTATCCGCGAATCACTAAACAAATGG
AAAGTTGATTCCCATTTGAAACCGAACGGTGATAAAGTCTTTGAGCGGAT
GAAGAAATATGTTTACCCAGAAATCAATGGTAAAGACCACAATGCATTGC
TGTTGTTCTACGTTTTCCTAATGAATTGCAGCTCGCCCACTAAAATATTG
GAGGGTACGCTTACATTAGATGCTCATTCcaaacttttgaagaaaatcaa
GGCTGCTGCATCATCCATCAATTACAAACTTCTCGTGCATGGAGATTCAC
CTTTGGAGGTGATTAGAGACTGTGTTGATGATAACAATGTACATTTGTTG
GCTAAAATTGCATCCAAAATCCCCCAGGCGGATGGTAGTTACCTGTCATC
AAACAAGATCTTCTTAGCAAACGCCATTCGGatgttttggaagaaaaaag
aGAACAAGGATTGGTTGAATACATTCGAAAACTGTAAACAACACTTCACC
AAACTCCTGATAGAAGACGTTGTCACTTTTGCTGACCATGCAATTTTTGG
CGAGGAAGCTTTAGACTCGCTGACCCAAGACACCAGACTGGAGATTGGTA
AAAGAGtaataaaatatttgagacaacaACGTGGTCAAGACGAGACCAAA
CAAAGAGGAGCTGACGATTATGATTCGCTTATGGAGCGCTACGATTCATC
TATCAATGATTTGGAACTTTCCATCGAACATCTCAAAACGCTGACTGATC
CAATTTTCAAAGCAGTCTTTGGTGACGATAACGAACTGAGCAAAACCTTT
GGACGAGTATACGACTTATCACGTGGTCGAAAACAACCACTCGAAAAACT
ATTCCGTGATTTGTTCATATCGNTACAACCATTAGACAAAATTTCGAAAC
TGCGGAGTCTTTGTCGCAATGCATCTATTGACGTCCGCACGTGTTTCCAA
GATGCTTTGCGCGGGATCCTGAGTGACATCCAAAGCGATAGAGATTACAC
AAAACTACAGACTTTAACGGAGAACATCAAAGCGCATCAAGAACATCAAA
CAGACCCTCTTGTTACCCATAGCGACGTCTTAGATGTGGTGCGGCCATTT
TGTTCTGATGTTACAGCTAGCACGGATGTGAAGAGTCACGTGTTACATNT
TTTGTTCTGAatggaaGAAAATGAGCAAATATTGTATGATTTGATTGTTC
ACGAAGAATGGAAACAAGAACCACAGTTGTTGGACCAAGTTGAAAGTTAT
TTTTGGCAATATCGTGGTTCACTTCTAAAGAAGCTATGGAAAGTTTCACA
AAGTTCTGCAATTTATATGTGGGACAACTTGAAGACACAATTCAGATATC
AAGCTACCTTTGGTTGCCCACCATTGAATTTTATCAATCTGATGAACAAT
TGCTTGCCATGGCTTATGGCTTTGTCACCGGATGGAAATTTTATTGCCAT
CCTTCAAGATTCTGTTATTGAAATAAGGACTGCTGGAAATTTTGAGCAAG
TCATTACAAAATATAAGATTGAAAAAGATATGTTTCCAAGATGGCGTAAA
TTGATTTGGAATCATGACAACACCTTACTTTGTTATTCAAACAGTTTTGG
AGATTTGACCATTTTGGATATTACCGGCactaaaaaacattttattccaT
CATCAAATAATGTCAAGTTAAAAGTGCCTGGAACGCTGAGTTTGGCATTG
TGTCATGTTGAATTTGTAGCCAAAGGAAATagCTTCTTGTTATATACCTG
CACCTATCAAGGATTTTTTACAGTTTATGAAGTGAATGAATCCTCCTGCA
CAATAAAATGGGACTACTCTTTCATAACATTCCATCCATATGGATTAGCT
GGTTTGGTTATTGATCATAAAAATGGGTTATTGGTTGCAGCTGGGAATTA
TGGGAAGGAACCATTTCCTAATGTCATGGGAGATGCATGTTATGGATCAT
ATTCTGGTATCAGTCTCTGGAGATTTTTGAATGACACACCTCATCTAACT
CTGGTTGAAGACCAGGGAAAAGCTTTGAAGAAGGTATCCAGAGGTGAATG
GTTAAAGAGTGTTGTTTTAAGACGTGGCGATGAAAAAAACGAAATGTTGA
AGCATGGTATTTACAAGTTGAAATTGTCAGAAGATGGTACACAAATTGTC
ACACTGCATCTTGATGGTCGCATATCTTTTTGGAGTATCCCGTCAATGAG
GCTAATCAAAACTTGGAGTAAATCTGAACAACCTGATGCAAGTGGCGGCT
CAAGTGAAGGGTTCTCCTTTGACTCGCAGAAAAAAGAAGaTCTCACCAAA
ACAAGGAATTCAATAGATGTCAGCTGGTGGTCTGAAAAGGAGATTGCTTT
GGCATCTGGGAGGGGTGATGTAACGATTGCTTCGACTGACAGCTTGAAGA
ATTTACTTGGAGAGTCGAGTGAGAAATTTGATCCATGGCCGTCACTCAGC
CAAGTGGTGGATGGAAGCATTCTTGTGCTCGAGTGTGAGAAACGAGTGAA
CGATCCAAACAACAAAACGAAGACATCTTGGAAATGGACTTCAGAAGAAG
ATGAAAGCCAAGATGAAGTGAACTCGATTCGTTATCGATTCAAAGAACTC
ACTAAACAGATGTTATATTTCATCACTGAGGCTGAAAGGTTTTTACCAGC
TGTCAAGCCTCCAAGAATTTTAACCAACGTTTATCGTTTACTATGCTTGA
AATCTACAACACCCGAAGAATTATACACGCGGAAAATCAATCTTGAACAT
TACGGAGAGGCCTTGGACCTAGCTAAACGTTTTGGTTTGAATACTGATTT
AGTTTATCAGCGACAGTGGAAAAAGAAAAGAGTTTCGAAGATTACCATTC
ATGATTATCtgtcCAAGATTAAAGATCGATATTGGGTTTTGGACGAGTGC
CTTTTACGAGTTGCCGATGACTTTGACTCGACAGAAGAGTTACTGAAATA
CGGTTTACTCGGTACAAGTTGGGAAATCTTGCAAAGGATTGATGAAGAGG
GTAAAGGTGatgcaaaggatgatgggaAGTTATTACCTTTTAAATTTGAC
GCCGCCCCACATGACGAGGATGACGAAAACTCAAGTAGAGAATTCCAAgg
gagTCTAACGAAGAAGCAATTGAAAATCTGCCAATATCGACGGCAATTAT
TACATTATCTTGATCGGCTTTCCACTTATGAGGTTGTTTTGGGAGGCTCA
TTCAAAGCACGAGATAAATTCTCAAAAGAGTATTTTACCAAATTTCGATC
GTGCAATATGGTACACCAAGCGGTCGAGTGTGCCCGCGACGAGGACGCTT
ATACTCTGGAGCATTTGTTTTCGTACCATGGGAAGCAGTTACTACCTTAT
TGGCTGCCGATATTATCAAACTTCCCGGAAACAACCGATATCCGATATTT
TGAGCCGGTCATCCCTGAGATTGGAGAGCCACCAGAAGATCCAGAGATTT
TACCTTGGTTAGAGAAACACCATCGTGAAGAGGATTGGGTCGAGCAATCG
AATATTGTCCAACAAATCAAGTCTAATGAAGAAGGTGACGCAAACGAAGA
TATAGGCTCATTCATTTTCGAATCCGATCCAGAGATacgaaaattttaca
aatgtGAAACAAAAGCTCAACTGAGAGAATGGTTTTTACATCGTGTACAC
TTGATTGATGAATATTCCGGTCAGATTGATAAATGTTGCGAGCTGTTAGA
TGTGGGAATCAAAAGAGGCTTGGAAGGGCTCACTAAGGTTCACCAAGAAA
TGGAAGCATGGAGACTCTTAGTTTACGACGTTGGAATTGACAGTAAAATG
ACTGCAAAGAGTTTCGTGGAATTATCTGAATCATCGAAAATCAAATTGCT
AATGTTCAAAACCTCAGATGTGACATTCGTTAACGATTTCAAGCTATATC
TAATGCCGTATTTAAGAAATATTGGAAAGAAGGATTTTAAGAAACGCCAA
GATTTACTTCATGAGTTTTTGGTGGAAATCGCTAAAACTGATTTGACATG
CTGCTTGAAGTTATTGGAAAAGTGTTCGCCAGAGCTGCCAGAACCACTGC
TTCCTGATATGGCGGAGATAATGAAGATTGGGATTGATTGCGTTTACGCG
TGCAAGAGAACGGATCAATTGAATCATTGTTTCAGCATTGTCGAATGTTT
GCCTTCGAGAGAAGAGGGAGTCATTAGCCGTCCCGTGGAAGAGCTTCACA
TACAACTGGATCAATTGGAACATTTGCTGACAGGAGCGGAAATTTTACAG
TATTACAACAACCCTCAGACCATCTCTTACATTTCTGAAATTAAAGATGA
CTCTACTATTTGTAAACAACTCATTCAGCAATTGGTGAAAAACGCTGTTT
GTAAAGGACGTTGTGTTCCAAAGGAATTGAACAAATTACTCGGACATTTG
ATCAAGCTTTCCAAAGAAGTTTTCCGGTGCTGTGATATCAAGATCGTTCA
CCAGATTTTCGTTGAAGAATTACTACGGTCCGGTTCACGTGAGAACATAA
CAGTAGCTGAAGAGTTGATCACGCCTTCCAAACTTGCCGGGAATTCACCT
CAAAGTAAGAAACCAGAACAACATTTGACGTCTGCACTCTACCTCCTCAA
ATATGATGTTTCGGTTACCGTTGTGTTGGAAGCGAGTCGTGAATATTTCA
ATGCAGCAATGTCGGGTAATGACTCTTCAATGGAACTGGCTAGATTGTGT
CTAACATTGGTCAAAGATTGTCCAGAGAGTGTTCAAGATGAATTGGATTT
GATCAACTCGTTGGGTTTATTGTATGAATTCAATGTATCCATGCTACCCT
TACAAGTTCGCCTTTGCGCTGATAAATTGGAAATTATCGATCTTTGTTTG
AAGGAGAAGAAGAATGGGTACAAGAAAAAAGACAAGCTCATCCAATTGAG
TAATCTTTTGCAAATCTGTGGCCATGACAACAAAGAACGGATTGGACAAG
TCAATATTAAAATTGCTGAATCAGCATTTGAACATAAAGATTACACATAC
GCTGGTATCGTTTGTGTACAATTGGTGGATGATAATTATTCTAATGCTTG
GTATATTTGCAGGAAACTTGGTGAATGTGCTAAATATACCAACTTCACAA
TCAGGCAAAAGTTGTTGAGTTTTGCGTTAACTTATTGTCCAGTACATCAC
ATTGAAGAAGTTTTACAAGAGAAAACTCAACTGGAAACCCAGGTTTTGTA
CGAGAGGTTGGGTGTATTTACGAAAGAAGGCAAGAAAGACAAAATTGTGA
CCTCATCTAAGAAAGAAACTGAGGAAGAAAACGACGAAGACAATGTTGAT
GGGAATAACATATCAATCCTCAACAAGACCAAAACTACAACAAAGAAATT
GATTTCAAGCGTCGCCAGCGTGGCTGATAACCGCTGGGTTGGATCCGCAA
TGAATTGGGTCAAACCGTCGTCGGAAGGGTCTGGTAACGAAGTTGATGTT
GTTGAGCGGGAAATTGAAAGCGTTCGGCATAACCCATTTTATAGTTCGCT
GGATTCGAAAAAGATTGACGAAGATGTTCAAAGATTTAATTATAACGAGT
TCAGCGACCATTTGAGGTGCGTCACAACCGAAGAAAAAGTATTCAATCAG
CTGGTGTTAAGAAGTCAAAAATTGAACGAGCAAAGAACCCTGGGTAAAGA
GCTCGAAAACACTGACCAAGCAATGCTATCGTTGAGTGATATAGCTTATA
CTGAAGAAAGTTGTTTGTGTCTGGCTTACATGATGGCTATTTCTCAGCCA
AAAGAAATCCATTCCCTATCGACCAAGCATCGGAAAAACACTTTCACTTT
CCTTTTCACTGCTTATTACTATGCATTACAAGAATAtgttaaaaacaaca
aaatcgAATTCGATAAACAAGCACAGATTTACAGCGCGCCTCCGATTGAT
GTGATTACATGGATGCTAAAAGTGTTAGGTAAGAAGCAAGgagaaaagga
agaaaaagaaaaaggagagACTTACTTTCTGTCTAACATGAACAAGTTGC
AAGACTTGATGCAAGCAAAGATGCTACAAGCTCTTGACAAAGgaGTGGAC
ATCGAAAGATTTTCAGTTGATAATGAATATAAACGTGAAACTATACTCGG
ATTAGCTATGAGTGTCGAAGACGAGTTGATTAACACAAGTTTGCTGCTAG
CAGAGAAATATGATATCCCCGCATGGGAAGTGTTGTTATCACACGTGGAA
TTTTTATTCACTGATAGTGGTCTAAAAGCCAAAGCTATCCGCGAATCACT
AAACAAATGGAAAGTTGATTCCCATTTGAAACCGAACGGTGATAAAGTCT
TTGAGCGGATGAAGAAATATGTTTACCCAGAAATCAATGGTAAAGACCAC
AATGCATTGCTGTTGTTCTACGTTTTCCTAATGAATTGCAGCTCGCCCAC
TAAAATATTGGAGGGTACGCTTACATTAGATGCTCATTCcaaacttttga
agaaaatcaaGGCTGCTGCATCATCCATCAATTACAAACTTCTCGTGCAT
GGAGATTCACCTTTGGAGGTGATTAGAGACTGTGTTGATGATAACAATGT
ACATTTGTTGGCTAAAATTGCATCCAAAATCCCCCAGGCGGATGGTAGTT
ACCTGTCATCAAACAAGATCTTCTTAGCAAACGCCATTCGGatgttttgg
aagaaaaaagaGAACAAGGATTGGTTGAATACATTCGAAAACTGTAAACA
ACACTTCACCAAACTCCTGATAGAAGACGTTGTCACTTTTGCTGACCATG
CAATTTTTGGCGAGGAAGCTTTAGACTCGCTGACCCAAGACACCAGACTG
GAGATTGGTAAAAGAGtaataaaatatttgagacaacaACGTGGTCAAGA
CGAGACCAAACAAAGAGGAGCTGACGATTATGATTCGCTTATGGAGCGCT
ACGATTCATCTATCAATGATTTGGAACTTTCCATCGAACATCTCAAAACG
CTGACTGATCCAATTTTCAAAGCAGTCTTTGGTGACGATAACGAACTGAG
CAAAACCTTTGGACGAGTATACGACTTATCACGTGGTCGAAAACAACCAC
TCGAAAAACTATTCCGTGATTTGTTCATATCGNTACAACCATTAGACAAA
ATTTCGAAACTGCGGAGTCTTTGTCGCAATGCATCTATTGACGTCCGCAC
GTGTTTCCAAGATGCTTTGCGCGGGATCCTGAGTGACATCCAAAGCGATA
GAGATTACACAAAACTACAGACTTTAACGGAGAACATCAAAGCGCATCAA
GAACATCAAACAGACCCTCTTGTTACCCATAGCGACGTCTTAGATGTGGT
GCGGCCATTTTGTTCTGATGTTACAGCTAGCACGGATGTGAAGAGTCACG
TGTTACATNTTTTGTTCTGAatggaaGAAAATGAGCAAATATTGTATGAT
TTGATTGTTCACGAAGAATGGAAACAAGAACCACAGTTGTTGGACCAAGT
TGAAAGTTATTTTTGGCAATATCGTGGTTCACTTCTAAAGAAGCTATGGA
AAGTTTCACAAAGTTCTGCAATTTATATGTGGGACAACTTGAAGACACAA
TTCAGATATCAAGCTACCTTTGGTTGCCCACCATTGAATTTTATCAATCT
GATGAACAATTGCTTGCCATGGCTTATGGCTTTGTCACCGGATGGAAATT
TTATTGCCATCCTTCAAGATTCTGTTATTGAAATAAGGACTGCTGGAAAT
TTTGAGCAAGTCATTACAAAATATAAGATTGAAAAAGATATGTTTCCAAG
ATGGCGTAAATTGATTTGGAATCATGACAACACCTTACTTTGTTATTCAA
ACAGTTTTGGAGATTTGACCATTTTGGATATTACCGGCactaaaaaacat
tttattccaTCATCAAATAATGTCAAGTTAAAAGTGCCTGGAACGCTGAG
TTTGGCATTGTGTCATGTTGAATTTGTAGCCAAAGGAAATagCTTCTTGT
TATATACCTGCACCTATCAAGGATTTTTTACAGTTTATGAAGTGAATGAA
TCCTCCTGCACAATAAAATGGGACTACTCTTTCATAACATTCCATCCATA
TGGATTAGCTGGTTTGGTTATTGATCATAAAAATGGGTTATTGGTTGCAG
CTGGGAATTATGGGAAGGAACCATTTCCTAATGTCATGGGAGATGCATGT
TATGGATCATATTCTGGTATCAGTCTCTGGAGATTTTTGAATGACACACC
TCATCTAACTCTGGTTGAAGACCAGGGAAAAGCTTTGAAGAAGGTATCCA
GAGGTGAATGGTTAAAGAGTGTTGTTTTAAGACGTGGCGATGAAAAAAAC
GAAATGTTGAAGCATGGTATTTACAAGTTGAAATTGTCAGAAGATGGTAC
ACAAATTGTCACACTGCATCTTGATGGTCGCATATCTTTTTGGAGTATCC
CGTCAATGAGGCTAATCAAAACTTGGAGTAAATCTGAACAACCTGATGCA
AGTGGCGGCTCAAGTGAAGGGTTCTCCTTTGACTCGCAGAAAAAAGAAGa
TCTCACCAAAACAAGGAATTCAATAGATGTCAGCTGGTGGTCTGAAAAGG
AGATTGCTTTGGCATCTGGGAGGGGTGATGTAACGATTGCTTCGACTGAC
AGCTTGAAGAATTTACTTGGAGAGTCGAGTGAGAAATTTGATCCATGGCC
GTCACTCAGCCAAGTGGTGGATGGAAGCATTCTTGTGCTCGAGTGTGAGA
AACGAGTGAACGATCCAAACAACAAAACGAAGACATCTTGGAAATGGACT
TCAGAAGAAGATGAAAGCCAAGATGAAGTGAACTCGATTCGTTATCGATT
CAAAGAACTCACTAAACAGATGTTATATTTCATCACTGAGGCTGAAAGGT
TTTTACCAGCTGTCAAGCCTCCAAGAATTTTAACCAACGTTTATCGTTTA
CTATGCTTGAAATCTACAACACCCGAAGAATTATACACGCGGAAAATCAA
TCTTGAACATTACGGAGAGGCCTTGGACCTAGCTAAACGTTTTGGTTTGA
ATACTGATTTAGTTTATCAGCGACAGTGGAAAAAGAAAAGAGTTTCGAAG
ATTACCATTCATGATTATCtgtcCAAGATTAAAGATCGATATTGGGTTTT
GGACGAGTGCCTTTTACGAGTTGCCGATGACTTTGACTCGACAGAAGAGT
TACTGAAATACGGTTTACTCGGTACAAGTTGGGAAATCTTGCAAAGGATT
GATGAAGAGGGTAAAGGTGatgcaaaggatgatgggaAGTTATTACCTTT
TAAATTTGACGCCGCCCCACATGACGAGGATGACGAAAACTCAAGTAGAG
AATTCCAAgggagTCTAACGAAGAAGCAATTGAAAATCTGCCAATATCGA
CGGCAATTATTACATTATCTTGATCGGCTTTCCACTTATGAGGTTGTTTT
GGGAGGCTCATTCAAAGCACGAGATAAATTCTCAAAAGAGTATTTTACCA
AATTTCGATCGTGCAATATGGTACACCAAGCGGTCGAGTGTGCCCGCGAC
GAGGACGCTTATACTCTGGAGCATTTGTTTTCGTACCATGGGAAGCAGTT
ACTACCTTATTGGCTGCCGATATTATCAAACTTCCCGGAAACAACCGATA
TCCGATATTTTGAGCCGGTCATCCCTGAGATTGGAGAGCCACCAGAAGAT
CCAGAGATTTTACCTTGGTTAGAGAAACACCATCGTGAAGAGGATTGGGT
CGAGCAATCGAATATTGTCCAACAAATCAAGTCTAATGAAGAAGGTGACG
CAAACGAAGATATAGGCTCATTCATTTTCGAATCCGATCCAGAGATacga
aaattttacaaatgtGAAACAAAAGCTCAACTGAGAGAATGGTTTTTACA
TCGTGTACACTTGATTGATGAATATTCCGGTCAGATTGATAAATGTTGCG
AGCTGTTAGATGTGGGAATCAAAAGAGGCTTGGAAGGGCTCACTAAGGTT
CACCAAGAAATGGAAGCATGGAGACTCTTAGTTTACGACGTTGGAATTGA
CAGTAAAATGACTGCAAAGAGTTTCGTGGAATTATCTGAATCATCGAAAA
TCAAATTGCTAATGTTCAAAACCTCAGATGTGACATTCGTTAACGATTTC
AAGCTATATCTAATGCCGTATTTAAGAAATATTGGAAAGAAGGATTTTAA
GAAACGCCAAGATTTACTTCATGAGTTTTTGGTGGAAATCGCTAAAACTG
ATTTGACATGCTGCTTGAAGTTATTGGAAAAGTGTTCGCCAGAGCTGCCA
GAACCACTGCTTCCTGATATGGCGGAGATAATGAAGATTGGGATTGATTG
CGTTTACGCGTGCAAGAGAACGGATCAATTGAATCATTGTTTCAGCATTG
TCGAATGTTTGCCTTCGAGAGAAGAGGGAGTCATTAGCCGTCCCGTGGAA
GAGCTTCACATACAACTGGATCAATTGGAACATTTGCTGACAGGAGCGGA
AATTTTACAGTATTACAACAACCCTCAGACCATCTCTTACATTTCTGAAA
TTAAAGATGACTCTACTATTTGTAAACAACTCATTCAGCAATTGGTGAAA
AACGCTGTTTGTAAAGGACGTTGTGTTCCAAAGGAATTGAACAAATTACT
CGGACATTTGATCAAGCTTTCCAAAGAAGTTTTCCGGTGCTGTGATATCA
AGATCGTTCACCAGATTTTCGTTGAAGAATTACTACGGTCCGGTTCACGT
GAGAACATAACAGTAGCTGAAGAGTTGATCACGCCTTCCAAACTTGCCGG
GAATTCACCTCAAAGTAAGAAACCAGAACAACATTTGACGTCTGCACTCT
ACCTCCTCAAATATGATGTTTCGGTTACCGTTGTGTTGGAAGCGAGTCGT
GAATATTTCAATGCAGCAATGTCGGGTAATGACTCTTCAATGGAACTGGC
TAGATTGTGTCTAACATTGGTCAAAGATTGTCCAGAGAGTGTTCAAGATG
AATTGGATTTGATCAACTCGTTGGGTTTATTGTATGAATTCAATGTATCC
ATGCTACCCTTACAAGTTCGCCTTTGCGCTGATAAATTGGAAATTATCGA
TCTTTGTTTGAAGGAGAAGAAGAATGGGTACAAGAAAAAAGACAAGCTCA
TCCAATTGAGTAATCTTTTGCAAATCTGTGGCCATGACAACAAAGAACGG
ATTGGACAAGTCAATATTAAAATTGCTGAATCAGCATTTGAACATAAAGA
TTACACATACGCTGGTATCGTTTGTGTACAATTGGTGGATGATAATTATT
CTAATGCTTGGTATATTTGCAGGAAACTTGGTGAATGTGCTAAATATACC
AACTTCACAATCAGGCAAAAGTTGTTGAGTTTTGCGTTAACTTATTGTCC
AGTACATCACATTGAAGAAGTTTTACAAGAGAAAACTCAACTGGAAACCC
AGGTTTTGTACGAGAGGTTGGGTGTATTTACGAAAGAAGGCAAGAAAGAC
AAAATTGTGACCTCATCTAAGAAAGAAACTGAGGAAGAAAACGACGAAGA
CAATGTTGATGGGAATAACATATCAATCCTCAACAAGACCAAAACTACAA
CAAAGAAATTGATTTCAAGCGTCGCCAGCGTGGCTGATAACCGCTGGGTT
GGATCCGCAATGAATTGGGTCAAACCGTCGTCGGAAGGGTCTGGTAACGA
AGTTGATGTTGTTGAGCGGGAAATTGAAAGCGTTCGGCATAACCCATTTT
ATAGTTCGCTGGATTCGAAAAAGATTGACGAAGATGTTCAAAGATTTAAT
TATAACGAGTTCAGCGACCATTTGAGGTGCGTCACAACCGAAGAAAAAGT
ATTCAATCAGCTGGTGTTAAGAAGTCAAAAATTGAACGAGCAAAGAACCC
TGGGTAAAGAGCTCGAAAACACTGACCAAGCAATGCTATCGTTGAGTGAT
ATAGCTTATACTGAAGAAAGTTGTTTGTGTCTGGCTTACATGATGGCTAT
TTCTCAGCCAAAAGAAATCCATTCCCTATCGACCAAGCATCGGAAAAACA
CTTTCACTTTCCTTTTCACTGCTTATTACTATGCATTACAAGAATAtgtt
aaaaacaacaaaatcgAATTCGATAAACAAGCACAGATTTACAGCGCGCC
TCCGATTGATGTGATTACATGGATGCTAAAAGTGTTAGGTAAGAAGCAAG
gagaaaaggaagaaaaagaaaaaggagagACTTACTTTCTGTCTAACATG
AACAAGTTGCAAGACTTGATGCAAGCAAAGATGCTACAAGCTCTTGACAA
AGgaGTGGACATCGAAAGATTTTCAGTTGATAATGAATATAAACGTGAAA
CTATACTCGGATTAGCTATGAGTGTCGAAGACGAGTTGATTAACACAAGT
TTGCTGCTAGCAGAGAAATATGATATCCCCGCATGGGAAGTGTTGTTATC
ACACGTGGAATTTTTATTCACTGATAGTGGTCTAAAAGCCAAAGCTATCC
GCGAATCACTAAACAAATGGAAAGTTGATTCCCATTTGAAACCGAACGGT
GATAAAGTCTTTGAGCGGATGAAGAAATATGTTTACCCAGAAATCAATGG
TAAAGACCACAATGCATTGCTGTTGTTCTACGTTTTCCTAATGAATTGCA
GCTCGCCCACTAAAATATTGGAGGGTACGCTTACATTAGATGCTCATTCc
aaacttttgaagaaaatcaaGGCTGCTGCATCATCCATCAATTACAAACT
TCTCGTGCATGGAGATTCACCTTTGGAGGTGATTAGAGACTGTGTTGATG
ATAACAATGTACATTTGTTGGCTAAAATTGCATCCAAAATCCCCCAGGCG
GATGGTAGTTACCTGTCATCAAACAAGATCTTCTTAGCAAACGCCATTCG
GatgttttggaagaaaaaagaGAACAAGGATTGGTTGAATACATTCGAAA
ACTGTAAACAACACTTCACCAAACTCCTGATAGAAGACGTTGTCACTTTT
GCTGACCATGCAATTTTTGGCGAGGAAGCTTTAGACTCGCTGACCCAAGA
CACCAGACTGGAGATTGGTAAAAGAGtaataaaatatttgagacaacaAC
GTGGTCAAGACGAGACCAAACAAAGAGGAGCTGACGATTATGATTCGCTT
ATGGAGCGCTACGATTCATCTATCAATGATTTGGAACTTTCCATCGAACA
TCTCAAAACGCTGACTGATCCAATTTTCAAAGCAGTCTTTGGTGACGATA
ACGAACTGAGCAAAACCTTTGGACGAGTATACGACTTATCACGTGGTCGA
AAACAACCACTCGAAAAACTATTCCGTGATTTGTTCATATCGNTACAACC
ATTAGACAAAATTTCGAAACTGCGGAGTCTTTGTCGCAATGCATCTATTG
ACGTCCGCACGTGTTTCCAAGATGCTTTGCGCGGGATCCTGAGTGACATC
CAAAGCGATAGAGATTACACAAAACTACAGACTTTAACGGAGAACATCAA
AGCGCATCAAGAACATCAAACAGACCCTCTTGTTACCCATAGCGACGTCT
TAGATGTGGTGCGGCCATTTTGTTCTGATGTTACAGCTAGCACGGATGTG
AAGAGTCACGTGTTACATNTTTTGTTCTGAatggaaGAAAATGAGCAAAT
ATTGTATGATTTGATTGTTCACGAAGAATGGAAACAAGAACCACAGTTGT
TGGACCAAGTTGAAAGTTATTTTTGGCAATATCGTGGTTCACTTCTAAAG
AAGCTATGGAAAGTTTCACAAAGTTCTGCAATTTATATGTGGGACAACTT
GAAGACACAATTCAGATATCAAGCTACCTTTGGTTGCCCACCATTGAATT
TTATCAATCTGATGAACAATTGCTTGCCATGGCTTATGGCTTTGTCACCG
GATGGAAATTTTATTGCCATCCTTCAAGATTCTGTTATTGAAATAAGGAC
TGCTGGAAATTTTGAGCAAGTCATTACAAAATATAAGATTGAAAAAGATA
TGTTTCCAAGATGGCGTAAATTGATTTGGAATCATGACAACACCTTACTT
TGTTATTCAAACAGTTTTGGAGATTTGACCATTTTGGATATTACCGGCac
taaaaaacattttattccaTCATCAAATAATGTCAAGTTAAAAGTGCCTG
GAACGCTGAGTTTGGCATTGTGTCATGTTGAATTTGTAGCCAAAGGAAAT
agCTTCTTGTTATATACCTGCACCTATCAAGGATTTTTTACAGTTTATGA
AGTGAATGAATCCTCCTGCACAATAAAATGGGACTACTCTTTCATAACAT
TCCATCCATATGGATTAGCTGGTTTGGTTATTGATCATAAAAATGGGTTA
TTGGTTGCAGCTGGGAATTATGGGAAGGAACCATTTCCTAATGTCATGGG
AGATGCATGTTATGGATCATATTCTGGTATCAGTCTCTGGAGATTTTTGA
ATGACACACCTCATCTAACTCTGGTTGAAGACCAGGGAAAAGCTTTGAAG
AAGGTATCCAGAGGTGAATGGTTAAAGAGTGTTGTTTTAAGACGTGGCGA
TGAAAAAAACGAAATGTTGAAGCATGGTATTTACAAGTTGAAATTGTCAG
AAGATGGTACACAAATTGTCACACTGCATCTTGATGGTCGCATATCTTTT
TGGAGTATCCCGTCAATGAGGCTAATCAAAACTTGGAGTAAATCTGAACA
ACCTGATGCAAGTGGCGGCTCAAGTGAAGGGTTCTCCTTTGACTCGCAGA
AAAAAGAAGaTCTCACCAAAACAAGGAATTCAATAGATGTCAGCTGGTGG
TCTGAAAAGGAGATTGCTTTGGCATCTGGGAGGGGTGATGTAACGATTGC
TTCGACTGACAGCTTGAAGAATTTACTTGGAGAGTCGAGTGAGAAATTTG
ATCCATGGCCGTCACTCAGCCAAGTGGTGGATGGAAGCATTCTTGTGCTC
GAGTGTGAGAAACGAGTGAACGATCCAAACAACAAAACGAAGACATCTTG
GAAATGGACTTCAGAAGAAGATGAAAGCCAAGATGAAGTGAACTCGATTC
GTTATCGATTCAAAGAACTCACTAAACAGATGTTATATTTCATCACTGAG
GCTGAAAGGTTTTTACCAGCTGTCAAGCCTCCAAGAATTTTAACCAACGT
TTATCGTTTACTATGCTTGAAATCTACAACACCCGAAGAATTATACACGC
GGAAAATCAATCTTGAACATTACGGAGAGGCCTTGGACCTAGCTAAACGT
TTTGGTTTGAATACTGATTTAGTTTATCAGCGACAGTGGAAAAAGAAAAG
AGTTTCGAAGATTACCATTCATGATTATCtgtcCAAGATTAAAGATCGAT
ATTGGGTTTTGGACGAGTGCCTTTTACGAGTTGCCGATGACTTTGACTCG
ACAGAAGAGTTACTGAAATACGGTTTACTCGGTACAAGTTGGGAAATCTT
GCAAAGGATTGATGAAGAGGGTAAAGGTGatgcaaaggatgatgggaAGT
TATTACCTTTTAAATTTGACGCCGCCCCACATGACGAGGATGACGAAAAC
TCAAGTAGAGAATTCCAAgggagTCTAACGAAGAAGCAATTGAAAATCTG
CCAATATCGACGGCAATTATTACATTATCTTGATCGGCTTTCCACTTATG
AGGTTGTTTTGGGAGGCTCATTCAAAGCACGAGATAAATTCTCAAAAGAG
TATTTTACCAAATTTCGATCGTGCAATATGGTACACCAAGCGGTCGAGTG
TGCCCGCGACGAGGACGCTTATACTCTGGAGCATTTGTTTTCGTACCATG
GGAAGCAGTTACTACCTTATTGGCTGCCGATATTATCAAACTTCCCGGAA
ACAACCGATATCCGATATTTTGAGCCGGTCATCCCTGAGATTGGAGAGCC
ACCAGAAGATCCAGAGATTTTACCTTGGTTAGAGAAACACCATCGTGAAG
AGGATTGGGTCGAGCAATCGAATATTGTCCAACAAATCAAGTCTAATGAA
GAAGGTGACGCAAACGAAGATATAGGCTCATTCATTTTCGAATCCGATCC
AGAGATacgaaaattttacaaatgtGAAACAAAAGCTCAACTGAGAGAAT
GGTTTTTACATCGTGTACACTTGATTGATGAATATTCCGGTCAGATTGAT
AAATGTTGCGAGCTGTTAGATGTGGGAATCAAAAGAGGCTTGGAAGGGCT
CACTAAGGTTCACCAAGAAATGGAAGCATGGAGACTCTTAGTTTACGACG
TTGGAATTGACAGTAAAATGACTGCAAAGAGTTTCGTGGAATTATCTGAA
TCATCGAAAATCAAATTGCTAATGTTCAAAACCTCAGATGTGACATTCGT
TAACGATTTCAAGCTATATCTAATGCCGTATTTAAGAAATATTGGAAAGA
AGGATTTTAAGAAACGCCAAGATTTACTTCATGAGTTTTTGGTGGAAATC
GCTAAAACTGATTTGACATGCTGCTTGAAGTTATTGGAAAAGTGTTCGCC
AGAGCTGCCAGAACCACTGCTTCCTGATATGGCGGAGATAATGAAGATTG
GGATTGATTGCGTTTACGCGTGCAAGAGAACGGATCAATTGAATCATTGT
TTCAGCATTGTCGAATGTTTGCCTTCGAGAGAAGAGGGAGTCATTAGCCG
TCCCGTGGAAGAGCTTCACATACAACTGGATCAATTGGAACATTTGCTGA
CAGGAGCGGAAATTTTACAGTATTACAACAACCCTCAGACCATCTCTTAC
ATTTCTGAAATTAAAGATGACTCTACTATTTGTAAACAACTCATTCAGCA
ATTGGTGAAAAACGCTGTTTGTAAAGGACGTTGTGTTCCAAAGGAATTGA
ACAAATTACTCGGACATTTGATCAAGCTTTCCAAAGAAGTTTTCCGGTGC
TGTGATATCAAGATCGTTCACCAGATTTTCGTTGAAGAATTACTACGGTC
CGGTTCACGTGAGAACATAACAGTAGCTGAAGAGTTGATCACGCCTTCCA
AACTTGCCGGGAATTCACCTCAAAGTAAGAAACCAGAACAACATTTGACG
TCTGCACTCTACCTCCTCAAATATGATGTTTCGGTTACCGTTGTGTTGGA
AGCGAGTCGTGAATATTTCAATGCAGCAATGTCGGGTAATGACTCTTCAA
TGGAACTGGCTAGATTGTGTCTAACATTGGTCAAAGATTGTCCAGAGAGT
GTTCAAGATGAATTGGATTTGATCAACTCGTTGGGTTTATTGTATGAATT
CAATGTATCCATGCTACCCTTACAAGTTCGCCTTTGCGCTGATAAATTGG
AAATTATCGATCTTTGTTTGAAGGAGAAGAAGAATGGGTACAAGAAAAAA
GACAAGCTCATCCAATTGAGTAATCTTTTGCAAATCTGTGGCCATGACAA
CAAAGAACGGATTGGACAAGTCAATATTAAAATTGCTGAATCAGCATTTG
AACATAAAGATTACACATACGCTGGTATCGTTTGTGTACAATTGGTGGAT
GATAATTATTCTAATGCTTGGTATATTTGCAGGAAACTTGGTGAATGTGC
TAAATATACCAACTTCACAATCAGGCAAAAGTTGTTGAGTTTTGCGTTAA
CTTATTGTCCAGTACATCACATTGAAGAAGTTTTACAAGAGAAAACTCAA
CTGGAAACCCAGGTTTTGTACGAGAGGTTGGGTGTATTTACGAAAGAAGG
CAAGAAAGACAAAATTGTGACCTCATCTAAGAAAGAAACTGAGGAAGAAA
ACGACGAAGACAATGTTGATGGGAATAACATATCAATCCTCAACAAGACC
AAAACTACAACAAAGAAATTGATTTCAAGCGTCGCCAGCGTGGCTGATAA
CCGCTGGGTTGGATCCGCAATGAATTGGGTCAAACCGTCGTCGGAAGGGT
CTGGTAACGAAGTTGATGTTGTTGAGCGGGAAATTGAAAGCGTTCGGCAT
AACCCATTTTATAGTTCGCTGGATTCGAAAAAGATTGACGAAGATGTTCA
AAGATTTAATTATAACGAGTTCAGCGACCATTTGAGGTGCGTCACAACCG
AAGAAAAAGTATTCAATCAGCTGGTGTTAAGAAGTCAAAAATTGAACGAG
CAAAGAACCCTGGGTAAAGAGCTCGAAAACACTGACCAAGCAATGCTATC
GTTGAGTGATATAGCTTATACTGAAGAAAGTTGTTTGTGTCTGGCTTACA
TGATGGCTATTTCTCAGCCAAAAGAAATCCATTCCCTATCGACCAAGCAT
CGGAAAAACACTTTCACTTTCCTTTTCACTGCTTATTACTATGCATTACA
AGAATAtgttaaaaacaacaaaatcgAATTCGATAAACAAGCACAGATTT
ACAGCGCGCCTCCGATTGATGTGATTACATGGATGCTAAAAGTGTTAGGT
AAGAAGCAAGgagaaaaggaagaaaaagaaaaaggagagACTTACTTTCT
GTCTAACATGAACAAGTTGCAAGACTTGATGCAAGCAAAGATGCTACAAG
CTCTTGACAAAGgaGTGGACATCGAAAGATTTTCAGTTGATAATGAATAT
AAACGTGAAACTATACTCGGATTAGCTATGAGTGTCGAAGACGAGTTGAT
TAACACAAGTTTGCTGCTAGCAGAGAAATATGATATCCCCGCATGGGAAG
TGTTGTTATCACACGTGGAATTTTTATTCACTGATAGTGGTCTAAAAGCC
AAAGCTATCCGCGAATCACTAAACAAATGGAAAGTTGATTCCCATTTGAA
ACCGAACGGTGATAAAGTCTTTGAGCGGATGAAGAAATATGTTTACCCAG
AAATCAATGGTAAAGACCACAATGCATTGCTGTTGTTCTACGTTTTCCTA
ATGAATTGCAGCTCGCCCACTAAAATATTGGAGGGTACGCTTACATTAGA
TGCTCATTCcaaacttttgaagaaaatcaaGGCTGCTGCATCATCCATCA
ATTACAAACTTCTCGTGCATGGAGATTCACCTTTGGAGGTGATTAGAGAC
TGTGTTGATGATAACAATGTACATTTGTTGGCTAAAATTGCATCCAAAAT
CCCCCAGGCGGATGGTAGTTACCTGTCATCAAACAAGATCTTCTTAGCAA
ACGCCATTCGGatgttttggaagaaaaaagaGAACAAGGATTGGTTGAAT
ACATTCGAAAACTGTAAACAACACTTCACCAAACTCCTGATAGAAGACGT
TGTCACTTTTGCTGACCATGCAATTTTTGGCGAGGAAGCTTTAGACTCGC
TGACCCAAGACACCAGACTGGAGATTGGTAAAAGAGtaataaaatatttg
agacaacaACGTGGTCAAGACGAGACCAAACAAAGAGGAGCTGACGATTA
TGATTCGCTTATGGAGCGCTACGATTCATCTATCAATGATTTGGAACTTT
CCATCGAACATCTCAAAACGCTGACTGATCCAATTTTCAAAGCAGTCTTT
GGTGACGATAACGAACTGAGCAAAACCTTTGGACGAGTATACGACTTATC
ACGTGGTCGAAAACAACCACTCGAAAAACTATTCCGTGATTTGTTCATAT
CGNTACAACCATTAGACAAAATTTCGAAACTGCGGAGTCTTTGTCGCAAT
GCATCTATTGACGTCCGCACGTGTTTCCAAGATGCTTTGCGCGGGATCCT
GAGTGACATCCAAAGCGATAGAGATTACACAAAACTACAGACTTTAACGG
AGAACATCAAAGCGCATCAAGAACATCAAACAGACCCTCTTGTTACCCAT
AGCGACGTCTTAGATGTGGTGCGGCCATTTTGTTCTGATGTTACAGCTAG
CACGGATGTGAAGAGTCACGTGTTACATNTTTTGTTCTGAatggaaGAAA
ATGAGCAAATATTGTATGATTTGATTGTTCACGAAGAATGGAAACAAGAA
CCACAGTTGTTGGACCAAGTTGAAAGTTATTTTTGGCAATATCGTGGTTC
ACTTCTAAAGAAGCTATGGAAAGTTTCACAAAGTTCTGCAATTTATATGT
GGGACAACTTGAAGACACAATTCAGATATCAAGCTACCTTTGGTTGCCCA
CCATTGAATTTTATCAATCTGATGAACAATTGCTTGCCATGGCTTATGGC
TTTGTCACCGGATGGAAATTTTATTGCCATCCTTCAAGATTCTGTTATTG
AAATAAGGACTGCTGGAAATTTTGAGCAAGTCATTACAAAATATAAGATT
GAAAAAGATATGTTTCCAAGATGGCGTAAATTGATTTGGAATCATGACAA
CACCTTACTTTGTTATTCAAACAGTTTTGGAGATTTGACCATTTTGGATA
TTACCGGCactaaaaaacattttattccaTCATCAAATAATGTCAAGTTA
AAAGTGCCTGGAACGCTGAGTTTGGCATTGTGTCATGTTGAATTTGTAGC
CAAAGGAAATagCTTCTTGTTATATACCTGCACCTATCAAGGATTTTTTA
CAGTTTATGAAGTGAATGAATCCTCCTGCACAATAAAATGGGACTACTCT
TTCATAACATTCCATCCATATGGATTAGCTGGTTTGGTTATTGATCATAA
AAATGGGTTATTGGTTGCAGCTGGGAATTATGGGAAGGAACCATTTCCTA
ATGTCATGGGAGATGCATGTTATGGATCATATTCTGGTATCAGTCTCTGG
AGATTTTTGAATGACACACCTCATCTAACTCTGGTTGAAGACCAGGGAAA
AGCTTTGAAGAAGGTATCCAGAGGTGAATGGTTAAAGAGTGTTGTTTTAA
GACGTGGCGATGAAAAAAACGAAATGTTGAAGCATGGTATTTACAAGTTG
AAATTGTCAGAAGATGGTACACAAATTGTCACACTGCATCTTGATGGTCG
CATATCTTTTTGGAGTATCCCGTCAATGAGGCTAATCAAAACTTGGAGTA
AATCTGAACAACCTGATGCAAGTGGCGGCTCAAGTGAAGGGTTCTCCTTT
GACTCGCAGAAAAAAGAAGaTCTCACCAAAACAAGGAATTCAATAGATGT
CAGCTGGTGGTCTGAAAAGGAGATTGCTTTGGCATCTGGGAGGGGTGATG
TAACGATTGCTTCGACTGACAGCTTGAAGAATTTACTTGGAGAGTCGAGT
GAGAAATTTGATCCATGGCCGTCACTCAGCCAAGTGGTGGATGGAAGCAT
TCTTGTGCTCGAGTGTGAGAAACGAGTGAACGATCCAAACAACAAAACGA
AGACATCTTGGAAATGGACTTCAGAAGAAGATGAAAGCCAAGATGAAGTG
AACTCGATTCGTTATCGATTCAAAGAACTCACTAAACAGATGTTATATTT
CATCACTGAGGCTGAAAGGTTTTTACCAGCTGTCAAGCCTCCAAGAATTT
TAACCAACGTTTATCGTTTACTATGCTTGAAATCTACAACACCCGAAGAA
TTATACACGCGGAAAATCAATCTTGAACATTACGGAGAGGCCTTGGACCT
AGCTAAACGTTTTGGTTTGAATACTGATTTAGTTTATCAGCGACAGTGGA
AAAAGAAAAGAGTTTCGAAGATTACCATTCATGATTATCtgtcCAAGATT
AAAGATCGATATTGGGTTTTGGACGAGTGCCTTTTACGAGTTGCCGATGA
CTTTGACTCGACAGAAGAGTTACTGAAATACGGTTTACTCGGTACAAGTT
GGGAAATCTTGCAAAGGATTGATGAAGAGGGTAAAGGTGatgcaaaggat
gatgggaAGTTATTACCTTTTAAATTTGACGCCGCCCCACATGACGAGGA
TGACGAAAACTCAAGTAGAGAATTCCAAgggagTCTAACGAAGAAGCAAT
TGAAAATCTGCCAATATCGACGGCAATTATTACATTATCTTGATCGGCTT
TCCACTTATGAGGTTGTTTTGGGAGGCTCATTCAAAGCACGAGATAAATT
CTCAAAAGAGTATTTTACCAAATTTCGATCGTGCAATATGGTACACCAAG
CGGTCGAGTGTGCCCGCGACGAGGACGCTTATACTCTGGAGCATTTGTTT
TCGTACCATGGGAAGCAGTTACTACCTTATTGGCTGCCGATATTATCAAA
CTTCCCGGAAACAACCGATATCCGATATTTTGAGCCGGTCATCCCTGAGA
TTGGAGAGCCACCAGAAGATCCAGAGATTTTACCTTGGTTAGAGAAACAC
CATCGTGAAGAGGATTGGGTCGAGCAATCGAATATTGTCCAACAAATCAA
GTCTAATGAAGAAGGTGACGCAAACGAAGATATAGGCTCATTCATTTTCG
AATCCGATCCAGAGATacgaaaattttacaaatgtGAAACAAAAGCTCAA
CTGAGAGAATGGTTTTTACATCGTGTACACTTGATTGATGAATATTCCGG
TCAGATTGATAAATGTTGCGAGCTGTTAGATGTGGGAATCAAAAGAGGCT
TGGAAGGGCTCACTAAGGTTCACCAAGAAATGGAAGCATGGAGACTCTTA
GTTTACGACGTTGGAATTGACAGTAAAATGACTGCAAAGAGTTTCGTGGA
ATTATCTGAATCATCGAAAATCAAATTGCTAATGTTCAAAACCTCAGATG
TGACATTCGTTAACGATTTCAAGCTATATCTAATGCCGTATTTAAGAAAT
ATTGGAAAGAAGGATTTTAAGAAACGCCAAGATTTACTTCATGAGTTTTT
GGTGGAAATCGCTAAAACTGATTTGACATGCTGCTTGAAGTTATTGGAAA
AGTGTTCGCCAGAGCTGCCAGAACCACTGCTTCCTGATATGGCGGAGATA
ATGAAGATTGGGATTGATTGCGTTTACGCGTGCAAGAGAACGGATCAATT
GAATCATTGTTTCAGCATTGTCGAATGTTTGCCTTCGAGAGAAGAGGGAG
TCATTAGCCGTCCCGTGGAAGAGCTTCACATACAACTGGATCAATTGGAA
CATTTGCTGACAGGAGCGGAAATTTTACAGTATTACAACAACCCTCAGAC
CATCTCTTACATTTCTGAAATTAAAGATGACTCTACTATTTGTAAACAAC
TCATTCAGCAATTGGTGAAAAACGCTGTTTGTAAAGGACGTTGTGTTCCA
AAGGAATTGAACAAATTACTCGGACATTTGATCAAGCTTTCCAAAGAAGT
TTTCCGGTGCTGTGATATCAAGATCGTTCACCAGATTTTCGTTGAAGAAT
TACTACGGTCCGGTTCACGTGAGAACATAACAGTAGCTGAAGAGTTGATC
ACGCCTTCCAAACTTGCCGGGAATTCACCTCAAAGTAAGAAACCAGAACA
ACATTTGACGTCTGCACTCTACCTCCTCAAATATGATGTTTCGGTTACCG
TTGTGTTGGAAGCGAGTCGTGAATATTTCAATGCAGCAATGTCGGGTAAT
GACTCTTCAATGGAACTGGCTAGATTGTGTCTAACATTGGTCAAAGATTG
TCCAGAGAGTGTTCAAGATGAATTGGATTTGATCAACTCGTTGGGTTTAT
TGTATGAATTCAATGTATCCATGCTACCCTTACAAGTTCGCCTTTGCGCT
GATAAATTGGAAATTATCGATCTTTGTTTGAAGGAGAAGAAGAATGGGTA
CAAGAAAAAAGACAAGCTCATCCAATTGAGTAATCTTTTGCAAATCTGTG
GCCATGACAACAAAGAACGGATTGGACAAGTCAATATTAAAATTGCTGAA
TCAGCATTTGAACATAAAGATTACACATACGCTGGTATCGTTTGTGTACA
ATTGGTGGATGATAATTATTCTAATGCTTGGTATATTTGCAGGAAACTTG
GTGAATGTGCTAAATATACCAACTTCACAATCAGGCAAAAGTTGTTGAGT
TTTGCGTTAACTTATTGTCCAGTACATCACATTGAAGAAGTTTTACAAGA
GAAAACTCAACTGGAAACCCAGGTTTTGTACGAGAGGTTGGGTGTATTTA
CGAAAGAAGGCAAGAAAGACAAAATTGTGACCTCATCTAAGAAAGAAACT
GAGGAAGAAAACGACGAAGACAATGTTGATGGGAATAACATATCAATCCT
CAACAAGACCAAAACTACAACAAAGAAATTGATTTCAAGCGTCGCCAGCG
TGGCTGATAACCGCTGGGTTGGATCCGCAATGAATTGGGTCAAACCGTCG
TCGGAAGGGTCTGGTAACGAAGTTGATGTTGTTGAGCGGGAAATTGAAAG
CGTTCGGCATAACCCATTTTATAGTTCGCTGGATTCGAAAAAGATTGACG
AAGATGTTCAAAGATTTAATTATAACGAGTTCAGCGACCATTTGAGGTGC
GTCACAACCGAAGAAAAAGTATTCAATCAGCTGGTGTTAAGAAGTCAAAA
ATTGAACGAGCAAAGAACCCTGGGTAAAGAGCTCGAAAACACTGACCAAG
CAATGCTATCGTTGAGTGATATAGCTTATACTGAAGAAAGTTGTTTGTGT
CTGGCTTACATGATGGCTATTTCTCAGCCAAAAGAAATCCATTCCCTATC
GACCAAGCATCGGAAAAACACTTTCACTTTCCTTTTCACTGCTTATTACT
ATGCATTACAAGAATAtgttaaaaacaacaaaatcgAATTCGATAAACAA
GCACAGATTTACAGCGCGCCTCCGATTGATGTGATTACATGGATGCTAAA
AGTGTTAGGTAAGAAGCAAGgagaaaaggaagaaaaagaaaaaggagagA
CTTACTTTCTGTCTAACATGAACAAGTTGCAAGACTTGATGCAAGCAAAG
ATGCTACAAGCTCTTGACAAAGgaGTGGACATCGAAAGATTTTCAGTTGA
TAATGAATATAAACGTGAAACTATACTCGGATTAGCTATGAGTGTCGAAG
ACGAGTTGATTAACACAAGTTTGCTGCTAGCAGAGAAATATGATATCCCC
GCATGGGAAGTGTTGTTATCACACGTGGAATTTTTATTCACTGATAGTGG
TCTAAAAGCCAAAGCTATCCGCGAATCACTAAACAAATGGAAAGTTGATT
CCCATTTGAAACCGAACGGTGATAAAGTCTTTGAGCGGATGAAGAAATAT
GTTTACCCAGAAATCAATGGTAAAGACCACAATGCATTGCTGTTGTTCTA
CGTTTTCCTAATGAATTGCAGCTCGCCCACTAAAATATTGGAGGGTACGC
TTACATTAGATGCTCATTCcaaacttttgaagaaaatcaaGGCTGCTGCA
TCATCCATCAATTACAAACTTCTCGTGCATGGAGATTCACCTTTGGAGGT
GATTAGAGACTGTGTTGATGATAACAATGTACATTTGTTGGCTAAAATTG
CATCCAAAATCCCCCAGGCGGATGGTAGTTACCTGTCATCAAACAAGATC
TTCTTAGCAAACGCCATTCGGatgttttggaagaaaaaagaGAACAAGGA
TTGGTTGAATACATTCGAAAACTGTAAACAACACTTCACCAAACTCCTGA
TAGAAGACGTTGTCACTTTTGCTGACCATGCAATTTTTGGCGAGGAAGCT
TTAGACTCGCTGACCCAAGACACCAGACTGGAGATTGGTAAAAGAGtaat
aaaatatttgagacaacaACGTGGTCAAGACGAGACCAAACAAAGAGGAG
CTGACGATTATGATTCGCTTATGGAGCGCTACGATTCATCTATCAATGAT
TTGGAACTTTCCATCGAACATCTCAAAACGCTGACTGATCCAATTTTCAA
AGCAGTCTTTGGTGACGATAACGAACTGAGCAAAACCTTTGGACGAGTAT
ACGACTTATCACGTGGTCGAAAACAACCACTCGAAAAACTATTCCGTGAT
TTGTTCATATCGNTACAACCATTAGACAAAATTTCGAAACTGCGGAGTCT
TTGTCGCAATGCATCTATTGACGTCCGCACGTGTTTCCAAGATGCTTTGC
GCGGGATCCTGAGTGACATCCAAAGCGATAGAGATTACACAAAACTACAG
ACTTTAACGGAGAACATCAAAGCGCATCAAGAACATCAAACAGACCCTCT
TGTTACCCATAGCGACGTCTTAGATGTGGTGCGGCCATTTTGTTCTGATG
TTACAGCTAGCACGGATGTGAAGAGTCACGTGTTACATNTTTTGTTCTGA
atggaaGAAAATGAGCAAATATTGTATGATTTGATTGTTCACGAAGAATG
GAAACAAGAACCACAGTTGTTGGACCAAGTTGAAAGTTATTTTTGGCAAT
ATCGTGGTTCACTTCTAAAGAAGCTATGGAAAGTTTCACAAAGTTCTGCA
ATTTATATGTGGGACAACTTGAAGACACAATTCAGATATCAAGCTACCTT
TGGTTGCCCACCATTGAATTTTATCAATCTGATGAACAATTGCTTGCCAT
GGCTTATGGCTTTGTCACCGGATGGAAATTTTATTGCCATCCTTCAAGAT
TCTGTTATTGAAATAAGGACTGCTGGAAATTTTGAGCAAGTCATTACAAA
ATATAAGATTGAAAAAGATATGTTTCCAAGATGGCGTAAATTGATTTGGA
ATCATGACAACACCTTACTTTGTTATTCAAACAGTTTTGGAGATTTGACC
ATTTTGGATATTACCGGCactaaaaaacattttattccaTCATCAAATAA
TGTCAAGTTAAAAGTGCCTGGAACGCTGAGTTTGGCATTGTGTCATGTTG
AATTTGTAGCCAAAGGAAATagCTTCTTGTTATATACCTGCACCTATCAA
GGATTTTTTACAGTTTATGAAGTGAATGAATCCTCCTGCACAATAAAATG
GGACTACTCTTTCATAACATTCCATCCATATGGATTAGCTGGTTTGGTTA
TTGATCATAAAAATGGGTTATTGGTTGCAGCTGGGAATTATGGGAAGGAA
CCATTTCCTAATGTCATGGGAGATGCATGTTATGGATCATATTCTGGTAT
CAGTCTCTGGAGATTTTTGAATGACACACCTCATCTAACTCTGGTTGAAG
ACCAGGGAAAAGCTTTGAAGAAGGTATCCAGAGGTGAATGGTTAAAGAGT
GTTGTTTTAAGACGTGGCGATGAAAAAAACGAAATGTTGAAGCATGGTAT
TTACAAGTTGAAATTGTCAGAAGATGGTACACAAATTGTCACACTGCATC
TTGATGGTCGCATATCTTTTTGGAGTATCCCGTCAATGAGGCTAATCAAA
ACTTGGAGTAAATCTGAACAACCTGATGCAAGTGGCGGCTCAAGTGAAGG
GTTCTCCTTTGACTCGCAGAAAAAAGAAGaTCTCACCAAAACAAGGAATT
CAATAGATGTCAGCTGGTGGTCTGAAAAGGAGATTGCTTTGGCATCTGGG
AGGGGTGATGTAACGATTGCTTCGACTGACAGCTTGAAGAATTTACTTGG
AGAGTCGAGTGAGAAATTTGATCCATGGCCGTCACTCAGCCAAGTGGTGG
ATGGAAGCATTCTTGTGCTCGAGTGTGAGAAACGAGTGAACGATCCAAAC
AACAAAACGAAGACATCTTGGAAATGGACTTCAGAAGAAGATGAAAGCCA
AGATGAAGTGAACTCGATTCGTTATCGATTCAAAGAACTCACTAAACAGA
TGTTATATTTCATCACTGAGGCTGAAAGGTTTTTACCAGCTGTCAAGCCT
CCAAGAATTTTAACCAACGTTTATCGTTTACTATGCTTGAAATCTACAAC
ACCCGAAGAATTATACACGCGGAAAATCAATCTTGAACATTACGGAGAGG
CCTTGGACCTAGCTAAACGTTTTGGTTTGAATACTGATTTAGTTTATCAG
CGACAGTGGAAAAAGAAAAGAGTTTCGAAGATTACCATTCATGATTATCt
gtcCAAGATTAAAGATCGATATTGGGTTTTGGACGAGTGCCTTTTACGAG
TTGCCGATGACTTTGACTCGACAGAAGAGTTACTGAAATACGGTTTACTC
GGTACAAGTTGGGAAATCTTGCAAAGGATTGATGAAGAGGGTAAAGGTGa
tgcaaaggatgatgggaAGTTATTACCTTTTAAATTTGACGCCGCCCCAC
ATGACGAGGATGACGAAAACTCAAGTAGAGAATTCCAAgggagTCTAACG
AAGAAGCAATTGAAAATCTGCCAATATCGACGGCAATTATTACATTATCT
TGATCGGCTTTCCACTTATGAGGTTGTTTTGGGAGGCTCATTCAAAGCAC
GAGATAAATTCTCAAAAGAGTATTTTACCAAATTTCGATCGTGCAATATG
GTACACCAAGCGGTCGAGTGTGCCCGCGACGAGGACGCTTATACTCTGGA
GCATTTGTTTTCGTACCATGGGAAGCAGTTACTACCTTATTGGCTGCCGA
TATTATCAAACTTCCCGGAAACAACCGATATCCGATATTTTGAGCCGGTC
ATCCCTGAGATTGGAGAGCCACCAGAAGATCCAGAGATTTTACCTTGGTT
AGAGAAACACCATCGTGAAGAGGATTGGGTCGAGCAATCGAATATTGTCC
AACAAATCAAGTCTAATGAAGAAGGTGACGCAAACGAAGATATAGGCTCA
TTCATTTTCGAATCCGATCCAGAGATacgaaaattttacaaatgtGAAAC
AAAAGCTCAACTGAGAGAATGGTTTTTACATCGTGTACACTTGATTGATG
AATATTCCGGTCAGATTGATAAATGTTGCGAGCTGTTAGATGTGGGAATC
AAAAGAGGCTTGGAAGGGCTCACTAAGGTTCACCAAGAAATGGAAGCATG
GAGACTCTTAGTTTACGACGTTGGAATTGACAGTAAAATGACTGCAAAGA
GTTTCGTGGAATTATCTGAATCATCGAAAATCAAATTGCTAATGTTCAAA
ACCTCAGATGTGACATTCGTTAACGATTTCAAGCTATATCTAATGCCGTA
TTTAAGAAATATTGGAAAGAAGGATTTTAAGAAACGCCAAGATTTACTTC
ATGAGTTTTTGGTGGAAATCGCTAAAACTGATTTGACATGCTGCTTGAAG
TTATTGGAAAAGTGTTCGCCAGAGCTGCCAGAACCACTGCTTCCTGATAT
GGCGGAGATAATGAAGATTGGGATTGATTGCGTTTACGCGTGCAAGAGAA
CGGATCAATTGAATCATTGTTTCAGCATTGTCGAATGTTTGCCTTCGAGA
GAAGAGGGAGTCATTAGCCGTCCCGTGGAAGAGCTTCACATACAACTGGA
TCAATTGGAACATTTGCTGACAGGAGCGGAAATTTTACAGTATTACAACA
ACCCTCAGACCATCTCTTACATTTCTGAAATTAAAGATGACTCTACTATT
TGTAAACAACTCATTCAGCAATTGGTGAAAAACGCTGTTTGTAAAGGACG
TTGTGTTCCAAAGGAATTGAACAAATTACTCGGACATTTGATCAAGCTTT
CCAAAGAAGTTTTCCGGTGCTGTGATATCAAGATCGTTCACCAGATTTTC
GTTGAAGAATTACTACGGTCCGGTTCACGTGAGAACATAACAGTAGCTGA
AGAGTTGATCACGCCTTCCAAACTTGCCGGGAATTCACCTCAAAGTAAGA
AACCAGAACAACATTTGACGTCTGCACTCTACCTCCTCAAATATGATGTT
TCGGTTACCGTTGTGTTGGAAGCGAGTCGTGAATATTTCAATGCAGCAAT
GTCGGGTAATGACTCTTCAATGGAACTGGCTAGATTGTGTCTAACATTGG
TCAAAGATTGTCCAGAGAGTGTTCAAGATGAATTGGATTTGATCAACTCG
TTGGGTTTATTGTATGAATTCAATGTATCCATGCTACCCTTACAAGTTCG
CCTTTGCGCTGATAAATTGGAAATTATCGATCTTTGTTTGAAGGAGAAGA
AGAATGGGTACAAGAAAAAAGACAAGCTCATCCAATTGAGTAATCTTTTG
CAAATCTGTGGCCATGACAACAAAGAACGGATTGGACAAGTCAATATTAA
AATTGCTGAATCAGCATTTGAACATAAAGATTACACATACGCTGGTATCG
TTTGTGTACAATTGGTGGATGATAATTATTCTAATGCTTGGTATATTTGC
AGGAAACTTGGTGAATGTGCTAAATATACCAACTTCACAATCAGGCAAAA
GTTGTTGAGTTTTGCGTTAACTTATTGTCCAGTACATCACATTGAAGAAG
TTTTACAAGAGAAAACTCAACTGGAAACCCAGGTTTTGTACGAGAGGTTG
GGTGTATTTACGAAAGAAGGCAAGAAAGACAAAATTGTGACCTCATCTAA
GAAAGAAACTGAGGAAGAAAACGACGAAGACAATGTTGATGGGAATAACA
TATCAATCCTCAACAAGACCAAAACTACAACAAAGAAATTGATTTCAAGC
GTCGCCAGCGTGGCTGATAACCGCTGGGTTGGATCCGCAATGAATTGGGT
CAAACCGTCGTCGGAAGGGTCTGGTAACGAAGTTGATGTTGTTGAGCGGG
AAATTGAAAGCGTTCGGCATAACCCATTTTATAGTTCGCTGGATTCGAAA
AAGATTGACGAAGATGTTCAAAGATTTAATTATAACGAGTTCAGCGACCA
TTTGAGGTGCGTCACAACCGAAGAAAAAGTATTCAATCAGCTGGTGTTAA
GAAGTCAAAAATTGAACGAGCAAAGAACCCTGGGTAAAGAGCTCGAAAAC
ACTGACCAAGCAATGCTATCGTTGAGTGATATAGCTTATACTGAAGAAAG
TTGTTTGTGTCTGGCTTACATGATGGCTATTTCTCAGCCAAAAGAAATCC
ATTCCCTATCGACCAAGCATCGGAAAAACACTTTCACTTTCCTTTTCACT
GCTTATTACTATGCATTACAAGAATAtgttaaaaacaacaaaatcgAATT
CGATAAACAAGCACAGATTTACAGCGCGCCTCCGATTGATGTGATTACAT
GGATGCTAAAAGTGTTAGGTAAGAAGCAAGgagaaaaggaagaaaaagaa
aaaggagagACTTACTTTCTGTCTAACATGAACAAGTTGCAAGACTTGAT
GCAAGCAAAGATGCTACAAGCTCTTGACAAAGgaGTGGACATCGAAAGAT
TTTCAGTTGATAATGAATATAAACGTGAAACTATACTCGGATTAGCTATG
AGTGTCGAAGACGAGTTGATTAACACAAGTTTGCTGCTAGCAGAGAAATA
TGATATCCCCGCATGGGAAGTGTTGTTATCACACGTGGAATTTTTATTCA
CTGATAGTGGTCTAAAAGCCAAAGCTATCCGCGAATCACTAAACAAATGG
AAAGTTGATTCCCATTTGAAACCGAACGGTGATAAAGTCTTTGAGCGGAT
GAAGAAATATGTTTACCCAGAAATCAATGGTAAAGACCACAATGCATTGC
TGTTGTTCTACGTTTTCCTAATGAATTGCAGCTCGCCCACTAAAATATTG
GAGGGTACGCTTACATTAGATGCTCATTCcaaacttttgaagaaaatcaa
GGCTGCTGCATCATCCATCAATTACAAACTTCTCGTGCATGGAGATTCAC
CTTTGGAGGTGATTAGAGACTGTGTTGATGATAACAATGTACATTTGTTG
GCTAAAATTGCATCCAAAATCCCCCAGGCGGATGGTAGTTACCTGTCATC
AAACAAGATCTTCTTAGCAAACGCCATTCGGatgttttggaagaaaaaag
aGAACAAGGATTGGTTGAATACATTCGAAAACTGTAAACAACACTTCACC
AAACTCCTGATAGAAGACGTTGTCACTTTTGCTGACCATGCAATTTTTGG
CGAGGAAGCTTTAGACTCGCTGACCCAAGACACCAGACTGGAGATTGGTA
AAAGAGtaataaaatatttgagacaacaACGTGGTCAAGACGAGACCAAA
CAAAGAGGAGCTGACGATTATGATTCGCTTATGGAGCGCTACGATTCATC
TATCAATGATTTGGAACTTTCCATCGAACATCTCAAAACGCTGACTGATC
CAATTTTCAAAGCAGTCTTTGGTGACGATAACGAACTGAGCAAAACCTTT
GGACGAGTATACGACTTATCACGTGGTCGAAAACAACCACTCGAAAAACT
ATTCCGTGATTTGTTCATATCGNTACAACCATTAGACAAAATTTCGAAAC
TGCGGAGTCTTTGTCGCAATGCATCTATTGACGTCCGCACGTGTTTCCAA
GATGCTTTGCGCGGGATCCTGAGTGACATCCAAAGCGATAGAGATTACAC
AAAACTACAGACTTTAACGGAGAACATCAAAGCGCATCAAGAACATCAAA
CAGACCCTCTTGTTACCCATAGCGACGTCTTAGATGTGGTGCGGCCATTT
TGTTCTGATGTTACAGCTAGCACGGATGTGAAGAGTCACGTGTTACATNT
TTTGTTCTGAatggaaGAAAATGAGCAAATATTGTATGATTTGATTGTTC
ACGAAGAATGGAAACAAGAACCACAGTTGTTGGACCAAGTTGAAAGTTAT
TTTTGGCAATATCGTGGTTCACTTCTAAAGAAGCTATGGAAAGTTTCACA
AAGTTCTGCAATTTATATGTGGGACAACTTGAAGACACAATTCAGATATC
AAGCTACCTTTGGTTGCCCACCATTGAATTTTATCAATCTGATGAACAAT
TGCTTGCCATGGCTTATGGCTTTGTCACCGGATGGAAATTTTATTGCCAT
CCTTCAAGATTCTGTTATTGAAATAAGGACTGCTGGAAATTTTGAGCAAG
TCATTACAAAATATAAGATTGAAAAAGATATGTTTCCAAGATGGCGTAAA
TTGATTTGGAATCATGACAACACCTTACTTTGTTATTCAAACAGTTTTGG
AGATTTGACCATTTTGGATATTACCGGCactaaaaaacattttattccaT
CATCAAATAATGTCAAGTTAAAAGTGCCTGGAACGCTGAGTTTGGCATTG
TGTCATGTTGAATTTGTAGCCAAAGGAAATagCTTCTTGTTATATACCTG
CACCTATCAAGGATTTTTTACAGTTTATGAAGTGAATGAATCCTCCTGCA
CAATAAAATGGGACTACTCTTTCATAACATTCCATCCATATGGATTAGCT
GGTTTGGTTATTGATCATAAAAATGGGTTATTGGTTGCAGCTGGGAATTA
TGGGAAGGAACCATTTCCTAATGTCATGGGAGATGCATGTTATGGATCAT
ATTCTGGTATCAGTCTCTGGAGATTTTTGAATGACACACCTCATCTAACT
CTGGTTGAAGACCAGGGAAAAGCTTTGAAGAAGGTATCCAGAGGTGAATG
GTTAAAGAGTGTTGTTTTAAGACGTGGCGATGAAAAAAACGAAATGTTGA
AGCATGGTATTTACAAGTTGAAATTGTCAGAAGATGGTACACAAATTGTC
ACACTGCATCTTGATGGTCGCATATCTTTTTGGAGTATCCCGTCAATGAG
GCTAATCAAAACTTGGAGTAAATCTGAACAACCTGATGCAAGTGGCGGCT
CAAGTGAAGGGTTCTCCTTTGACTCGCAGAAAAAAGAAGaTCTCACCAAA
ACAAGGAATTCAATAGATGTCAGCTGGTGGTCTGAAAAGGAGATTGCTTT
GGCATCTGGGAGGGGTGATGTAACGATTGCTTCGACTGACAGCTTGAAGA
ATTTACTTGGAGAGTCGAGTGAGAAATTTGATCCATGGCCGTCACTCAGC
CAAGTGGTGGATGGAAGCATTCTTGTGCTCGAGTGTGAGAAACGAGTGAA
CGATCCAAACAACAAAACGAAGACATCTTGGAAATGGACTTCAGAAGAAG
ATGAAAGCCAAGATGAAGTGAACTCGATTCGTTATCGATTCAAAGAACTC
ACTAAACAGATGTTATATTTCATCACTGAGGCTGAAAGGTTTTTACCAGC
TGTCAAGCCTCCAAGAATTTTAACCAACGTTTATCGTTTACTATGCTTGA
AATCTACAACACCCGAAGAATTATACACGCGGAAAATCAATCTTGAACAT
TACGGAGAGGCCTTGGACCTAGCTAAACGTTTTGGTTTGAATACTGATTT
AGTTTATCAGCGACAGTGGAAAAAGAAAAGAGTTTCGAAGATTACCATTC
ATGATTATCtgtcCAAGATTAAAGATCGATATTGGGTTTTGGACGAGTGC
CTTTTACGAGTTGCCGATGACTTTGACTCGACAGAAGAGTTACTGAAATA
CGGTTTACTCGGTACAAGTTGGGAAATCTTGCAAAGGATTGATGAAGAGG
GTAAAGGTGatgcaaaggatgatgggaAGTTATTACCTTTTAAATTTGAC
GCCGCCCCACATGACGAGGATGACGAAAACTCAAGTAGAGAATTCCAAgg
gagTCTAACGAAGAAGCAATTGAAAATCTGCCAATATCGACGGCAATTAT
TACATTATCTTGATCGGCTTTCCACTTATGAGGTTGTTTTGGGAGGCTCA
TTCAAAGCACGAGATAAATTCTCAAAAGAGTATTTTACCAAATTTCGATC
GTGCAATATGGTACACCAAGCGGTCGAGTGTGCCCGCGACGAGGACGCTT
ATACTCTGGAGCATTTGTTTTCGTACCATGGGAAGCAGTTACTACCTTAT
TGGCTGCCGATATTATCAAACTTCCCGGAAACAACCGATATCCGATATTT
TGAGCCGGTCATCCCTGAGATTGGAGAGCCACCAGAAGATCCAGAGATTT
TACCTTGGTTAGAGAAACACCATCGTGAAGAGGATTGGGTCGAGCAATCG
AATATTGTCCAACAAATCAAGTCTAATGAAGAAGGTGACGCAAACGAAGA
TATAGGCTCATTCATTTTCGAATCCGATCCAGAGATacgaaaattttaca
aatgtGAAACAAAAGCTCAACTGAGAGAATGGTTTTTACATCGTGTACAC
TTGATTGATGAATATTCCGGTCAGATTGATAAATGTTGCGAGCTGTTAGA
TGTGGGAATCAAAAGAGGCTTGGAAGGGCTCACTAAGGTTCACCAAGAAA
TGGAAGCATGGAGACTCTTAGTTTACGACGTTGGAATTGACAGTAAAATG
ACTGCAAAGAGTTTCGTGGAATTATCTGAATCATCGAAAATCAAATTGCT
AATGTTCAAAACCTCAGATGTGACATTCGTTAACGATTTCAAGCTATATC
TAATGCCGTATTTAAGAAATATTGGAAAGAAGGATTTTAAGAAACGCCAA
GATTTACTTCATGAGTTTTTGGTGGAAATCGCTAAAACTGATTTGACATG
CTGCTTGAAGTTATTGGAAAAGTGTTCGCCAGAGCTGCCAGAACCACTGC
TTCCTGATATGGCGGAGATAATGAAGATTGGGATTGATTGCGTTTACGCG
TGCAAGAGAACGGATCAATTGAATCATTGTTTCAGCATTGTCGAATGTTT
GCCTTCGAGAGAAGAGGGAGTCATTAGCCGTCCCGTGGAAGAGCTTCACA
TACAACTGGATCAATTGGAACATTTGCTGACAGGAGCGGAAATTTTACAG
TATTACAACAACCCTCAGACCATCTCTTACATTTCTGAAATTAAAGATGA
CTCTACTATTTGTAAACAACTCATTCAGCAATTGGTGAAAAACGCTGTTT
GTAAAGGACGTTGTGTTCCAAAGGAATTGAACAAATTACTCGGACATTTG
ATCAAGCTTTCCAAAGAAGTTTTCCGGTGCTGTGATATCAAGATCGTTCA
CCAGATTTTCGTTGAAGAATTACTACGGTCCGGTTCACGTGAGAACATAA
CAGTAGCTGAAGAGTTGATCACGCCTTCCAAACTTGCCGGGAATTCACCT
CAAAGTAAGAAACCAGAACAACATTTGACGTCTGCACTCTACCTCCTCAA
ATATGATGTTTCGGTTACCGTTGTGTTGGAAGCGAGTCGTGAATATTTCA
ATGCAGCAATGTCGGGTAATGACTCTTCAATGGAACTGGCTAGATTGTGT
CTAACATTGGTCAAAGATTGTCCAGAGAGTGTTCAAGATGAATTGGATTT
GATCAACTCGTTGGGTTTATTGTATGAATTCAATGTATCCATGCTACCCT
TACAAGTTCGCCTTTGCGCTGATAAATTGGAAATTATCGATCTTTGTTTG
AAGGAGAAGAAGAATGGGTACAAGAAAAAAGACAAGCTCATCCAATTGAG
TAATCTTTTGCAAATCTGTGGCCATGACAACAAAGAACGGATTGGACAAG
TCAATATTAAAATTGCTGAATCAGCATTTGAACATAAAGATTACACATAC
GCTGGTATCGTTTGTGTACAATTGGTGGATGATAATTATTCTAATGCTTG
GTATATTTGCAGGAAACTTGGTGAATGTGCTAAATATACCAACTTCACAA
TCAGGCAAAAGTTGTTGAGTTTTGCGTTAACTTATTGTCCAGTACATCAC
ATTGAAGAAGTTTTACAAGAGAAAACTCAACTGGAAACCCAGGTTTTGTA
CGAGAGGTTGGGTGTATTTACGAAAGAAGGCAAGAAAGACAAAATTGTGA
CCTCATCTAAGAAAGAAACTGAGGAAGAAAACGACGAAGACAATGTTGAT
GGGAATAACATATCAATCCTCAACAAGACCAAAACTACAACAAAGAAATT
GATTTCAAGCGTCGCCAGCGTGGCTGATAACCGCTGGGTTGGATCCGCAA
TGAATTGGGTCAAACCGTCGTCGGAAGGGTCTGGTAACGAAGTTGATGTT
GTTGAGCGGGAAATTGAAAGCGTTCGGCATAACCCATTTTATAGTTCGCT
GGATTCGAAAAAGATTGACGAAGATGTTCAAAGATTTAATTATAACGAGT
TCAGCGACCATTTGAGGTGCGTCACAACCGAAGAAAAAGTATTCAATCAG
CTGGTGTTAAGAAGTCAAAAATTGAACGAGCAAAGAACCCTGGGTAAAGA
GCTCGAAAACACTGACCAAGCAATGCTATCGTTGAGTGATATAGCTTATA
CTGAAGAAAGTTGTTTGTGTCTGGCTTACATGATGGCTATTTCTCAGCCA
AAAGAAATCCATTCCCTATCGACCAAGCATCGGAAAAACACTTTCACTTT
CCTTTTCACTGCTTATTACTATGCATTACAAGAATAtgttaaaaacaaca
aaatcgAATTCGATAAACAAGCACAGATTTACAGCGCGCCTCCGATTGAT
GTGATTACATGGATGCTAAAAGTGTTAGGTAAGAAGCAAGgagaaaagga
agaaaaagaaaaaggagagACTTACTTTCTGTCTAACATGAACAAGTTGC
AAGACTTGATGCAAGCAAAGATGCTACAAGCTCTTGACAAAGgaGTGGAC
ATCGAAAGATTTTCAGTTGATAATGAATATAAACGTGAAACTATACTCGG
ATTAGCTATGAGTGTCGAAGACGAGTTGATTAACACAAGTTTGCTGCTAG
CAGAGAAATATGATATCCCCGCATGGGAAGTGTTGTTATCACACGTGGAA
TTTTTATTCACTGATAGTGGTCTAAAAGCCAAAGCTATCCGCGAATCACT
AAACAAATGGAAAGTTGATTCCCATTTGAAACCGAACGGTGATAAAGTCT
TTGAGCGGATGAAGAAATATGTTTACCCAGAAATCAATGGTAAAGACCAC
AATGCATTGCTGTTGTTCTACGTTTTCCTAATGAATTGCAGCTCGCCCAC
TAAAATATTGGAGGGTACGCTTACATTAGATGCTCATTCcaaacttttga
agaaaatcaaGGCTGCTGCATCATCCATCAATTACAAACTTCTCGTGCAT
GGAGATTCACCTTTGGAGGTGATTAGAGACTGTGTTGATGATAACAATGT
ACATTTGTTGGCTAAAATTGCATCCAAAATCCCCCAGGCGGATGGTAGTT
ACCTGTCATCAAACAAGATCTTCTTAGCAAACGCCATTCGGatgttttgg
aagaaaaaagaGAACAAGGATTGGTTGAATACATTCGAAAACTGTAAACA
ACACTTCACCAAACTCCTGATAGAAGACGTTGTCACTTTTGCTGACCATG
CAATTTTTGGCGAGGAAGCTTTAGACTCGCTGACCCAAGACACCAGACTG
GAGATTGGTAAAAGAGtaataaaatatttgagacaacaACGTGGTCAAGA
CGAGACCAAACAAAGAGGAGCTGACGATTATGATTCGCTTATGGAGCGCT
ACGATTCATCTATCAATGATTTGGAACTTTCCATCGAACATCTCAAAACG
CTGACTGATCCAATTTTCAAAGCAGTCTTTGGTGACGATAACGAACTGAG
CAAAACCTTTGGACGAGTATACGACTTATCACGTGGTCGAAAACAACCAC
TCGAAAAACTATTCCGTGATTTGTTCATATCGNTACAACCATTAGACAAA
ATTTCGAAACTGCGGAGTCTTTGTCGCAATGCATCTATTGACGTCCGCAC
GTGTTTCCAAGATGCTTTGCGCGGGATCCTGAGTGACATCCAAAGCGATA
GAGATTACACAAAACTACAGACTTTAACGGAGAACATCAAAGCGCATCAA
GAACATCAAACAGACCCTCTTGTTACCCATAGCGACGTCTTAGATGTGGT
GCGGCCATTTTGTTCTGATGTTACAGCTAGCACGGATGTGAAGAGTCACG
TGTTACATNTTTTGTTCTGAatggaaGAAAATGAGCAAATATTGTATGAT
TTGATTGTTCACGAAGAATGGAAACAAGAACCACAGTTGTTGGACCAAGT
TGAAAGTTATTTTTGGCAATATCGTGGTTCACTTCTAAAGAAGCTATGGA
AAGTTTCACAAAGTTCTGCAATTTATATGTGGGACAACTTGAAGACACAA
TTCAGATATCAAGCTACCTTTGGTTGCCCACCATTGAATTTTATCAATCT
GATGAACAATTGCTTGCCATGGCTTATGGCTTTGTCACCGGATGGAAATT
TTATTGCCATCCTTCAAGATTCTGTTATTGAAATAAGGACTGCTGGAAAT
TTTGAGCAAGTCATTACAAAATATAAGATTGAAAAAGATATGTTTCCAAG
ATGGCGTAAATTGATTTGGAATCATGACAACACCTTACTTTGTTATTCAA
ACAGTTTTGGAGATTTGACCATTTTGGATATTACCGGCactaaaaaacat
tttattccaTCATCAAATAATGTCAAGTTAAAAGTGCCTGGAACGCTGAG
TTTGGCATTGTGTCATGTTGAATTTGTAGCCAAAGGAAATagCTTCTTGT
TATATACCTGCACCTATCAAGGATTTTTTACAGTTTATGAAGTGAATGAA
TCCTCCTGCACAATAAAATGGGACTACTCTTTCATAACATTCCATCCATA
TGGATTAGCTGGTTTGGTTATTGATCATAAAAATGGGTTATTGGTTGCAG
CTGGGAATTATGGGAAGGAACCATTTCCTAATGTCATGGGAGATGCATGT
TATGGATCATATTCTGGTATCAGTCTCTGGAGATTTTTGAATGACACACC
TCATCTAACTCTGGTTGAAGACCAGGGAAAAGCTTTGAAGAAGGTATCCA
GAGGTGAATGGTTAAAGAGTGTTGTTTTAAGACGTGGCGATGAAAAAAAC
GAAATGTTGAAGCATGGTATTTACAAGTTGAAATTGTCAGAAGATGGTAC
ACAAATTGTCACACTGCATCTTGATGGTCGCATATCTTTTTGGAGTATCC
CGTCAATGAGGCTAATCAAAACTTGGAGTAAATCTGAACAACCTGATGCA
AGTGGCGGCTCAAGTGAAGGGTTCTCCTTTGACTCGCAGAAAAAAGAAGa
TCTCACCAAAACAAGGAATTCAATAGATGTCAGCTGGTGGTCTGAAAAGG
AGATTGCTTTGGCATCTGGGAGGGGTGATGTAACGATTGCTTCGACTGAC
AGCTTGAAGAATTTACTTGGAGAGTCGAGTGAGAAATTTGATCCATGGCC
GTCACTCAGCCAAGTGGTGGATGGAAGCATTCTTGTGCTCGAGTGTGAGA
AACGAGTGAACGATCCAAACAACAAAACGAAGACATCTTGGAAATGGACT
TCAGAAGAAGATGAAAGCCAAGATGAAGTGAACTCGATTCGTTATCGATT
CAAAGAACTCACTAAACAGATGTTATATTTCATCACTGAGGCTGAAAGGT
TTTTACCAGCTGTCAAGCCTCCAAGAATTTTAACCAACGTTTATCGTTTA
CTATGCTTGAAATCTACAACACCCGAAGAATTATACACGCGGAAAATCAA
TCTTGAACATTACGGAGAGGCCTTGGACCTAGCTAAACGTTTTGGTTTGA
ATACTGATTTAGTTTATCAGCGACAGTGGAAAAAGAAAAGAGTTTCGAAG
ATTACCATTCATGATTATCtgtcCAAGATTAAAGATCGATATTGGGTTTT
GGACGAGTGCCTTTTACGAGTTGCCGATGACTTTGACTCGACAGAAGAGT
TACTGAAATACGGTTTACTCGGTACAAGTTGGGAAATCTTGCAAAGGATT
GATGAAGAGGGTAAAGGTGatgcaaaggatgatgggaAGTTATTACCTTT
TAAATTTGACGCCGCCCCACATGACGAGGATGACGAAAACTCAAGTAGAG
AATTCCAAgggagTCTAACGAAGAAGCAATTGAAAATCTGCCAATATCGA
CGGCAATTATTACATTATCTTGATCGGCTTTCCACTTATGAGGTTGTTTT
GGGAGGCTCATTCAAAGCACGAGATAAATTCTCAAAAGAGTATTTTACCA
AATTTCGATCGTGCAATATGGTACACCAAGCGGTCGAGTGTGCCCGCGAC
GAGGACGCTTATACTCTGGAGCATTTGTTTTCGTACCATGGGAAGCAGTT
ACTACCTTATTGGCTGCCGATATTATCAAACTTCCCGGAAACAACCGATA
TCCGATATTTTGAGCCGGTCATCCCTGAGATTGGAGAGCCACCAGAAGAT
CCAGAGATTTTACCTTGGTTAGAGAAACACCATCGTGAAGAGGATTGGGT
CGAGCAATCGAATATTGTCCAACAAATCAAGTCTAATGAAGAAGGTGACG
CAAACGAAGATATAGGCTCATTCATTTTCGAATCCGATCCAGAGATacga
aaattttacaaatgtGAAACAAAAGCTCAACTGAGAGAATGGTTTTTACA
TCGTGTACACTTGATTGATGAATATTCCGGTCAGATTGATAAATGTTGCG
AGCTGTTAGATGTGGGAATCAAAAGAGGCTTGGAAGGGCTCACTAAGGTT
CACCAAGAAATGGAAGCATGGAGACTCTTAGTTTACGACGTTGGAATTGA
CAGTAAAATGACTGCAAAGAGTTTCGTGGAATTATCTGAATCATCGAAAA
TCAAATTGCTAATGTTCAAAACCTCAGATGTGACATTCGTTAACGATTTC
AAGCTATATCTAATGCCGTATTTAAGAAATATTGGAAAGAAGGATTTTAA
GAAACGCCAAGATTTACTTCATGAGTTTTTGGTGGAAATCGCTAAAACTG
ATTTGACATGCTGCTTGAAGTTATTGGAAAAGTGTTCGCCAGAGCTGCCA
GAACCACTGCTTCCTGATATGGCGGAGATAATGAAGATTGGGATTGATTG
CGTTTACGCGTGCAAGAGAACGGATCAATTGAATCATTGTTTCAGCATTG
TCGAATGTTTGCCTTCGAGAGAAGAGGGAGTCATTAGCCGTCCCGTGGAA
GAGCTTCACATACAACTGGATCAATTGGAACATTTGCTGACAGGAGCGGA
AATTTTACAGTATTACAACAACCCTCAGACCATCTCTTACATTTCTGAAA
TTAAAGATGACTCTACTATTTGTAAACAACTCATTCAGCAATTGGTGAAA
AACGCTGTTTGTAAAGGACGTTGTGTTCCAAAGGAATTGAACAAATTACT
CGGACATTTGATCAAGCTTTCCAAAGAAGTTTTCCGGTGCTGTGATATCA
AGATCGTTCACCAGATTTTCGTTGAAGAATTACTACGGTCCGGTTCACGT
GAGAACATAACAGTAGCTGAAGAGTTGATCACGCCTTCCAAACTTGCCGG
GAATTCACCTCAAAGTAAGAAACCAGAACAACATTTGACGTCTGCACTCT
ACCTCCTCAAATATGATGTTTCGGTTACCGTTGTGTTGGAAGCGAGTCGT
GAATATTTCAATGCAGCAATGTCGGGTAATGACTCTTCAATGGAACTGGC
TAGATTGTGTCTAACATTGGTCAAAGATTGTCCAGAGAGTGTTCAAGATG
AATTGGATTTGATCAACTCGTTGGGTTTATTGTATGAATTCAATGTATCC
ATGCTACCCTTACAAGTTCGCCTTTGCGCTGATAAATTGGAAATTATCGA
TCTTTGTTTGAAGGAGAAGAAGAATGGGTACAAGAAAAAAGACAAGCTCA
TCCAATTGAGTAATCTTTTGCAAATCTGTGGCCATGACAACAAAGAACGG
ATTGGACAAGTCAATATTAAAATTGCTGAATCAGCATTTGAACATAAAGA
TTACACATACGCTGGTATCGTTTGTGTACAATTGGTGGATGATAATTATT
CTAATGCTTGGTATATTTGCAGGAAACTTGGTGAATGTGCTAAATATACC
AACTTCACAATCAGGCAAAAGTTGTTGAGTTTTGCGTTAACTTATTGTCC
AGTACATCACATTGAAGAAGTTTTACAAGAGAAAACTCAACTGGAAACCC
AGGTTTTGTACGAGAGGTTGGGTGTATTTACGAAAGAAGGCAAGAAAGAC
AAAATTGTGACCTCATCTAAGAAAGAAACTGAGGAAGAAAACGACGAAGA
CAATGTTGATGGGAATAACATATCAATCCTCAACAAGACCAAAACTACAA
CAAAGAAATTGATTTCAAGCGTCGCCAGCGTGGCTGATAACCGCTGGGTT
GGATCCGCAATGAATTGGGTCAAACCGTCGTCGGAAGGGTCTGGTAACGA
AGTTGATGTTGTTGAGCGGGAAATTGAAAGCGTTCGGCATAACCCATTTT
ATAGTTCGCTGGATTCGAAAAAGATTGACGAAGATGTTCAAAGATTTAAT
TATAACGAGTTCAGCGACCATTTGAGGTGCGTCACAACCGAAGAAAAAGT
ATTCAATCAGCTGGTGTTAAGAAGTCAAAAATTGAACGAGCAAAGAACCC
TGGGTAAAGAGCTCGAAAACACTGACCAAGCAATGCTATCGTTGAGTGAT
ATAGCTTATACTGAAGAAAGTTGTTTGTGTCTGGCTTACATGATGGCTAT
TTCTCAGCCAAAAGAAATCCATTCCCTATCGACCAAGCATCGGAAAAACA
CTTTCACTTTCCTTTTCACTGCTTATTACTATGCATTACAAGAATAtgtt
aaaaacaacaaaatcgAATTCGATAAACAAGCACAGATTTACAGCGCGCC
TCCGATTGATGTGATTACATGGATGCTAAAAGTGTTAGGTAAGAAGCAAG
gagaaaaggaagaaaaagaaaaaggagagACTTACTTTCTGTCTAACATG
AACAAGTTGCAAGACTTGATGCAAGCAAAGATGCTACAAGCTCTTGACAA
AGgaGTGGACATCGAAAGATTTTCAGTTGATAATGAATATAAACGTGAAA
CTATACTCGGATTAGCTATGAGTGTCGAAGACGAGTTGATTAACACAAGT
TTGCTGCTAGCAGAGAAATATGATATCCCCGCATGGGAAGTGTTGTTATC
ACACGTGGAATTTTTATTCACTGATAGTGGTCTAAAAGCCAAAGCTATCC
GCGAATCACTAAACAAATGGAAAGTTGATTCCCATTTGAAACCGAACGGT
GATAAAGTCTTTGAGCGGATGAAGAAATATGTTTACCCAGAAATCAATGG
TAAAGACCACAATGCATTGCTGTTGTTCTACGTTTTCCTAATGAATTGCA
GCTCGCCCACTAAAATATTGGAGGGTACGCTTACATTAGATGCTCATTCc
aaacttttgaagaaaatcaaGGCTGCTGCATCATCCATCAATTACAAACT
TCTCGTGCATGGAGATTCACCTTTGGAGGTGATTAGAGACTGTGTTGATG
ATAACAATGTACATTTGTTGGCTAAAATTGCATCCAAAATCCCCCAGGCG
GATGGTAGTTACCTGTCATCAAACAAGATCTTCTTAGCAAACGCCATTCG
GatgttttggaagaaaaaagaGAACAAGGATTGGTTGAATACATTCGAAA
ACTGTAAACAACACTTCACCAAACTCCTGATAGAAGACGTTGTCACTTTT
GCTGACCATGCAATTTTTGGCGAGGAAGCTTTAGACTCGCTGACCCAAGA
CACCAGACTGGAGATTGGTAAAAGAGtaataaaatatttgagacaacaAC
GTGGTCAAGACGAGACCAAACAAAGAGGAGCTGACGATTATGATTCGCTT
ATGGAGCGCTACGATTCATCTATCAATGATTTGGAACTTTCCATCGAACA
TCTCAAAACGCTGACTGATCCAATTTTCAAAGCAGTCTTTGGTGACGATA
ACGAACTGAGCAAAACCTTTGGACGAGTATACGACTTATCACGTGGTCGA
AAACAACCACTCGAAAAACTATTCCGTGATTTGTTCATATCGNTACAACC
ATTAGACAAAATTTCGAAACTGCGGAGTCTTTGTCGCAATGCATCTATTG
ACGTCCGCACGTGTTTCCAAGATGCTTTGCGCGGGATCCTGAGTGACATC
CAAAGCGATAGAGATTACACAAAACTACAGACTTTAACGGAGAACATCAA
AGCGCATCAAGAACATCAAACAGACCCTCTTGTTACCCATAGCGACGTCT
TAGATGTGGTGCGGCCATTTTGTTCTGATGTTACAGCTAGCACGGATGTG
AAGAGTCACGTGTTACATNTTTTGTTCTGAatggaaGAAAATGAGCAAAT
ATTGTATGATTTGATTGTTCACGAAGAATGGAAACAAGAACCACAGTTGT
TGGACCAAGTTGAAAGTTATTTTTGGCAATATCGTGGTTCACTTCTAAAG
AAGCTATGGAAAGTTTCACAAAGTTCTGCAATTTATATGTGGGACAACTT
GAAGACACAATTCAGATATCAAGCTACCTTTGGTTGCCCACCATTGAATT
TTATCAATCTGATGAACAATTGCTTGCCATGGCTTATGGCTTTGTCACCG
GATGGAAATTTTATTGCCATCCTTCAAGATTCTGTTATTGAAATAAGGAC
TGCTGGAAATTTTGAGCAAGTCATTACAAAATATAAGATTGAAAAAGATA
TGTTTCCAAGATGGCGTAAATTGATTTGGAATCATGACAACACCTTACTT
TGTTATTCAAACAGTTTTGGAGATTTGACCATTTTGGATATTACCGGCac
taaaaaacattttattccaTCATCAAATAATGTCAAGTTAAAAGTGCCTG
GAACGCTGAGTTTGGCATTGTGTCATGTTGAATTTGTAGCCAAAGGAAAT
agCTTCTTGTTATATACCTGCACCTATCAAGGATTTTTTACAGTTTATGA
AGTGAATGAATCCTCCTGCACAATAAAATGGGACTACTCTTTCATAACAT
TCCATCCATATGGATTAGCTGGTTTGGTTATTGATCATAAAAATGGGTTA
TTGGTTGCAGCTGGGAATTATGGGAAGGAACCATTTCCTAATGTCATGGG
AGATGCATGTTATGGATCATATTCTGGTATCAGTCTCTGGAGATTTTTGA
ATGACACACCTCATCTAACTCTGGTTGAAGACCAGGGAAAAGCTTTGAAG
AAGGTATCCAGAGGTGAATGGTTAAAGAGTGTTGTTTTAAGACGTGGCGA
TGAAAAAAACGAAATGTTGAAGCATGGTATTTACAAGTTGAAATTGTCAG
AAGATGGTACACAAATTGTCACACTGCATCTTGATGGTCGCATATCTTTT
TGGAGTATCCCGTCAATGAGGCTAATCAAAACTTGGAGTAAATCTGAACA
ACCTGATGCAAGTGGCGGCTCAAGTGAAGGGTTCTCCTTTGACTCGCAGA
AAAAAGAAGaTCTCACCAAAACAAGGAATTCAATAGATGTCAGCTGGTGG
TCTGAAAAGGAGATTGCTTTGGCATCTGGGAGGGGTGATGTAACGATTGC
TTCGACTGACAGCTTGAAGAATTTACTTGGAGAGTCGAGTGAGAAATTTG
ATCCATGGCCGTCACTCAGCCAAGTGGTGGATGGAAGCATTCTTGTGCTC
GAGTGTGAGAAACGAGTGAACGATCCAAACAACAAAACGAAGACATCTTG
GAAATGGACTTCAGAAGAAGATGAAAGCCAAGATGAAGTGAACTCGATTC
GTTATCGATTCAAAGAACTCACTAAACAGATGTTATATTTCATCACTGAG
GCTGAAAGGTTTTTACCAGCTGTCAAGCCTCCAAGAATTTTAACCAACGT
TTATCGTTTACTATGCTTGAAATCTACAACACCCGAAGAATTATACACGC
GGAAAATCAATCTTGAACATTACGGAGAGGCCTTGGACCTAGCTAAACGT
TTTGGTTTGAATACTGATTTAGTTTATCAGCGACAGTGGAAAAAGAAAAG
AGTTTCGAAGATTACCATTCATGATTATCtgtcCAAGATTAAAGATCGAT
ATTGGGTTTTGGACGAGTGCCTTTTACGAGTTGCCGATGACTTTGACTCG
ACAGAAGAGTTACTGAAATACGGTTTACTCGGTACAAGTTGGGAAATCTT
GCAAAGGATTGATGAAGAGGGTAAAGGTGatgcaaaggatgatgggaAGT
TATTACCTTTTAAATTTGACGCCGCCCCACATGACGAGGATGACGAAAAC
TCAAGTAGAGAATTCCAAgggagTCTAACGAAGAAGCAATTGAAAATCTG
CCAATATCGACGGCAATTATTACATTATCTTGATCGGCTTTCCACTTATG
AGGTTGTTTTGGGAGGCTCATTCAAAGCACGAGATAAATTCTCAAAAGAG
TATTTTACCAAATTTCGATCGTGCAATATGGTACACCAAGCGGTCGAGTG
TGCCCGCGACGAGGACGCTTATACTCTGGAGCATTTGTTTTCGTACCATG
GGAAGCAGTTACTACCTTATTGGCTGCCGATATTATCAAACTTCCCGGAA
ACAACCGATATCCGATATTTTGAGCCGGTCATCCCTGAGATTGGAGAGCC
ACCAGAAGATCCAGAGATTTTACCTTGGTTAGAGAAACACCATCGTGAAG
AGGATTGGGTCGAGCAATCGAATATTGTCCAACAAATCAAGTCTAATGAA
GAAGGTGACGCAAACGAAGATATAGGCTCATTCATTTTCGAATCCGATCC
AGAGATacgaaaattttacaaatgtGAAACAAAAGCTCAACTGAGAGAAT
GGTTTTTACATCGTGTACACTTGATTGATGAATATTCCGGTCAGATTGAT
AAATGTTGCGAGCTGTTAGATGTGGGAATCAAAAGAGGCTTGGAAGGGCT
CACTAAGGTTCACCAAGAAATGGAAGCATGGAGACTCTTAGTTTACGACG
TTGGAATTGACAGTAAAATGACTGCAAAGAGTTTCGTGGAATTATCTGAA
TCATCGAAAATCAAATTGCTAATGTTCAAAACCTCAGATGTGACATTCGT
TAACGATTTCAAGCTATATCTAATGCCGTATTTAAGAAATATTGGAAAGA
AGGATTTTAAGAAACGCCAAGATTTACTTCATGAGTTTTTGGTGGAAATC
GCTAAAACTGATTTGACATGCTGCTTGAAGTTATTGGAAAAGTGTTCGCC
AGAGCTGCCAGAACCACTGCTTCCTGATATGGCGGAGATAATGAAGATTG
GGATTGATTGCGTTTACGCGTGCAAGAGAACGGATCAATTGAATCATTGT
TTCAGCATTGTCGAATGTTTGCCTTCGAGAGAAGAGGGAGTCATTAGCCG
TCCCGTGGAAGAGCTTCACATACAACTGGATCAATTGGAACATTTGCTGA
CAGGAGCGGAAATTTTACAGTATTACAACAACCCTCAGACCATCTCTTAC
ATTTCTGAAATTAAAGATGACTCTACTATTTGTAAACAACTCATTCAGCA
ATTGGTGAAAAACGCTGTTTGTAAAGGACGTTGTGTTCCAAAGGAATTGA
ACAAATTACTCGGACATTTGATCAAGCTTTCCAAAGAAGTTTTCCGGTGC
TGTGATATCAAGATCGTTCACCAGATTTTCGTTGAAGAATTACTACGGTC
CGGTTCACGTGAGAACATAACAGTAGCTGAAGAGTTGATCACGCCTTCCA
AACTTGCCGGGAATTCACCTCAAAGTAAGAAACCAGAACAACATTTGACG
TCTGCACTCTACCTCCTCAAATATGATGTTTCGGTTACCGTTGTGTTGGA
AGCGAGTCGTGAATATTTCAATGCAGCAATGTCGGGTAATGACTCTTCAA
TGGAACTGGCTAGATTGTGTCTAACATTGGTCAAAGATTGTCCAGAGAGT
GTTCAAGATGAATTGGATTTGATCAACTCGTTGGGTTTATTGTATGAATT
CAATGTATCCATGCTACCCTTACAAGTTCGCCTTTGCGCTGATAAATTGG
AAATTATCGATCTTTGTTTGAAGGAGAAGAAGAATGGGTACAAGAAAAAA
GACAAGCTCATCCAATTGAGTAATCTTTTGCAAATCTGTGGCCATGACAA
CAAAGAACGGATTGGACAAGTCAATATTAAAATTGCTGAATCAGCATTTG
AACATAAAGATTACACATACGCTGGTATCGTTTGTGTACAATTGGTGGAT
GATAATTATTCTAATGCTTGGTATATTTGCAGGAAACTTGGTGAATGTGC
TAAATATACCAACTTCACAATCAGGCAAAAGTTGTTGAGTTTTGCGTTAA
CTTATTGTCCAGTACATCACATTGAAGAAGTTTTACAAGAGAAAACTCAA
CTGGAAACCCAGGTTTTGTACGAGAGGTTGGGTGTATTTACGAAAGAAGG
CAAGAAAGACAAAATTGTGACCTCATCTAAGAAAGAAACTGAGGAAGAAA
ACGACGAAGACAATGTTGATGGGAATAACATATCAATCCTCAACAAGACC
AAAACTACAACAAAGAAATTGATTTCAAGCGTCGCCAGCGTGGCTGATAA
CCGCTGGGTTGGATCCGCAATGAATTGGGTCAAACCGTCGTCGGAAGGGT
CTGGTAACGAAGTTGATGTTGTTGAGCGGGAAATTGAAAGCGTTCGGCAT
AACCCATTTTATAGTTCGCTGGATTCGAAAAAGATTGACGAAGATGTTCA
AAGATTTAATTATAACGAGTTCAGCGACCATTTGAGGTGCGTCACAACCG
AAGAAAAAGTATTCAATCAGCTGGTGTTAAGAAGTCAAAAATTGAACGAG
CAAAGAACCCTGGGTAAAGAGCTCGAAAACACTGACCAAGCAATGCTATC
GTTGAGTGATATAGCTTATACTGAAGAAAGTTGTTTGTGTCTGGCTTACA
TGATGGCTATTTCTCAGCCAAAAGAAATCCATTCCCTATCGACCAAGCAT
CGGAAAAACACTTTCACTTTCCTTTTCACTGCTTATTACTATGCATTACA
AGAATAtgttaaaaacaacaaaatcgAATTCGATAAACAAGCACAGATTT
ACAGCGCGCCTCCGATTGATGTGATTACATGGATGCTAAAAGTGTTAGGT
AAGAAGCAAGgagaaaaggaagaaaaagaaaaaggagagACTTACTTTCT
GTCTAACATGAACAAGTTGCAAGACTTGATGCAAGCAAAGATGCTACAAG
CTCTTGACAAAGgaGTGGACATCGAAAGATTTTCAGTTGATAATGAATAT
AAACGTGAAACTATACTCGGATTAGCTATGAGTGTCGAAGACGAGTTGAT
TAACACAAGTTTGCTGCTAGCAGAGAAATATGATATCCCCGCATGGGAAG
TGTTGTTATCACACGTGGAATTTTTATTCACTGATAGTGGTCTAAAAGCC
AAAGCTATCCGCGAATCACTAAACAAATGGAAAGTTGATTCCCATTTGAA
ACCGAACGGTGATAAAGTCTTTGAGCGGATGAAGAAATATGTTTACCCAG
AAATCAATGGTAAAGACCACAATGCATTGCTGTTGTTCTACGTTTTCCTA
ATGAATTGCAGCTCGCCCACTAAAATATTGGAGGGTACGCTTACATTAGA
TGCTCATTCcaaacttttgaagaaaatcaaGGCTGCTGCATCATCCATCA
ATTACAAACTTCTCGTGCATGGAGATTCACCTTTGGAGGTGATTAGAGAC
TGTGTTGATGATAACAATGTACATTTGTTGGCTAAAATTGCATCCAAAAT
CCCCCAGGCGGATGGTAGTTACCTGTCATCAAACAAGATCTTCTTAGCAA
ACGCCATTCGGatgttttggaagaaaaaagaGAACAAGGATTGGTTGAAT
ACATTCGAAAACTGTAAACAACACTTCACCAAACTCCTGATAGAAGACGT
TGTCACTTTTGCTGACCATGCAATTTTTGGCGAGGAAGCTTTAGACTCGC
TGACCCAAGACACCAGACTGGAGATTGGTAAAAGAGtaataaaatatttg
agacaacaACGTGGTCAAGACGAGACCAAACAAAGAGGAGCTGACGATTA
TGATTCGCTTATGGAGCGCTACGATTCATCTATCAATGATTTGGAACTTT
CCATCGAACATCTCAAAACGCTGACTGATCCAATTTTCAAAGCAGTCTTT
GGTGACGATAACGAACTGAGCAAAACCTTTGGACGAGTATACGACTTATC
ACGTGGTCGAAAACAACCACTCGAAAAACTATTCCGTGATTTGTTCATAT
CGNTACAACCATTAGACAAAATTTCGAAACTGCGGAGTCTTTGTCGCAAT
GCATCTATTGACGTCCGCACGTGTTTCCAAGATGCTTTGCGCGGGATCCT
GAGTGACATCCAAAGCGATAGAGATTACACAAAACTACAGACTTTAACGG
AGAACATCAAAGCGCATCAAGAACATCAAACAGACCCTCTTGTTACCCAT
AGCGACGTCTTAGATGTGGTGCGGCCATTTTGTTCTGATGTTACAGCTAG
CACGGATGTGAAGAGTCACGTGTTACATNTTTTGTTCTGAatggaaGAAA
ATGAGCAAATATTGTATGATTTGATTGTTCACGAAGAATGGAAACAAGAA
CCACAGTTGTTGGACCAAGTTGAAAGTTATTTTTGGCAATATCGTGGTTC
ACTTCTAAAGAAGCTATGGAAAGTTTCACAAAGTTCTGCAATTTATATGT
GGGACAACTTGAAGACACAATTCAGATATCAAGCTACCTTTGGTTGCCCA
CCATTGAATTTTATCAATCTGATGAACAATTGCTTGCCATGGCTTATGGC
TTTGTCACCGGATGGAAATTTTATTGCCATCCTTCAAGATTCTGTTATTG
AAATAAGGACTGCTGGAAATTTTGAGCAAGTCATTACAAAATATAAGATT
GAAAAAGATATGTTTCCAAGATGGCGTAAATTGATTTGGAATCATGACAA
CACCTTACTTTGTTATTCAAACAGTTTTGGAGATTTGACCATTTTGGATA
TTACCGGCactaaaaaacattttattccaTCATCAAATAATGTCAAGTTA
AAAGTGCCTGGAACGCTGAGTTTGGCATTGTGTCATGTTGAATTTGTAGC
CAAAGGAAATagCTTCTTGTTATATACCTGCACCTATCAAGGATTTTTTA
CAGTTTATGAAGTGAATGAATCCTCCTGCACAATAAAATGGGACTACTCT
TTCATAACATTCCATCCATATGGATTAGCTGGTTTGGTTATTGATCATAA
AAATGGGTTATTGGTTGCAGCTGGGAATTATGGGAAGGAACCATTTCCTA
ATGTCATGGGAGATGCATGTTATGGATCATATTCTGGTATCAGTCTCTGG
AGATTTTTGAATGACACACCTCATCTAACTCTGGTTGAAGACCAGGGAAA
AGCTTTGAAGAAGGTATCCAGAGGTGAATGGTTAAAGAGTGTTGTTTTAA
GACGTGGCGATGAAAAAAACGAAATGTTGAAGCATGGTATTTACAAGTTG
AAATTGTCAGAAGATGGTACACAAATTGTCACACTGCATCTTGATGGTCG
CATATCTTTTTGGAGTATCCCGTCAATGAGGCTAATCAAAACTTGGAGTA
AATCTGAACAACCTGATGCAAGTGGCGGCTCAAGTGAAGGGTTCTCCTTT
GACTCGCAGAAAAAAGAAGaTCTCACCAAAACAAGGAATTCAATAGATGT
CAGCTGGTGGTCTGAAAAGGAGATTGCTTTGGCATCTGGGAGGGGTGATG
TAACGATTGCTTCGACTGACAGCTTGAAGAATTTACTTGGAGAGTCGAGT
GAGAAATTTGATCCATGGCCGTCACTCAGCCAAGTGGTGGATGGAAGCAT
TCTTGTGCTCGAGTGTGAGAAACGAGTGAACGATCCAAACAACAAAACGA
AGACATCTTGGAAATGGACTTCAGAAGAAGATGAAAGCCAAGATGAAGTG
AACTCGATTCGTTATCGATTCAAAGAACTCACTAAACAGATGTTATATTT
CATCACTGAGGCTGAAAGGTTTTTACCAGCTGTCAAGCCTCCAAGAATTT
TAACCAACGTTTATCGTTTACTATGCTTGAAATCTACAACACCCGAAGAA
TTATACACGCGGAAAATCAATCTTGAACATTACGGAGAGGCCTTGGACCT
AGCTAAACGTTTTGGTTTGAATACTGATTTAGTTTATCAGCGACAGTGGA
AAAAGAAAAGAGTTTCGAAGATTACCATTCATGATTATCtgtcCAAGATT
AAAGATCGATATTGGGTTTTGGACGAGTGCCTTTTACGAGTTGCCGATGA
CTTTGACTCGACAGAAGAGTTACTGAAATACGGTTTACTCGGTACAAGTT
GGGAAATCTTGCAAAGGATTGATGAAGAGGGTAAAGGTGatgcaaaggat
gatgggaAGTTATTACCTTTTAAATTTGACGCCGCCCCACATGACGAGGA
TGACGAAAACTCAAGTAGAGAATTCCAAgggagTCTAACGAAGAAGCAAT
TGAAAATCTGCCAATATCGACGGCAATTATTACATTATCTTGATCGGCTT
TCCACTTATGAGGTTGTTTTGGGAGGCTCATTCAAAGCACGAGATAAATT
CTCAAAAGAGTATTTTACCAAATTTCGATCGTGCAATATGGTACACCAAG
CGGTCGAGTGTGCCCGCGACGAGGACGCTTATACTCTGGAGCATTTGTTT
TCGTACCATGGGAAGCAGTTACTACCTTATTGGCTGCCGATATTATCAAA
CTTCCCGGAAACAACCGATATCCGATATTTTGAGCCGGTCATCCCTGAGA
TTGGAGAGCCACCAGAAGATCCAGAGATTTTACCTTGGTTAGAGAAACAC
CATCGTGAAGAGGATTGGGTCGAGCAATCGAATATTGTCCAACAAATCAA
GTCTAATGAAGAAGGTGACGCAAACGAAGATATAGGCTCATTCATTTTCG
AATCCGATCCAGAGATacgaaaattttacaaatgtGAAACAAAAGCTCAA
CTGAGAGAATGGTTTTTACATCGTGTACACTTGATTGATGAATATTCCGG
TCAGATTGATAAATGTTGCGAGCTGTTAGATGTGGGAATCAAAAGAGGCT
TGGAAGGGCTCACTAAGGTTCACCAAGAAATGGAAGCATGGAGACTCTTA
GTTTACGACGTTGGAATTGACAGTAAAATGACTGCAAAGAGTTTCGTGGA
ATTATCTGAATCATCGAAAATCAAATTGCTAATGTTCAAAACCTCAGATG
TGACATTCGTTAACGATTTCAAGCTATATCTAATGCCGTATTTAAGAAAT
ATTGGAAAGAAGGATTTTAAGAAACGCCAAGATTTACTTCATGAGTTTTT
GGTGGAAATCGCTAAAACTGATTTGACATGCTGCTTGAAGTTATTGGAAA
AGTGTTCGCCAGAGCTGCCAGAACCACTGCTTCCTGATATGGCGGAGATA
ATGAAGATTGGGATTGATTGCGTTTACGCGTGCAAGAGAACGGATCAATT
GAATCATTGTTTCAGCATTGTCGAATGTTTGCCTTCGAGAGAAGAGGGAG
TCATTAGCCGTCCCGTGGAAGAGCTTCACATACAACTGGATCAATTGGAA
CATTTGCTGACAGGAGCGGAAATTTTACAGTATTACAACAACCCTCAGAC
CATCTCTTACATTTCTGAAATTAAAGATGACTCTACTATTTGTAAACAAC
TCATTCAGCAATTGGTGAAAAACGCTGTTTGTAAAGGACGTTGTGTTCCA
AAGGAATTGAACAAATTACTCGGACATTTGATCAAGCTTTCCAAAGAAGT
TTTCCGGTGCTGTGATATCAAGATCGTTCACCAGATTTTCGTTGAAGAAT
TACTACGGTCCGGTTCACGTGAGAACATAACAGTAGCTGAAGAGTTGATC
ACGCCTTCCAAACTTGCCGGGAATTCACCTCAAAGTAAGAAACCAGAACA
ACATTTGACGTCTGCACTCTACCTCCTCAAATATGATGTTTCGGTTACCG
TTGTGTTGGAAGCGAGTCGTGAATATTTCAATGCAGCAATGTCGGGTAAT
GACTCTTCAATGGAACTGGCTAGATTGTGTCTAACATTGGTCAAAGATTG
TCCAGAGAGTGTTCAAGATGAATTGGATTTGATCAACTCGTTGGGTTTAT
TGTATGAATTCAATGTATCCATGCTACCCTTACAAGTTCGCCTTTGCGCT
GATAAATTGGAAATTATCGATCTTTGTTTGAAGGAGAAGAAGAATGGGTA
CAAGAAAAAAGACAAGCTCATCCAATTGAGTAATCTTTTGCAAATCTGTG
GCCATGACAACAAAGAACGGATTGGACAAGTCAATATTAAAATTGCTGAA
TCAGCATTTGAACATAAAGATTACACATACGCTGGTATCGTTTGTGTACA
ATTGGTGGATGATAATTATTCTAATGCTTGGTATATTTGCAGGAAACTTG
GTGAATGTGCTAAATATACCAACTTCACAATCAGGCAAAAGTTGTTGAGT
TTTGCGTTAACTTATTGTCCAGTACATCACATTGAAGAAGTTTTACAAGA
GAAAACTCAACTGGAAACCCAGGTTTTGTACGAGAGGTTGGGTGTATTTA
CGAAAGAAGGCAAGAAAGACAAAATTGTGACCTCATCTAAGAAAGAAACT
GAGGAAGAAAACGACGAAGACAATGTTGATGGGAATAACATATCAATCCT
CAACAAGACCAAAACTACAACAAAGAAATTGATTTCAAGCGTCGCCAGCG
TGGCTGATAACCGCTGGGTTGGATCCGCAATGAATTGGGTCAAACCGTCG
TCGGAAGGGTCTGGTAACGAAGTTGATGTTGTTGAGCGGGAAATTGAAAG
CGTTCGGCATAACCCATTTTATAGTTCGCTGGATTCGAAAAAGATTGACG
AAGATGTTCAAAGATTTAATTATAACGAGTTCAGCGACCATTTGAGGTGC
GTCACAACCGAAGAAAAAGTATTCAATCAGCTGGTGTTAAGAAGTCAAAA
ATTGAACGAGCAAAGAACCCTGGGTAAAGAGCTCGAAAACACTGACCAAG
CAATGCTATCGTTGAGTGATATAGCTTATACTGAAGAAAGTTGTTTGTGT
CTGGCTTACATGATGGCTATTTCTCAGCCAAAAGAAATCCATTCCCTATC
GACCAAGCATCGGAAAAACACTTTCACTTTCCTTTTCACTGCTTATTACT
ATGCATTACAAGAATAtgttaaaaacaacaaaatcgAATTCGATAAACAA
GCACAGATTTACAGCGCGCCTCCGATTGATGTGATTACATGGATGCTAAA
AGTGTTAGGTAAGAAGCAAGgagaaaaggaagaaaaagaaaaaggagagA
CTTACTTTCTGTCTAACATGAACAAGTTGCAAGACTTGATGCAAGCAAAG
ATGCTACAAGCTCTTGACAAAGgaGTGGACATCGAAAGATTTTCAGTTGA
TAATGAATATAAACGTGAAACTATACTCGGATTAGCTATGAGTGTCGAAG
ACGAGTTGATTAACACAAGTTTGCTGCTAGCAGAGAAATATGATATCCCC
GCATGGGAAGTGTTGTTATCACACGTGGAATTTTTATTCACTGATAGTGG
TCTAAAAGCCAAAGCTATCCGCGAATCACTAAACAAATGGAAAGTTGATT
CCCATTTGAAACCGAACGGTGATAAAGTCTTTGAGCGGATGAAGAAATAT
GTTTACCCAGAAATCAATGGTAAAGACCACAATGCATTGCTGTTGTTCTA
CGTTTTCCTAATGAATTGCAGCTCGCCCACTAAAATATTGGAGGGTACGC
TTACATTAGATGCTCATTCcaaacttttgaagaaaatcaaGGCTGCTGCA
TCATCCATCAATTACAAACTTCTCGTGCATGGAGATTCACCTTTGGAGGT
GATTAGAGACTGTGTTGATGATAACAATGTACATTTGTTGGCTAAAATTG
CATCCAAAATCCCCCAGGCGGATGGTAGTTACCTGTCATCAAACAAGATC
TTCTTAGCAAACGCCATTCGGatgttttggaagaaaaaagaGAACAAGGA
TTGGTTGAATACATTCGAAAACTGTAAACAACACTTCACCAAACTCCTGA
TAGAAGACGTTGTCACTTTTGCTGACCATGCAATTTTTGGCGAGGAAGCT
TTAGACTCGCTGACCCAAGACACCAGACTGGAGATTGGTAAAAGAGtaat
aaaatatttgagacaacaACGTGGTCAAGACGAGACCAAACAAAGAGGAG
CTGACGATTATGATTCGCTTATGGAGCGCTACGATTCATCTATCAATGAT
TTGGAACTTTCCATCGAACATCTCAAAACGCTGACTGATCCAATTTTCAA
AGCAGTCTTTGGTGACGATAACGAACTGAGCAAAACCTTTGGACGAGTAT
ACGACTTATCACGTGGTCGAAAACAACCACTCGAAAAACTATTCCGTGAT
TTGTTCATATCGNTACAACCATTAGACAAAATTTCGAAACTGCGGAGTCT
TTGTCGCAATGCATCTATTGACGTCCGCACGTGTTTCCAAGATGCTTTGC
GCGGGATCCTGAGTGACATCCAAAGCGATAGAGATTACACAAAACTACAG
ACTTTAACGGAGAACATCAAAGCGCATCAAGAACATCAAACAGACCCTCT
TGTTACCCATAGCGACGTCTTAGATGTGGTGCGGCCATTTTGTTCTGATG
TTACAGCTAGCACGGATGTGAAGAGTCACGTGTTACATNTTTTGTTCTGA
atggaaGAAAATGAGCAAATATTGTATGATTTGATTGTTCACGAAGAATG
GAAACAAGAACCACAGTTGTTGGACCAAGTTGAAAGTTATTTTTGGCAAT
ATCGTGGTTCACTTCTAAAGAAGCTATGGAAAGTTTCACAAAGTTCTGCA
ATTTATATGTGGGACAACTTGAAGACACAATTCAGATATCAAGCTACCTT
TGGTTGCCCACCATTGAATTTTATCAATCTGATGAACAATTGCTTGCCAT
GGCTTATGGCTTTGTCACCGGATGGAAATTTTATTGCCATCCTTCAAGAT
TCTGTTATTGAAATAAGGACTGCTGGAAATTTTGAGCAAGTCATTACAAA
ATATAAGATTGAAAAAGATATGTTTCCAAGATGGCGTAAATTGATTTGGA
ATCATGACAACACCTTACTTTGTTATTCAAACAGTTTTGGAGATTTGACC
ATTTTGGATATTACCGGCactaaaaaacattttattccaTCATCAAATAA
TGTCAAGTTAAAAGTGCCTGGAACGCTGAGTTTGGCATTGTGTCATGTTG
AATTTGTAGCCAAAGGAAATagCTTCTTGTTATATACCTGCACCTATCAA
GGATTTTTTACAGTTTATGAAGTGAATGAATCCTCCTGCACAATAAAATG
GGACTACTCTTTCATAACATTCCATCCATATGGATTAGCTGGTTTGGTTA
TTGATCATAAAAATGGGTTATTGGTTGCAGCTGGGAATTATGGGAAGGAA
CCATTTCCTAATGTCATGGGAGATGCATGTTATGGATCATATTCTGGTAT
CAGTCTCTGGAGATTTTTGAATGACACACCTCATCTAACTCTGGTTGAAG
ACCAGGGAAAAGCTTTGAAGAAGGTATCCAGAGGTGAATGGTTAAAGAGT
GTTGTTTTAAGACGTGGCGATGAAAAAAACGAAATGTTGAAGCATGGTAT
TTACAAGTTGAAATTGTCAGAAGATGGTACACAAATTGTCACACTGCATC
TTGATGGTCGCATATCTTTTTGGAGTATCCCGTCAATGAGGCTAATCAAA
ACTTGGAGTAAATCTGAACAACCTGATGCAAGTGGCGGCTCAAGTGAAGG
GTTCTCCTTTGACTCGCAGAAAAAAGAAGaTCTCACCAAAACAAGGAATT
CAATAGATGTCAGCTGGTGGTCTGAAAAGGAGATTGCTTTGGCATCTGGG
AGGGGTGATGTAACGATTGCTTCGACTGACAGCTTGAAGAATTTACTTGG
AGAGTCGAGTGAGAAATTTGATCCATGGCCGTCACTCAGCCAAGTGGTGG
ATGGAAGCATTCTTGTGCTCGAGTGTGAGAAACGAGTGAACGATCCAAAC
AACAAAACGAAGACATCTTGGAAATGGACTTCAGAAGAAGATGAAAGCCA
AGATGAAGTGAACTCGATTCGTTATCGATTCAAAGAACTCACTAAACAGA
TGTTATATTTCATCACTGAGGCTGAAAGGTTTTTACCAGCTGTCAAGCCT
CCAAGAATTTTAACCAACGTTTATCGTTTACTATGCTTGAAATCTACAAC
ACCCGAAGAATTATACACGCGGAAAATCAATCTTGAACATTACGGAGAGG
CCTTGGACCTAGCTAAACGTTTTGGTTTGAATACTGATTTAGTTTATCAG
CGACAGTGGAAAAAGAAAAGAGTTTCGAAGATTACCATTCATGATTATCt
gtcCAAGATTAAAGATCGATATTGGGTTTTGGACGAGTGCCTTTTACGAG
TTGCCGATGACTTTGACTCGACAGAAGAGTTACTGAAATACGGTTTACTC
GGTACAAGTTGGGAAATCTTGCAAAGGATTGATGAAGAGGGTAAAGGTGa
tgcaaaggatgatgggaAGTTATTACCTTTTAAATTTGACGCCGCCCCAC
ATGACGAGGATGACGAAAACTCAAGTAGAGAATTCCAAgggagTCTAACG
AAGAAGCAATTGAAAATCTGCCAATATCGACGGCAATTATTACATTATCT
TGATCGGCTTTCCACTTATGAGGTTGTTTTGGGAGGCTCATTCAAAGCAC
GAGATAAATTCTCAAAAGAGTATTTTACCAAATTTCGATCGTGCAATATG
GTACACCAAGCGGTCGAGTGTGCCCGCGACGAGGACGCTTATACTCTGGA
GCATTTGTTTTCGTACCATGGGAAGCAGTTACTACCTTATTGGCTGCCGA
TATTATCAAACTTCCCGGAAACAACCGATATCCGATATTTTGAGCCGGTC
ATCCCTGAGATTGGAGAGCCACCAGAAGATCCAGAGATTTTACCTTGGTT
AGAGAAACACCATCGTGAAGAGGATTGGGTCGAGCAATCGAATATTGTCC
AACAAATCAAGTCTAATGAAGAAGGTGACGCAAACGAAGATATAGGCTCA
TTCATTTTCGAATCCGATCCAGAGATacgaaaattttacaaatgtGAAAC
AAAAGCTCAACTGAGAGAATGGTTTTTACATCGTGTACACTTGATTGATG
AATATTCCGGTCAGATTGATAAATGTTGCGAGCTGTTAGATGTGGGAATC
AAAAGAGGCTTGGAAGGGCTCACTAAGGTTCACCAAGAAATGGAAGCATG
GAGACTCTTAGTTTACGACGTTGGAATTGACAGTAAAATGACTGCAAAGA
GTTTCGTGGAATTATCTGAATCATCGAAAATCAAATTGCTAATGTTCAAA
ACCTCAGATGTGACATTCGTTAACGATTTCAAGCTATATCTAATGCCGTA
TTTAAGAAATATTGGAAAGAAGGATTTTAAGAAACGCCAAGATTTACTTC
ATGAGTTTTTGGTGGAAATCGCTAAAACTGATTTGACATGCTGCTTGAAG
TTATTGGAAAAGTGTTCGCCAGAGCTGCCAGAACCACTGCTTCCTGATAT
GGCGGAGATAATGAAGATTGGGATTGATTGCGTTTACGCGTGCAAGAGAA
CGGATCAATTGAATCATTGTTTCAGCATTGTCGAATGTTTGCCTTCGAGA
GAAGAGGGAGTCATTAGCCGTCCCGTGGAAGAGCTTCACATACAACTGGA
TCAATTGGAACATTTGCTGACAGGAGCGGAAATTTTACAGTATTACAACA
ACCCTCAGACCATCTCTTACATTTCTGAAATTAAAGATGACTCTACTATT
TGTAAACAACTCATTCAGCAATTGGTGAAAAACGCTGTTTGTAAAGGACG
TTGTGTTCCAAAGGAATTGAACAAATTACTCGGACATTTGATCAAGCTTT
CCAAAGAAGTTTTCCGGTGCTGTGATATCAAGATCGTTCACCAGATTTTC
GTTGAAGAATTACTACGGTCCGGTTCACGTGAGAACATAACAGTAGCTGA
AGAGTTGATCACGCCTTCCAAACTTGCCGGGAATTCACCTCAAAGTAAGA
AACCAGAACAACATTTGACGTCTGCACTCTACCTCCTCAAATATGATGTT
TCGGTTACCGTTGTGTTGGAAGCGAGTCGTGAATATTTCAATGCAGCAAT
GTCGGGTAATGACTCTTCAATGGAACTGGCTAGATTGTGTCTAACATTGG
TCAAAGATTGTCCAGAGAGTGTTCAAGATGAATTGGATTTGATCAACTCG
TTGGGTTTATTGTATGAATTCAATGTATCCATGCTACCCTTACAAGTTCG
CCTTTGCGCTGATAAATTGGAAATTATCGATCTTTGTTTGAAGGAGAAGA
AGAATGGGTACAAGAAAAAAGACAAGCTCATCCAATTGAGTAATCTTTTG
CAAATCTGTGGCCATGACAACAAAGAACGGATTGGACAAGTCAATATTAA
AATTGCTGAATCAGCATTTGAACATAAAGATTACACATACGCTGGTATCG
TTTGTGTACAATTGGTGGATGATAATTATTCTAATGCTTGGTATATTTGC
AGGAAACTTGGTGAATGTGCTAAATATACCAACTTCACAATCAGGCAAAA
GTTGTTGAGTTTTGCGTTAACTTATTGTCCAGTACATCACATTGAAGAAG
TTTTACAAGAGAAAACTCAACTGGAAACCCAGGTTTTGTACGAGAGGTTG
GGTGTATTTACGAAAGAAGGCAAGAAAGACAAAATTGTGACCTCATCTAA
GAAAGAAACTGAGGAAGAAAACGACGAAGACAATGTTGATGGGAATAACA
TATCAATCCTCAACAAGACCAAAACTACAACAAAGAAATTGATTTCAAGC
GTCGCCAGCGTGGCTGATAACCGCTGGGTTGGATCCGCAATGAATTGGGT
CAAACCGTCGTCGGAAGGGTCTGGTAACGAAGTTGATGTTGTTGAGCGGG
AAATTGAAAGCGTTCGGCATAACCCATTTTATAGTTCGCTGGATTCGAAA
AAGATTGACGAAGATGTTCAAAGATTTAATTATAACGAGTTCAGCGACCA
TTTGAGGTGCGTCACAACCGAAGAAAAAGTATTCAATCAGCTGGTGTTAA
GAAGTCAAAAATTGAACGAGCAAAGAACCCTGGGTAAAGAGCTCGAAAAC
ACTGACCAAGCAATGCTATCGTTGAGTGATATAGCTTATACTGAAGAAAG
TTGTTTGTGTCTGGCTTACATGATGGCTATTTCTCAGCCAAAAGAAATCC
ATTCCCTATCGACCAAGCATCGGAAAAACACTTTCACTTTCCTTTTCACT
GCTTATTACTATGCATTACAAGAATAtgttaaaaacaacaaaatcgAATT
CGATAAACAAGCACAGATTTACAGCGCGCCTCCGATTGATGTGATTACAT
GGATGCTAAAAGTGTTAGGTAAGAAGCAAGgagaaaaggaagaaaaagaa
aaaggagagACTTACTTTCTGTCTAACATGAACAAGTTGCAAGACTTGAT
GCAAGCAAAGATGCTACAAGCTCTTGACAAAGgaGTGGACATCGAAAGAT
TTTCAGTTGATAATGAATATAAACGTGAAACTATACTCGGATTAGCTATG
AGTGTCGAAGACGAGTTGATTAACACAAGTTTGCTGCTAGCAGAGAAATA
TGATATCCCCGCATGGGAAGTGTTGTTATCACACGTGGAATTTTTATTCA
CTGATAGTGGTCTAAAAGCCAAAGCTATCCGCGAATCACTAAACAAATGG
AAAGTTGATTCCCATTTGAAACCGAACGGTGATAAAGTCTTTGAGCGGAT
GAAGAAATATGTTTACCCAGAAATCAATGGTAAAGACCACAATGCATTGC
TGTTGTTCTACGTTTTCCTAATGAATTGCAGCTCGCCCACTAAAATATTG
GAGGGTACGCTTACATTAGATGCTCATTCcaaacttttgaagaaaatcaa
GGCTGCTGCATCATCCATCAATTACAAACTTCTCGTGCATGGAGATTCAC
CTTTGGAGGTGATTAGAGACTGTGTTGATGATAACAATGTACATTTGTTG
GCTAAAATTGCATCCAAAATCCCCCAGGCGGATGGTAGTTACCTGTCATC
AAACAAGATCTTCTTAGCAAACGCCATTCGGatgttttggaagaaaaaag
aGAACAAGGATTGGTTGAATACATTCGAAAACTGTAAACAACACTTCACC
AAACTCCTGATAGAAGACGTTGTCACTTTTGCTGACCATGCAATTTTTGG
CGAGGAAGCTTTAGACTCGCTGACCCAAGACACCAGACTGGAGATTGGTA
AAAGAGtaataaaatatttgagacaacaACGTGGTCAAGACGAGACCAAA
CAAAGAGGAGCTGACGATTATGATTCGCTTATGGAGCGCTACGATTCATC
TATCAATGATTTGGAACTTTCCATCGAACATCTCAAAACGCTGACTGATC
CAATTTTCAAAGCAGTCTTTGGTGACGATAACGAACTGAGCAAAACCTTT
GGACGAGTATACGACTTATCACGTGGTCGAAAACAACCACTCGAAAAACT
ATTCCGTGATTTGTTCATATCGNTACAACCATTAGACAAAATTTCGAAAC
TGCGGAGTCTTTGTCGCAATGCATCTATTGACGTCCGCACGTGTTTCCAA
GATGCTTTGCGCGGGATCCTGAGTGACATCCAAAGCGATAGAGATTACAC
AAAACTACAGACTTTAACGGAGAACATCAAAGCGCATCAAGAACATCAAA
CAGACCCTCTTGTTACCCATAGCGACGTCTTAGATGTGGTGCGGCCATTT
TGTTCTGATGTTACAGCTAGCACGGATGTGAAGAGTCACGTGTTACATNT
TTTGTTCTGAatggaaGAAAATGAGCAAATATTGTATGATTTGATTGTTC
ACGAAGAATGGAAACAAGAACCACAGTTGTTGGACCAAGTTGAAAGTTAT
TTTTGGCAATATCGTGGTTCACTTCTAAAGAAGCTATGGAAAGTTTCACA
AAGTTCTGCAATTTATATGTGGGACAACTTGAAGACACAATTCAGATATC
AAGCTACCTTTGGTTGCCCACCATTGAATTTTATCAATCTGATGAACAAT
TGCTTGCCATGGCTTATGGCTTTGTCACCGGATGGAAATTTTATTGCCAT
CCTTCAAGATTCTGTTATTGAAATAAGGACTGCTGGAAATTTTGAGCAAG
TCATTACAAAATATAAGATTGAAAAAGATATGTTTCCAAGATGGCGTAAA
TTGATTTGGAATCATGACAACACCTTACTTTGTTATTCAAACAGTTTTGG
AGATTTGACCATTTTGGATATTACCGGCactaaaaaacattttattccaT
CATCAAATAATGTCAAGTTAAAAGTGCCTGGAACGCTGAGTTTGGCATTG
TGTCATGTTGAATTTGTAGCCAAAGGAAATagCTTCTTGTTATATACCTG
CACCTATCAAGGATTTTTTACAGTTTATGAAGTGAATGAATCCTCCTGCA
CAATAAAATGGGACTACTCTTTCATAACATTCCATCCATATGGATTAGCT
GGTTTGGTTATTGATCATAAAAATGGGTTATTGGTTGCAGCTGGGAATTA
TGGGAAGGAACCATTTCCTAATGTCATGGGAGATGCATGTTATGGATCAT
ATTCTGGTATCAGTCTCTGGAGATTTTTGAATGACACACCTCATCTAACT
CTGGTTGAAGACCAGGGAAAAGCTTTGAAGAAGGTATCCAGAGGTGAATG
GTTAAAGAGTGTTGTTTTAAGACGTGGCGATGAAAAAAACGAAATGTTGA
AGCATGGTATTTACAAGTTGAAATTGTCAGAAGATGGTACACAAATTGTC
ACACTGCATCTTGATGGTCGCATATCTTTTTGGAGTATCCCGTCAATGAG
GCTAATCAAAACTTGGAGTAAATCTGAACAACCTGATGCAAGTGGCGGCT
CAAGTGAAGGGTTCTCCTTTGACTCGCAGAAAAAAGAAGaTCTCACCAAA
ACAAGGAATTCAATAGATGTCAGCTGGTGGTCTGAAAAGGAGATTGCTTT
GGCATCTGGGAGGGGTGATGTAACGATTGCTTCGACTGACAGCTTGAAGA
ATTTACTTGGAGAGTCGAGTGAGAAATTTGATCCATGGCCGTCACTCAGC
CAAGTGGTGGATGGAAGCATTCTTGTGCTCGAGTGTGAGAAACGAGTGAA
CGATCCAAACAACAAAACGAAGACATCTTGGAAATGGACTTCAGAAGAAG
ATGAAAGCCAAGATGAAGTGAACTCGATTCGTTATCGATTCAAAGAACTC
ACTAAACAGATGTTATATTTCATCACTGAGGCTGAAAGGTTTTTACCAGC
TGTCAAGCCTCCAAGAATTTTAACCAACGTTTATCGTTTACTATGCTTGA
AATCTACAACACCCGAAGAATTATACACGCGGAAAATCAATCTTGAACAT
TACGGAGAGGCCTTGGACCTAGCTAAACGTTTTGGTTTGAATACTGATTT
AGTTTATCAGCGACAGTGGAAAAAGAAAAGAGTTTCGAAGATTACCATTC
ATGATTATCtgtcCAAGATTAAAGATCGATATTGGGTTTTGGACGAGTGC
CTTTTACGAGTTGCCGATGACTTTGACTCGACAGAAGAGTTACTGAAATA
CGGTTTACTCGGTACAAGTTGGGAAATCTTGCAAAGGATTGATGAAGAGG
GTAAAGGTGatgcaaaggatgatgggaAGTTATTACCTTTTAAATTTGAC
GCCGCCCCACATGACGAGGATGACGAAAACTCAAGTAGAGAATTCCAAgg
gagTCTAACGAAGAAGCAATTGAAAATCTGCCAATATCGACGGCAATTAT
TACATTATCTTGATCGGCTTTCCACTTATGAGGTTGTTTTGGGAGGCTCA
TTCAAAGCACGAGATAAATTCTCAAAAGAGTATTTTACCAAATTTCGATC
GTGCAATATGGTACACCAAGCGGTCGAGTGTGCCCGCGACGAGGACGCTT
ATACTCTGGAGCATTTGTTTTCGTACCATGGGAAGCAGTTACTACCTTAT
TGGCTGCCGATATTATCAAACTTCCCGGAAACAACCGATATCCGATATTT
TGAGCCGGTCATCCCTGAGATTGGAGAGCCACCAGAAGATCCAGAGATTT
TACCTTGGTTAGAGAAACACCATCGTGAAGAGGATTGGGTCGAGCAATCG
AATATTGTCCAACAAATCAAGTCTAATGAAGAAGGTGACGCAAACGAAGA
TATAGGCTCATTCATTTTCGAATCCGATCCAGAGATacgaaaattttaca
aatgtGAAACAAAAGCTCAACTGAGAGAATGGTTTTTACATCGTGTACAC
TTGATTGATGAATATTCCGGTCAGATTGATAAATGTTGCGAGCTGTTAGA
TGTGGGAATCAAAAGAGGCTTGGAAGGGCTCACTAAGGTTCACCAAGAAA
TGGAAGCATGGAGACTCTTAGTTTACGACGTTGGAATTGACAGTAAAATG
ACTGCAAAGAGTTTCGTGGAATTATCTGAATCATCGAAAATCAAATTGCT
AATGTTCAAAACCTCAGATGTGACATTCGTTAACGATTTCAAGCTATATC
TAATGCCGTATTTAAGAAATATTGGAAAGAAGGATTTTAAGAAACGCCAA
GATTTACTTCATGAGTTTTTGGTGGAAATCGCTAAAACTGATTTGACATG
CTGCTTGAAGTTATTGGAAAAGTGTTCGCCAGAGCTGCCAGAACCACTGC
TTCCTGATATGGCGGAGATAATGAAGATTGGGATTGATTGCGTTTACGCG
TGCAAGAGAACGGATCAATTGAATCATTGTTTCAGCATTGTCGAATGTTT
GCCTTCGAGAGAAGAGGGAGTCATTAGCCGTCCCGTGGAAGAGCTTCACA
TACAACTGGATCAATTGGAACATTTGCTGACAGGAGCGGAAATTTTACAG
TATTACAACAACCCTCAGACCATCTCTTACATTTCTGAAATTAAAGATGA
CTCTACTATTTGTAAACAACTCATTCAGCAATTGGTGAAAAACGCTGTTT
GTAAAGGACGTTGTGTTCCAAAGGAATTGAACAAATTACTCGGACATTTG
ATCAAGCTTTCCAAAGAAGTTTTCCGGTGCTGTGATATCAAGATCGTTCA
CCAGATTTTCGTTGAAGAATTACTACGGTCCGGTTCACGTGAGAACATAA
CAGTAGCTGAAGAGTTGATCACGCCTTCCAAACTTGCCGGGAATTCACCT
CAAAGTAAGAAACCAGAACAACATTTGACGTCTGCACTCTACCTCCTCAA
ATATGATGTTTCGGTTACCGTTGTGTTGGAAGCGAGTCGTGAATATTTCA
ATGCAGCAATGTCGGGTAATGACTCTTCAATGGAACTGGCTAGATTGTGT
CTAACATTGGTCAAAGATTGTCCAGAGAGTGTTCAAGATGAATTGGATTT
GATCAACTCGTTGGGTTTATTGTATGAATTCAATGTATCCATGCTACCCT
TACAAGTTCGCCTTTGCGCTGATAAATTGGAAATTATCGATCTTTGTTTG
AAGGAGAAGAAGAATGGGTACAAGAAAAAAGACAAGCTCATCCAATTGAG
TAATCTTTTGCAAATCTGTGGCCATGACAACAAAGAACGGATTGGACAAG
TCAATATTAAAATTGCTGAATCAGCATTTGAACATAAAGATTACACATAC
GCTGGTATCGTTTGTGTACAATTGGTGGATGATAATTATTCTAATGCTTG
GTATATTTGCAGGAAACTTGGTGAATGTGCTAAATATACCAACTTCACAA
TCAGGCAAAAGTTGTTGAGTTTTGCGTTAACTTATTGTCCAGTACATCAC
ATTGAAGAAGTTTTACAAGAGAAAACTCAACTGGAAACCCAGGTTTTGTA
CGAGAGGTTGGGTGTATTTACGAAAGAAGGCAAGAAAGACAAAATTGTGA
CCTCATCTAAGAAAGAAACTGAGGAAGAAAACGACGAAGACAATGTTGAT
GGGAATAACATATCAATCCTCAACAAGACCAAAACTACAACAAAGAAATT
GATTTCAAGCGTCGCCAGCGTGGCTGATAACCGCTGGGTTGGATCCGCAA
TGAATTGGGTCAAACCGTCGTCGGAAGGGTCTGGTAACGAAGTTGATGTT
GTTGAGCGGGAAATTGAAAGCGTTCGGCATAACCCATTTTATAGTTCGCT
GGATTCGAAAAAGATTGACGAAGATGTTCAAAGATTTAATTATAACGAGT
TCAGCGACCATTTGAGGTGCGTCACAACCGAAGAAAAAGTATTCAATCAG
CTGGTGTTAAGAAGTCAAAAATTGAACGAGCAAAGAACCCTGGGTAAAGA
GCTCGAAAACACTGACCAAGCAATGCTATCGTTGAGTGATATAGCTTATA
CTGAAGAAAGTTGTTTGTGTCTGGCTTACATGATGGCTATTTCTCAGCCA
AAAGAAATCCATTCCCTATCGACCAAGCATCGGAAAAACACTTTCACTTT
CCTTTTCACTGCTTATTACTATGCATTACAAGAATAtgttaaaaacaaca
aaatcgAATTCGATAAACAAGCACAGATTTACAGCGCGCCTCCGATTGAT
GTGATTACATGGATGCTAAAAGTGTTAGGTAAGAAGCAAGgagaaaagga
agaaaaagaaaaaggagagACTTACTTTCTGTCTAACATGAACAAGTTGC
AAGACTTGATGCAAGCAAAGATGCTACAAGCTCTTGACAAAGgaGTGGAC
ATCGAAAGATTTTCAGTTGATAATGAATATAAACGTGAAACTATACTCGG
ATTAGCTATGAGTGTCGAAGACGAGTTGATTAACACAAGTTTGCTGCTAG
CAGAGAAATATGATATCCCCGCATGGGAAGTGTTGTTATCACACGTGGAA
TTTTTATTCACTGATAGTGGTCTAAAAGCCAAAGCTATCCGCGAATCACT
AAACAAATGGAAAGTTGATTCCCATTTGAAACCGAACGGTGATAAAGTCT
TTGAGCGGATGAAGAAATATGTTTACCCAGAAATCAATGGTAAAGACCAC
AATGCATTGCTGTTGTTCTACGTTTTCCTAATGAATTGCAGCTCGCCCAC
TAAAATATTGGAGGGTACGCTTACATTAGATGCTCATTCcaaacttttga
agaaaatcaaGGCTGCTGCATCATCCATCAATTACAAACTTCTCGTGCAT
GGAGATTCACCTTTGGAGGTGATTAGAGACTGTGTTGATGATAACAATGT
ACATTTGTTGGCTAAAATTGCATCCAAAATCCCCCAGGCGGATGGTAGTT
ACCTGTCATCAAACAAGATCTTCTTAGCAAACGCCATTCGGatgttttgg
aagaaaaaagaGAACAAGGATTGGTTGAATACATTCGAAAACTGTAAACA
ACACTTCACCAAACTCCTGATAGAAGACGTTGTCACTTTTGCTGACCATG
CAATTTTTGGCGAGGAAGCTTTAGACTCGCTGACCCAAGACACCAGACTG
GAGATTGGTAAAAGAGtaataaaatatttgagacaacaACGTGGTCAAGA
CGAGACCAAACAAAGAGGAGCTGACGATTATGATTCGCTTATGGAGCGCT
ACGATTCATCTATCAATGATTTGGAACTTTCCATCGAACATCTCAAAACG
CTGACTGATCCAATTTTCAAAGCAGTCTTTGGTGACGATAACGAACTGAG
CAAAACCTTTGGACGAGTATACGACTTATCACGTGGTCGAAAACAACCAC
TCGAAAAACTATTCCGTGATTTGTTCATATCGNTACAACCATTAGACAAA
ATTTCGAAACTGCGGAGTCTTTGTCGCAATGCATCTATTGACGTCCGCAC
GTGTTTCCAAGATGCTTTGCGCGGGATCCTGAGTGACATCCAAAGCGATA
GAGATTACACAAAACTACAGACTTTAACGGAGAACATCAAAGCGCATCAA
GAACATCAAACAGACCCTCTTGTTACCCATAGCGACGTCTTAGATGTGGT
GCGGCCATTTTGTTCTGATGTTACAGCTAGCACGGATGTGAAGAGTCACG
TGTTACATNTTTTGTTCTGAatggaaGAAAATGAGCAAATATTGTATGAT
TTGATTGTTCACGAAGAATGGAAACAAGAACCACAGTTGTTGGACCAAGT
TGAAAGTTATTTTTGGCAATATCGTGGTTCACTTCTAAAGAAGCTATGGA
AAGTTTCACAAAGTTCTGCAATTTATATGTGGGACAACTTGAAGACACAA
TTCAGATATCAAGCTACCTTTGGTTGCCCACCATTGAATTTTATCAATCT
GATGAACAATTGCTTGCCATGGCTTATGGCTTTGTCACCGGATGGAAATT
TTATTGCCATCCTTCAAGATTCTGTTATTGAAATAAGGACTGCTGGAAAT
TTTGAGCAAGTCATTACAAAATATAAGATTGAAAAAGATATGTTTCCAAG
ATGGCGTAAATTGATTTGGAATCATGACAACACCTTACTTTGTTATTCAA
ACAGTTTTGGAGATTTGACCATTTTGGATATTACCGGCactaaaaaacat
tttattccaTCATCAAATAATGTCAAGTTAAAAGTGCCTGGAACGCTGAG
TTTGGCATTGTGTCATGTTGAATTTGTAGCCAAAGGAAATagCTTCTTGT
TATATACCTGCACCTATCAAGGATTTTTTACAGTTTATGAAGTGAATGAA
TCCTCCTGCACAATAAAATGGGACTACTCTTTCATAACATTCCATCCATA
TGGATTAGCTGGTTTGGTTATTGATCATAAAAATGGGTTATTGGTTGCAG
CTGGGAATTATGGGAAGGAACCATTTCCTAATGTCATGGGAGATGCATGT
TATGGATCATATTCTGGTATCAGTCTCTGGAGATTTTTGAATGACACACC
TCATCTAACTCTGGTTGAAGACCAGGGAAAAGCTTTGAAGAAGGTATCCA
GAGGTGAATGGTTAAAGAGTGTTGTTTTAAGACGTGGCGATGAAAAAAAC
GAAATGTTGAAGCATGGTATTTACAAGTTGAAATTGTCAGAAGATGGTAC
ACAAATTGTCACACTGCATCTTGATGGTCGCATATCTTTTTGGAGTATCC
CGTCAATGAGGCTAATCAAAACTTGGAGTAAATCTGAACAACCTGATGCA
AGTGGCGGCTCAAGTGAAGGGTTCTCCTTTGACTCGCAGAAAAAAGAAGa
TCTCACCAAAACAAGGAATTCAATAGATGTCAGCTGGTGGTCTGAAAAGG
AGATTGCTTTGGCATCTGGGAGGGGTGATGTAACGATTGCTTCGACTGAC
AGCTTGAAGAATTTACTTGGAGAGTCGAGTGAGAAATTTGATCCATGGCC
GTCACTCAGCCAAGTGGTGGATGGAAGCATTCTTGTGCTCGAGTGTGAGA
AACGAGTGAACGATCCAAACAACAAAACGAAGACATCTTGGAAATGGACT
TCAGAAGAAGATGAAAGCCAAGATGAAGTGAACTCGATTCGTTATCGATT
CAAAGAACTCACTAAACAGATGTTATATTTCATCACTGAGGCTGAAAGGT
TTTTACCAGCTGTCAAGCCTCCAAGAATTTTAACCAACGTTTATCGTTTA
CTATGCTTGAAATCTACAACACCCGAAGAATTATACACGCGGAAAATCAA
TCTTGAACATTACGGAGAGGCCTTGGACCTAGCTAAACGTTTTGGTTTGA
ATACTGATTTAGTTTATCAGCGACAGTGGAAAAAGAAAAGAGTTTCGAAG
ATTACCATTCATGATTATCtgtcCAAGATTAAAGATCGATATTGGGTTTT
GGACGAGTGCCTTTTACGAGTTGCCGATGACTTTGACTCGACAGAAGAGT
TACTGAAATACGGTTTACTCGGTACAAGTTGGGAAATCTTGCAAAGGATT
GATGAAGAGGGTAAAGGTGatgcaaaggatgatgggaAGTTATTACCTTT
TAAATTTGACGCCGCCCCACATGACGAGGATGACGAAAACTCAAGTAGAG
AATTCCAAgggagTCTAACGAAGAAGCAATTGAAAATCTGCCAATATCGA
CGGCAATTATTACATTATCTTGATCGGCTTTCCACTTATGAGGTTGTTTT
GGGAGGCTCATTCAAAGCACGAGATAAATTCTCAAAAGAGTATTTTACCA
AATTTCGATCGTGCAATATGGTACACCAAGCGGTCGAGTGTGCCCGCGAC
GAGGACGCTTATACTCTGGAGCATTTGTTTTCGTACCATGGGAAGCAGTT
ACTACCTTATTGGCTGCCGATATTATCAAACTTCCCGGAAACAACCGATA
TCCGATATTTTGAGCCGGTCATCCCTGAGATTGGAGAGCCACCAGAAGAT
CCAGAGATTTTACCTTGGTTAGAGAAACACCATCGTGAAGAGGATTGGGT
CGAGCAATCGAATATTGTCCAACAAATCAAGTCTAATGAAGAAGGTGACG
CAAACGAAGATATAGGCTCATTCATTTTCGAATCCGATCCAGAGATacga
aaattttacaaatgtGAAACAAAAGCTCAACTGAGAGAATGGTTTTTACA
TCGTGTACACTTGATTGATGAATATTCCGGTCAGATTGATAAATGTTGCG
AGCTGTTAGATGTGGGAATCAAAAGAGGCTTGGAAGGGCTCACTAAGGTT
CACCAAGAAATGGAAGCATGGAGACTCTTAGTTTACGACGTTGGAATTGA
CAGTAAAATGACTGCAAAGAGTTTCGTGGAATTATCTGAATCATCGAAAA
TCAAATTGCTAATGTTCAAAACCTCAGATGTGACATTCGTTAACGATTTC
AAGCTATATCTAATGCCGTATTTAAGAAATATTGGAAAGAAGGATTTTAA
GAAACGCCAAGATTTACTTCATGAGTTTTTGGTGGAAATCGCTAAAACTG
ATTTGACATGCTGCTTGAAGTTATTGGAAAAGTGTTCGCCAGAGCTGCCA
GAACCACTGCTTCCTGATATGGCGGAGATAATGAAGATTGGGATTGATTG
CGTTTACGCGTGCAAGAGAACGGATCAATTGAATCATTGTTTCAGCATTG
TCGAATGTTTGCCTTCGAGAGAAGAGGGAGTCATTAGCCGTCCCGTGGAA
GAGCTTCACATACAACTGGATCAATTGGAACATTTGCTGACAGGAGCGGA
AATTTTACAGTATTACAACAACCCTCAGACCATCTCTTACATTTCTGAAA
TTAAAGATGACTCTACTATTTGTAAACAACTCATTCAGCAATTGGTGAAA
AACGCTGTTTGTAAAGGACGTTGTGTTCCAAAGGAATTGAACAAATTACT
CGGACATTTGATCAAGCTTTCCAAAGAAGTTTTCCGGTGCTGTGATATCA
AGATCGTTCACCAGATTTTCGTTGAAGAATTACTACGGTCCGGTTCACGT
GAGAACATAACAGTAGCTGAAGAGTTGATCACGCCTTCCAAACTTGCCGG
GAATTCACCTCAAAGTAAGAAACCAGAACAACATTTGACGTCTGCACTCT
ACCTCCTCAAATATGATGTTTCGGTTACCGTTGTGTTGGAAGCGAGTCGT
GAATATTTCAATGCAGCAATGTCGGGTAATGACTCTTCAATGGAACTGGC
TAGATTGTGTCTAACATTGGTCAAAGATTGTCCAGAGAGTGTTCAAGATG
AATTGGATTTGATCAACTCGTTGGGTTTATTGTATGAATTCAATGTATCC
ATGCTACCCTTACAAGTTCGCCTTTGCGCTGATAAATTGGAAATTATCGA
TCTTTGTTTGAAGGAGAAGAAGAATGGGTACAAGAAAAAAGACAAGCTCA
TCCAATTGAGTAATCTTTTGCAAATCTGTGGCCATGACAACAAAGAACGG
ATTGGACAAGTCAATATTAAAATTGCTGAATCAGCATTTGAACATAAAGA
TTACACATACGCTGGTATCGTTTGTGTACAATTGGTGGATGATAATTATT
CTAATGCTTGGTATATTTGCAGGAAACTTGGTGAATGTGCTAAATATACC
AACTTCACAATCAGGCAAAAGTTGTTGAGTTTTGCGTTAACTTATTGTCC
AGTACATCACATTGAAGAAGTTTTACAAGAGAAAACTCAACTGGAAACCC
AGGTTTTGTACGAGAGGTTGGGTGTATTTACGAAAGAAGGCAAGAAAGAC
AAAATTGTGACCTCATCTAAGAAAGAAACTGAGGAAGAAAACGACGAAGA
CAATGTTGATGGGAATAACATATCAATCCTCAACAAGACCAAAACTACAA
CAAAGAAATTGATTTCAAGCGTCGCCAGCGTGGCTGATAACCGCTGGGTT
GGATCCGCAATGAATTGGGTCAAACCGTCGTCGGAAGGGTCTGGTAACGA
AGTTGATGTTGTTGAGCGGGAAATTGAAAGCGTTCGGCATAACCCATTTT
ATAGTTCGCTGGATTCGAAAAAGATTGACGAAGATGTTCAAAGATTTAAT
TATAACGAGTTCAGCGACCATTTGAGGTGCGTCACAACCGAAGAAAAAGT
ATTCAATCAGCTGGTGTTAAGAAGTCAAAAATTGAACGAGCAAAGAACCC
TGGGTAAAGAGCTCGAAAACACTGACCAAGCAATGCTATCGTTGAGTGAT
ATAGCTTATACTGAAGAAAGTTGTTTGTGTCTGGCTTACATGATGGCTAT
TTCTCAGCCAAAAGAAATCCATTCCCTATCGACCAAGCATCGGAAAAACA
CTTTCACTTTCCTTTTCACTGCTTATTACTATGCATTACAAGAATAtgtt
aaaaacaacaaaatcgAATTCGATAAACAAGCACAGATTTACAGCGCGCC
TCCGATTGATGTGATTACATGGATGCTAAAAGTGTTAGGTAAGAAGCAAG
gagaaaaggaagaaaaagaaaaaggagagACTTACTTTCTGTCTAACATG
AACAAGTTGCAAGACTTGATGCAAGCAAAGATGCTACAAGCTCTTGACAA
AGgaGTGGACATCGAAAGATTTTCAGTTGATAATGAATATAAACGTGAAA
CTATACTCGGATTAGCTATGAGTGTCGAAGACGAGTTGATTAACACAAGT
TTGCTGCTAGCAGAGAAATATGATATCCCCGCATGGGAAGTGTTGTTATC
ACACGTGGAATTTTTATTCACTGATAGTGGTCTAAAAGCCAAAGCTATCC
GCGAATCACTAAACAAATGGAAAGTTGATTCCCATTTGAAACCGAACGGT
GATAAAGTCTTTGAGCGGATGAAGAAATATGTTTACCCAGAAATCAATGG
TAAAGACCACAATGCATTGCTGTTGTTCTACGTTTTCCTAATGAATTGCA
GCTCGCCCACTAAAATATTGGAGGGTACGCTTACATTAGATGCTCATTCc
aaacttttgaagaaaatcaaGGCTGCTGCATCATCCATCAATTACAAACT
TCTCGTGCATGGAGATTCACCTTTGGAGGTGATTAGAGACTGTGTTGATG
ATAACAATGTACATTTGTTGGCTAAAATTGCATCCAAAATCCCCCAGGCG
GATGGTAGTTACCTGTCATCAAACAAGATCTTCTTAGCAAACGCCATTCG
GatgttttggaagaaaaaagaGAACAAGGATTGGTTGAATACATTCGAAA
ACTGTAAACAACACTTCACCAAACTCCTGATAGAAGACGTTGTCACTTTT
GCTGACCATGCAATTTTTGGCGAGGAAGCTTTAGACTCGCTGACCCAAGA
CACCAGACTGGAGATTGGTAAAAGAGtaataaaatatttgagacaacaAC
GTGGTCAAGACGAGACCAAACAAAGAGGAGCTGACGATTATGATTCGCTT
ATGGAGCGCTACGATTCATCTATCAATGATTTGGAACTTTCCATCGAACA
TCTCAAAACGCTGACTGATCCAATTTTCAAAGCAGTCTTTGGTGACGATA
ACGAACTGAGCAAAACCTTTGGACGAGTATACGACTTATCACGTGGTCGA
AAACAACCACTCGAAAAACTATTCCGTGATTTGTTCATATCGNTACAACC
ATTAGACAAAATTTCGAAACTGCGGAGTCTTTGTCGCAATGCATCTATTG
ACGTCCGCACGTGTTTCCAAGATGCTTTGCGCGGGATCCTGAGTGACATC
CAAAGCGATAGAGATTACACAAAACTACAGACTTTAACGGAGAACATCAA
AGCGCATCAAGAACATCAAACAGACCCTCTTGTTACCCATAGCGACGTCT
TAGATGTGGTGCGGCCATTTTGTTCTGATGTTACAGCTAGCACGGATGTG
AAGAGTCACGTGTTACATNTTTTGTTCTGAatggaaGAAAATGAGCAAAT
ATTGTATGATTTGATTGTTCACGAAGAATGGAAACAAGAACCACAGTTGT
TGGACCAAGTTGAAAGTTATTTTTGGCAATATCGTGGTTCACTTCTAAAG
AAGCTATGGAAAGTTTCACAAAGTTCTGCAATTTATATGTGGGACAACTT
GAAGACACAATTCAGATATCAAGCTACCTTTGGTTGCCCACCATTGAATT
TTATCAATCTGATGAACAATTGCTTGCCATGGCTTATGGCTTTGTCACCG
GATGGAAATTTTATTGCCATCCTTCAAGATTCTGTTATTGAAATAAGGAC
TGCTGGAAATTTTGAGCAAGTCATTACAAAATATAAGATTGAAAAAGATA
TGTTTCCAAGATGGCGTAAATTGATTTGGAATCATGACAACACCTTACTT
TGTTATTCAAACAGTTTTGGAGATTTGACCATTTTGGATATTACCGGCac
taaaaaacattttattccaTCATCAAATAATGTCAAGTTAAAAGTGCCTG
GAACGCTGAGTTTGGCATTGTGTCATGTTGAATTTGTAGCCAAAGGAAAT
agCTTCTTGTTATATACCTGCACCTATCAAGGATTTTTTACAGTTTATGA
AGTGAATGAATCCTCCTGCACAATAAAATGGGACTACTCTTTCATAACAT
TCCATCCATATGGATTAGCTGGTTTGGTTATTGATCATAAAAATGGGTTA
TTGGTTGCAGCTGGGAATTATGGGAAGGAACCATTTCCTAATGTCATGGG
AGATGCATGTTATGGATCATATTCTGGTATCAGTCTCTGGAGATTTTTGA
ATGACACACCTCATCTAACTCTGGTTGAAGACCAGGGAAAAGCTTTGAAG
AAGGTATCCAGAGGTGAATGGTTAAAGAGTGTTGTTTTAAGACGTGGCGA
TGAAAAAAACGAAATGTTGAAGCATGGTATTTACAAGTTGAAATTGTCAG
AAGATGGTACACAAATTGTCACACTGCATCTTGATGGTCGCATATCTTTT
TGGAGTATCCCGTCAATGAGGCTAATCAAAACTTGGAGTAAATCTGAACA
ACCTGATGCAAGTGGCGGCTCAAGTGAAGGGTTCTCCTTTGACTCGCAGA
AAAAAGAAGaTCTCACCAAAACAAGGAATTCAATAGATGTCAGCTGGTGG
TCTGAAAAGGAGATTGCTTTGGCATCTGGGAGGGGTGATGTAACGATTGC
TTCGACTGACAGCTTGAAGAATTTACTTGGAGAGTCGAGTGAGAAATTTG
ATCCATGGCCGTCACTCAGCCAAGTGGTGGATGGAAGCATTCTTGTGCTC
GAGTGTGAGAAACGAGTGAACGATCCAAACAACAAAACGAAGACATCTTG
GAAATGGACTTCAGAAGAAGATGAAAGCCAAGATGAAGTGAACTCGATTC
GTTATCGATTCAAAGAACTCACTAAACAGATGTTATATTTCATCACTGAG
GCTGAAAGGTTTTTACCAGCTGTCAAGCCTCCAAGAATTTTAACCAACGT
TTATCGTTTACTATGCTTGAAATCTACAACACCCGAAGAATTATACACGC
GGAAAATCAATCTTGAACATTACGGAGAGGCCTTGGACCTAGCTAAACGT
TTTGGTTTGAATACTGATTTAGTTTATCAGCGACAGTGGAAAAAGAAAAG
AGTTTCGAAGATTACCATTCATGATTATCtgtcCAAGATTAAAGATCGAT
ATTGGGTTTTGGACGAGTGCCTTTTACGAGTTGCCGATGACTTTGACTCG
ACAGAAGAGTTACTGAAATACGGTTTACTCGGTACAAGTTGGGAAATCTT
GCAAAGGATTGATGAAGAGGGTAAAGGTGatgcaaaggatgatgggaAGT
TATTACCTTTTAAATTTGACGCCGCCCCACATGACGAGGATGACGAAAAC
TCAAGTAGAGAATTCCAAgggagTCTAACGAAGAAGCAATTGAAAATCTG
CCAATATCGACGGCAATTATTACATTATCTTGATCGGCTTTCCACTTATG
AGGTTGTTTTGGGAGGCTCATTCAAAGCACGAGATAAATTCTCAAAAGAG
TATTTTACCAAATTTCGATCGTGCAATATGGTACACCAAGCGGTCGAGTG
TGCCCGCGACGAGGACGCTTATACTCTGGAGCATTTGTTTTCGTACCATG
GGAAGCAGTTACTACCTTATTGGCTGCCGATATTATCAAACTTCCCGGAA
ACAACCGATATCCGATATTTTGAGCCGGTCATCCCTGAGATTGGAGAGCC
ACCAGAAGATCCAGAGATTTTACCTTGGTTAGAGAAACACCATCGTGAAG
AGGATTGGGTCGAGCAATCGAATATTGTCCAACAAATCAAGTCTAATGAA
GAAGGTGACGCAAACGAAGATATAGGCTCATTCATTTTCGAATCCGATCC
AGAGATacgaaaattttacaaatgtGAAACAAAAGCTCAACTGAGAGAAT
GGTTTTTACATCGTGTACACTTGATTGATGAATATTCCGGTCAGATTGAT
AAATGTTGCGAGCTGTTAGATGTGGGAATCAAAAGAGGCTTGGAAGGGCT
CACTAAGGTTCACCAAGAAATGGAAGCATGGAGACTCTTAGTTTACGACG
TTGGAATTGACAGTAAAATGACTGCAAAGAGTTTCGTGGAATTATCTGAA
TCATCGAAAATCAAATTGCTAATGTTCAAAACCTCAGATGTGACATTCGT
TAACGATTTCAAGCTATATCTAATGCCGTATTTAAGAAATATTGGAAAGA
AGGATTTTAAGAAACGCCAAGATTTACTTCATGAGTTTTTGGTGGAAATC
GCTAAAACTGATTTGACATGCTGCTTGAAGTTATTGGAAAAGTGTTCGCC
AGAGCTGCCAGAACCACTGCTTCCTGATATGGCGGAGATAATGAAGATTG
GGATTGATTGCGTTTACGCGTGCAAGAGAACGGATCAATTGAATCATTGT
TTCAGCATTGTCGAATGTTTGCCTTCGAGAGAAGAGGGAGTCATTAGCCG
TCCCGTGGAAGAGCTTCACATACAACTGGATCAATTGGAACATTTGCTGA
CAGGAGCGGAAATTTTACAGTATTACAACAACCCTCAGACCATCTCTTAC
ATTTCTGAAATTAAAGATGACTCTACTATTTGTAAACAACTCATTCAGCA
ATTGGTGAAAAACGCTGTTTGTAAAGGACGTTGTGTTCCAAAGGAATTGA
ACAAATTACTCGGACATTTGATCAAGCTTTCCAAAGAAGTTTTCCGGTGC
TGTGATATCAAGATCGTTCACCAGATTTTCGTTGAAGAATTACTACGGTC
CGGTTCACGTGAGAACATAACAGTAGCTGAAGAGTTGATCACGCCTTCCA
AACTTGCCGGGAATTCACCTCAAAGTAAGAAACCAGAACAACATTTGACG
TCTGCACTCTACCTCCTCAAATATGATGTTTCGGTTACCGTTGTGTTGGA
AGCGAGTCGTGAATATTTCAATGCAGCAATGTCGGGTAATGACTCTTCAA
TGGAACTGGCTAGATTGTGTCTAACATTGGTCAAAGATTGTCCAGAGAGT
GTTCAAGATGAATTGGATTTGATCAACTCGTTGGGTTTATTGTATGAATT
CAATGTATCCATGCTACCCTTACAAGTTCGCCTTTGCGCTGATAAATTGG
AAATTATCGATCTTTGTTTGAAGGAGAAGAAGAATGGGTACAAGAAAAAA
GACAAGCTCATCCAATTGAGTAATCTTTTGCAAATCTGTGGCCATGACAA
CAAAGAACGGATTGGACAAGTCAATATTAAAATTGCTGAATCAGCATTTG
AACATAAAGATTACACATACGCTGGTATCGTTTGTGTACAATTGGTGGAT
GATAATTATTCTAATGCTTGGTATATTTGCAGGAAACTTGGTGAATGTGC
TAAATATACCAACTTCACAATCAGGCAAAAGTTGTTGAGTTTTGCGTTAA
CTTATTGTCCAGTACATCACATTGAAGAAGTTTTACAAGAGAAAACTCAA
CTGGAAACCCAGGTTTTGTACGAGAGGTTGGGTGTATTTACGAAAGAAGG
CAAGAAAGACAAAATTGTGACCTCATCTAAGAAAGAAACTGAGGAAGAAA
ACGACGAAGACAATGTTGATGGGAATAACATATCAATCCTCAACAAGACC
AAAACTACAACAAAGAAATTGATTTCAAGCGTCGCCAGCGTGGCTGATAA
CCGCTGGGTTGGATCCGCAATGAATTGGGTCAAACCGTCGTCGGAAGGGT
CTGGTAACGAAGTTGATGTTGTTGAGCGGGAAATTGAAAGCGTTCGGCAT
AACCCATTTTATAGTTCGCTGGATTCGAAAAAGATTGACGAAGATGTTCA
AAGATTTAATTATAACGAGTTCAGCGACCATTTGAGGTGCGTCACAACCG
AAGAAAAAGTATTCAATCAGCTGGTGTTAAGAAGTCAAAAATTGAACGAG
CAAAGAACCCTGGGTAAAGAGCTCGAAAACACTGACCAAGCAATGCTATC
GTTGAGTGATATAGCTTATACTGAAGAAAGTTGTTTGTGTCTGGCTTACA
TGATGGCTATTTCTCAGCCAAAAGAAATCCATTCCCTATCGACCAAGCAT
CGGAAAAACACTTTCACTTTCCTTTTCACTGCTTATTACTATGCATTACA
AGAATAtgttaaaaacaacaaaatcgAATTCGATAAACAAGCACAGATTT
ACAGCGCGCCTCCGATTGATGTGATTACATGGATGCTAAAAGTGTTAGGT
AAGAAGCAAGgagaaaaggaagaaaaagaaaaaggagagACTTACTTTCT
GTCTAACATGAACAAGTTGCAAGACTTGATGCAAGCAAAGATGCTACAAG
CTCTTGACAAAGgaGTGGACATCGAAAGATTTTCAGTTGATAATGAATAT
AAACGTGAAACTATACTCGGATTAGCTATGAGTGTCGAAGACGAGTTGAT
TAACACAAGTTTGCTGCTAGCAGAGAAATATGATATCCCCGCATGGGAAG
TGTTGTTATCACACGTGGAATTTTTATTCACTGATAGTGGTCTAAAAGCC
AAAGCTATCCGCGAATCACTAAACAAATGGAAAGTTGATTCCCATTTGAA
ACCGAACGGTGATAAAGTCTTTGAGCGGATGAAGAAATATGTTTACCCAG
AAATCAATGGTAAAGACCACAATGCATTGCTGTTGTTCTACGTTTTCCTA
ATGAATTGCAGCTCGCCCACTAAAATATTGGAGGGTACGCTTACATTAGA
TGCTCATTCcaaacttttgaagaaaatcaaGGCTGCTGCATCATCCATCA
ATTACAAACTTCTCGTGCATGGAGATTCACCTTTGGAGGTGATTAGAGAC
TGTGTTGATGATAACAATGTACATTTGTTGGCTAAAATTGCATCCAAAAT
CCCCCAGGCGGATGGTAGTTACCTGTCATCAAACAAGATCTTCTTAGCAA
ACGCCATTCGGatgttttggaagaaaaaagaGAACAAGGATTGGTTGAAT
ACATTCGAAAACTGTAAACAACACTTCACCAAACTCCTGATAGAAGACGT
TGTCACTTTTGCTGACCATGCAATTTTTGGCGAGGAAGCTTTAGACTCGC
TGACCCAAGACACCAGACTGGAGATTGGTAAAAGAGtaataaaatatttg
agacaacaACGTGGTCAAGACGAGACCAAACAAAGAGGAGCTGACGATTA
TGATTCGCTTATGGAGCGCTACGATTCATCTATCAATGATTTGGAACTTT
CCATCGAACATCTCAAAACGCTGACTGATCCAATTTTCAAAGCAGTCTTT
GGTGACGATAACGAACTGAGCAAAACCTTTGGACGAGTATACGACTTATC
ACGTGGTCGAAAACAACCACTCGAAAAACTATTCCGTGATTTGTTCATAT
CGNTACAACCATTAGACAAAATTTCGAAACTGCGGAGTCTTTGTCGCAAT
GCATCTATTGACGTCCGCACGTGTTTCCAAGATGCTTTGCGCGGGATCCT
GAGTGACATCCAAAGCGATAGAGATTACACAAAACTACAGACTTTAACGG
AGAACATCAAAGCGCATCAAGAACATCAAACAGACCCTCTTGTTACCCAT
AGCGACGTCTTAGATGTGGTGCGGCCATTTTGTTCTGATGTTACAGCTAG
CACGGATGTGAAGAGTCACGTGTTACATNTTTTGTTCTGAatggaaGAAA
ATGAGCAAATATTGTATGATTTGATTGTTCACGAAGAATGGAAACAAGAA
CCACAGTTGTTGGACCAAGTTGAAAGTTATTTTTGGCAATATCGTGGTTC
ACTTCTAAAGAAGCTATGGAAAGTTTCACAAAGTTCTGCAATTTATATGT
GGGACAACTTGAAGACACAATTCAGATATCAAGCTACCTTTGGTTGCCCA
CCATTGAATTTTATCAATCTGATGAACAATTGCTTGCCATGGCTTATGGC
TTTGTCACCGGATGGAAATTTTATTGCCATCCTTCAAGATTCTGTTATTG
AAATAAGGACTGCTGGAAATTTTGAGCAAGTCATTACAAAATATAAGATT
GAAAAAGATATGTTTCCAAGATGGCGTAAATTGATTTGGAATCATGACAA
CACCTTACTTTGTTATTCAAACAGTTTTGGAGATTTGACCATTTTGGATA
TTACCGGCactaaaaaacattttattccaTCATCAAATAATGTCAAGTTA
AAAGTGCCTGGAACGCTGAGTTTGGCATTGTGTCATGTTGAATTTGTAGC
CAAAGGAAATagCTTCTTGTTATATACCTGCACCTATCAAGGATTTTTTA
CAGTTTATGAAGTGAATGAATCCTCCTGCACAATAAAATGGGACTACTCT
TTCATAACATTCCATCCATATGGATTAGCTGGTTTGGTTATTGATCATAA
AAATGGGTTATTGGTTGCAGCTGGGAATTATGGGAAGGAACCATTTCCTA
ATGTCATGGGAGATGCATGTTATGGATCATATTCTGGTATCAGTCTCTGG
AGATTTTTGAATGACACACCTCATCTAACTCTGGTTGAAGACCAGGGAAA
AGCTTTGAAGAAGGTATCCAGAGGTGAATGGTTAAAGAGTGTTGTTTTAA
GACGTGGCGATGAAAAAAACGAAATGTTGAAGCATGGTATTTACAAGTTG
AAATTGTCAGAAGATGGTACACAAATTGTCACACTGCATCTTGATGGTCG
CATATCTTTTTGGAGTATCCCGTCAATGAGGCTAATCAAAACTTGGAGTA
AATCTGAACAACCTGATGCAAGTGGCGGCTCAAGTGAAGGGTTCTCCTTT
GACTCGCAGAAAAAAGAAGaTCTCACCAAAACAAGGAATTCAATAGATGT
CAGCTGGTGGTCTGAAAAGGAGATTGCTTTGGCATCTGGGAGGGGTGATG
TAACGATTGCTTCGACTGACAGCTTGAAGAATTTACTTGGAGAGTCGAGT
GAGAAATTTGATCCATGGCCGTCACTCAGCCAAGTGGTGGATGGAAGCAT
TCTTGTGCTCGAGTGTGAGAAACGAGTGAACGATCCAAACAACAAAACGA
AGACATCTTGGAAATGGACTTCAGAAGAAGATGAAAGCCAAGATGAAGTG
AACTCGATTCGTTATCGATTCAAAGAACTCACTAAACAGATGTTATATTT
CATCACTGAGGCTGAAAGGTTTTTACCAGCTGTCAAGCCTCCAAGAATTT
TAACCAACGTTTATCGTTTACTATGCTTGAAATCTACAACACCCGAAGAA
TTATACACGCGGAAAATCAATCTTGAACATTACGGAGAGGCCTTGGACCT
AGCTAAACGTTTTGGTTTGAATACTGATTTAGTTTATCAGCGACAGTGGA
AAAAGAAAAGAGTTTCGAAGATTACCATTCATGATTATCtgtcCAAGATT
AAAGATCGATATTGGGTTTTGGACGAGTGCCTTTTACGAGTTGCCGATGA
CTTTGACTCGACAGAAGAGTTACTGAAATACGGTTTACTCGGTACAAGTT
GGGAAATCTTGCAAAGGATTGATGAAGAGGGTAAAGGTGatgcaaaggat
gatgggaAGTTATTACCTTTTAAATTTGACGCCGCCCCACATGACGAGGA
TGACGAAAACTCAAGTAGAGAATTCCAAgggagTCTAACGAAGAAGCAAT
TGAAAATCTGCCAATATCGACGGCAATTATTACATTATCTTGATCGGCTT
TCCACTTATGAGGTTGTTTTGGGAGGCTCATTCAAAGCACGAGATAAATT
CTCAAAAGAGTATTTTACCAAATTTCGATCGTGCAATATGGTACACCAAG
CGGTCGAGTGTGCCCGCGACGAGGACGCTTATACTCTGGAGCATTTGTTT
TCGTACCATGGGAAGCAGTTACTACCTTATTGGCTGCCGATATTATCAAA
CTTCCCGGAAACAACCGATATCCGATATTTTGAGCCGGTCATCCCTGAGA
TTGGAGAGCCACCAGAAGATCCAGAGATTTTACCTTGGTTAGAGAAACAC
CATCGTGAAGAGGATTGGGTCGAGCAATCGAATATTGTCCAACAAATCAA
GTCTAATGAAGAAGGTGACGCAAACGAAGATATAGGCTCATTCATTTTCG
AATCCGATCCAGAGATacgaaaattttacaaatgtGAAACAAAAGCTCAA
CTGAGAGAATGGTTTTTACATCGTGTACACTTGATTGATGAATATTCCGG
TCAGATTGATAAATGTTGCGAGCTGTTAGATGTGGGAATCAAAAGAGGCT
TGGAAGGGCTCACTAAGGTTCACCAAGAAATGGAAGCATGGAGACTCTTA
GTTTACGACGTTGGAATTGACAGTAAAATGACTGCAAAGAGTTTCGTGGA
ATTATCTGAATCATCGAAAATCAAATTGCTAATGTTCAAAACCTCAGATG
TGACATTCGTTAACGATTTCAAGCTATATCTAATGCCGTATTTAAGAAAT
ATTGGAAAGAAGGATTTTAAGAAACGCCAAGATTTACTTCATGAGTTTTT
GGTGGAAATCGCTAAAACTGATTTGACATGCTGCTTGAAGTTATTGGAAA
AGTGTTCGCCAGAGCTGCCAGAACCACTGCTTCCTGATATGGCGGAGATA
ATGAAGATTGGGATTGATTGCGTTTACGCGTGCAAGAGAACGGATCAATT
GAATCATTGTTTCAGCATTGTCGAATGTTTGCCTTCGAGAGAAGAGGGAG
TCATTAGCCGTCCCGTGGAAGAGCTTCACATACAACTGGATCAATTGGAA
CATTTGCTGACAGGAGCGGAAATTTTACAGTATTACAACAACCCTCAGAC
CATCTCTTACATTTCTGAAATTAAAGATGACTCTACTATTTGTAAACAAC
TCATTCAGCAATTGGTGAAAAACGCTGTTTGTAAAGGACGTTGTGTTCCA
AAGGAATTGAACAAATTACTCGGACATTTGATCAAGCTTTCCAAAGAAGT
TTTCCGGTGCTGTGATATCAAGATCGTTCACCAGATTTTCGTTGAAGAAT
TACTACGGTCCGGTTCACGTGAGAACATAACAGTAGCTGAAGAGTTGATC
ACGCCTTCCAAACTTGCCGGGAATTCACCTCAAAGTAAGAAACCAGAACA
ACATTTGACGTCTGCACTCTACCTCCTCAAATATGATGTTTCGGTTACCG
TTGTGTTGGAAGCGAGTCGTGAATATTTCAATGCAGCAATGTCGGGTAAT
GACTCTTCAATGGAACTGGCTAGATTGTGTCTAACATTGGTCAAAGATTG
TCCAGAGAGTGTTCAAGATGAATTGGATTTGATCAACTCGTTGGGTTTAT
TGTATGAATTCAATGTATCCATGCTACCCTTACAAGTTCGCCTTTGCGCT
GATAAATTGGAAATTATCGATCTTTGTTTGAAGGAGAAGAAGAATGGGTA
CAAGAAAAAAGACAAGCTCATCCAATTGAGTAATCTTTTGCAAATCTGTG
GCCATGACAACAAAGAACGGATTGGACAAGTCAATATTAAAATTGCTGAA
TCAGCATTTGAACATAAAGATTACACATACGCTGGTATCGTTTGTGTACA
ATTGGTGGATGATAATTATTCTAATGCTTGGTATATTTGCAGGAAACTTG
GTGAATGTGCTAAATATACCAACTTCACAATCAGGCAAAAGTTGTTGAGT
TTTGCGTTAACTTATTGTCCAGTACATCACATTGAAGAAGTTTTACAAGA
GAAAACTCAACTGGAAACCCAGGTTTTGTACGAGAGGTTGGGTGTATTTA
CGAAAGAAGGCAAGAAAGACAAAATTGTGACCTCATCTAAGAAAGAAACT
GAGGAAGAAAACGACGAAGACAATGTTGATGGGAATAACATATCAATCCT
CAACAAGACCAAAACTACAACAAAGAAATTGATTTCAAGCGTCGCCAGCG
TGGCTGATAACCGCTGGGTTGGATCCGCAATGAATTGGGTCAAACCGTCG
TCGGAAGGGTCTGGTAACGAAGTTGATGTTGTTGAGCGGGAAATTGAAAG
CGTTCGGCATAACCCATTTTATAGTTCGCTGGATTCGAAAAAGATTGACG
AAGATGTTCAAAGATTTAATTATAACGAGTTCAGCGACCATTTGAGGTGC
GTCACAACCGAAGAAAAAGTATTCAATCAGCTGGTGTTAAGAAGTCAAAA
ATTGAACGAGCAAAGAACCCTGGGTAAAGAGCTCGAAAACACTGACCAAG
CAATGCTATCGTTGAGTGATATAGCTTATACTGAAGAAAGTTGTTTGTGT
CTGGCTTACATGATGGCTATTTCTCAGCCAAAAGAAATCCATTCCCTATC
GACCAAGCATCGGAAAAACACTTTCACTTTCCTTTTCACTGCTTATTACT
ATGCATTACAAGAATAtgttaaaaacaacaaaatcgAATTCGATAAACAA
GCACAGATTTACAGCGCGCCTCCGATTGATGTGATTACATGGATGCTAAA
AGTGTTAGGTAAGAAGCAAGgagaaaaggaagaaaaagaaaaaggagagA
CTTACTTTCTGTCTAACATGAACAAGTTGCAAGACTTGATGCAAGCAAAG
ATGCTACAAGCTCTTGACAAAGgaGTGGACATCGAAAGATTTTCAGTTGA
TAATGAATATAAACGTGAAACTATACTCGGATTAGCTATGAGTGTCGAAG
ACGAGTTGATTAACACAAGTTTGCTGCTAGCAGAGAAATATGATATCCCC
GCATGGGAAGTGTTGTTATCACACGTGGAATTTTTATTCACTGATAGTGG
TCTAAAAGCCAAAGCTATCCGCGAATCACTAAACAAATGGAAAGTTGATT
CCCATTTGAAACCGAACGGTGATAAAGTCTTTGAGCGGATGAAGAAATAT
GTTTACCCAGAAATCAATGGTAAAGACCACAATGCATTGCTGTTGTTCTA
CGTTTTCCTAATGAATTGCAGCTCGCCCACTAAAATATTGGAGGGTACGC
TTACATTAGATGCTCATTCcaaacttttgaagaaaatcaaGGCTGCTGCA
TCATCCATCAATTACAAACTTCTCGTGCATGGAGATTCACCTTTGGAGGT
GATTAGAGACTGTGTTGATGATAACAATGTACATTTGTTGGCTAAAATTG
CATCCAAAATCCCCCAGGCGGATGGTAGTTACCTGTCATCAAACAAGATC
TTCTTAGCAAACGCCATTCGGatgttttggaagaaaaaagaGAACAAGGA
TTGGTTGAATACATTCGAAAACTGTAAACAACACTTCACCAAACTCCTGA
TAGAAGACGTTGTCACTTTTGCTGACCATGCAATTTTTGGCGAGGAAGCT
TTAGACTCGCTGACCCAAGACACCAGACTGGAGATTGGTAAAAGAGtaat
aaaatatttgagacaacaACGTGGTCAAGACGAGACCAAACAAAGAGGAG
CTGACGATTATGATTCGCTTATGGAGCGCTACGATTCATCTATCAATGAT
TTGGAACTTTCCATCGAACATCTCAAAACGCTGACTGATCCAATTTTCAA
AGCAGTCTTTGGTGACGATAACGAACTGAGCAAAACCTTTGGACGAGTAT
ACGACTTATCACGTGGTCGAAAACAACCACTCGAAAAACTATTCCGTGAT
TTGTTCATATCGNTACAACCATTAGACAAAATTTCGAAACTGCGGAGTCT
TTGTCGCAATGCATCTATTGACGTCCGCACGTGTTTCCAAGATGCTTTGC
GCGGGATCCTGAGTGACATCCAAAGCGATAGAGATTACACAAAACTACAG
ACTTTAACGGAGAACATCAAAGCGCATCAAGAACATCAAACAGACCCTCT
TGTTACCCATAGCGACGTCTTAGATGTGGTGCGGCCATTTTGTTCTGATG
TTACAGCTAGCACGGATGTGAAGAGTCACGTGTTACATNTTTTGTTCTGA
atggaaGAAAATGAGCAAATATTGTATGATTTGATTGTTCACGAAGAATG
GAAACAAGAACCACAGTTGTTGGACCAAGTTGAAAGTTATTTTTGGCAAT
ATCGTGGTTCACTTCTAAAGAAGCTATGGAAAGTTTCACAAAGTTCTGCA
ATTTATATGTGGGACAACTTGAAGACACAATTCAGATATCAAGCTACCTT
TGGTTGCCCACCATTGAATTTTATCAATCTGATGAACAATTGCTTGCCAT
GGCTTATGGCTTTGTCACCGGATGGAAATTTTATTGCCATCCTTCAAGAT
TCTGTTATTGAAATAAGGACTGCTGGAAATTTTGAGCAAGTCATTACAAA
ATATAAGATTGAAAAAGATATGTTTCCAAGATGGCGTAAATTGATTTGGA
ATCATGACAACACCTTACTTTGTTATTCAAACAGTTTTGGAGATTTGACC
ATTTTGGATATTACCGGCactaaaaaacattttattccaTCATCAAATAA
TGTCAAGTTAAAAGTGCCTGGAACGCTGAGTTTGGCATTGTGTCATGTTG
AATTTGTAGCCAAAGGAAATagCTTCTTGTTATATACCTGCACCTATCAA
GGATTTTTTACAGTTTATGAAGTGAATGAATCCTCCTGCACAATAAAATG
GGACTACTCTTTCATAACATTCCATCCATATGGATTAGCTGGTTTGGTTA
TTGATCATAAAAATGGGTTATTGGTTGCAGCTGGGAATTATGGGAAGGAA
CCATTTCCTAATGTCATGGGAGATGCATGTTATGGATCATATTCTGGTAT
CAGTCTCTGGAGATTTTTGAATGACACACCTCATCTAACTCTGGTTGAAG
ACCAGGGAAAAGCTTTGAAGAAGGTATCCAGAGGTGAATGGTTAAAGAGT
GTTGTTTTAAGACGTGGCGATGAAAAAAACGAAATGTTGAAGCATGGTAT
TTACAAGTTGAAATTGTCAGAAGATGGTACACAAATTGTCACACTGCATC
TTGATGGTCGCATATCTTTTTGGAGTATCCCGTCAATGAGGCTAATCAAA
ACTTGGAGTAAATCTGAACAACCTGATGCAAGTGGCGGCTCAAGTGAAGG
GTTCTCCTTTGACTCGCAGAAAAAAGAAGaTCTCACCAAAACAAGGAATT
CAATAGATGTCAGCTGGTGGTCTGAAAAGGAGATTGCTTTGGCATCTGGG
AGGGGTGATGTAACGATTGCTTCGACTGACAGCTTGAAGAATTTACTTGG
AGAGTCGAGTGAGAAATTTGATCCATGGCCGTCACTCAGCCAAGTGGTGG
ATGGAAGCATTCTTGTGCTCGAGTGTGAGAAACGAGTGAACGATCCAAAC
AACAAAACGAAGACATCTTGGAAATGGACTTCAGAAGAAGATGAAAGCCA
AGATGAAGTGAACTCGATTCGTTATCGATTCAAAGAACTCACTAAACAGA
TGTTATATTTCATCACTGAGGCTGAAAGGTTTTTACCAGCTGTCAAGCCT
CCAAGAATTTTAACCAACGTTTATCGTTTACTATGCTTGAAATCTACAAC
ACCCGAAGAATTATACACGCGGAAAATCAATCTTGAACATTACGGAGAGG
CCTTGGACCTAGCTAAACGTTTTGGTTTGAATACTGATTTAGTTTATCAG
CGACAGTGGAAAAAGAAAAGAGTTTCGAAGATTACCATTCATGATTATCt
gtcCAAGATTAAAGATCGATATTGGGTTTTGGACGAGTGCCTTTTACGAG
TTGCCGATGACTTTGACTCGACAGAAGAGTTACTGAAATACGGTTTACTC
GGTACAAGTTGGGAAATCTTGCAAAGGATTGATGAAGAGGGTAAAGGTGa
tgcaaaggatgatgggaAGTTATTACCTTTTAAATTTGACGCCGCCCCAC
ATGACGAGGATGACGAAAACTCAAGTAGAGAATTCCAAgggagTCTAACG
AAGAAGCAATTGAAAATCTGCCAATATCGACGGCAATTATTACATTATCT
TGATCGGCTTTCCACTTATGAGGTTGTTTTGGGAGGCTCATTCAAAGCAC
GAGATAAATTCTCAAAAGAGTATTTTACCAAATTTCGATCGTGCAATATG
GTACACCAAGCGGTCGAGTGTGCCCGCGACGAGGACGCTTATACTCTGGA
GCATTTGTTTTCGTACCATGGGAAGCAGTTACTACCTTATTGGCTGCCGA
TATTATCAAACTTCCCGGAAACAACCGATATCCGATATTTTGAGCCGGTC
ATCCCTGAGATTGGAGAGCCACCAGAAGATCCAGAGATTTTACCTTGGTT
AGAGAAACACCATCGTGAAGAGGATTGGGTCGAGCAATCGAATATTGTCC
AACAAATCAAGTCTAATGAAGAAGGTGACGCAAACGAAGATATAGGCTCA
TTCATTTTCGAATCCGATCCAGAGATacgaaaattttacaaatgtGAAAC
AAAAGCTCAACTGAGAGAATGGTTTTTACATCGTGTACACTTGATTGATG
AATATTCCGGTCAGATTGATAAATGTTGCGAGCTGTTAGATGTGGGAATC
AAAAGAGGCTTGGAAGGGCTCACTAAGGTTCACCAAGAAATGGAAGCATG
GAGACTCTTAGTTTACGACGTTGGAATTGACAGTAAAATGACTGCAAAGA
GTTTCGTGGAATTATCTGAATCATCGAAAATCAAATTGCTAATGTTCAAA
ACCTCAGATGTGACATTCGTTAACGATTTCAAGCTATATCTAATGCCGTA
TTTAAGAAATATTGGAAAGAAGGATTTTAAGAAACGCCAAGATTTACTTC
ATGAGTTTTTGGTGGAAATCGCTAAAACTGATTTGACATGCTGCTTGAAG
TTATTGGAAAAGTGTTCGCCAGAGCTGCCAGAACCACTGCTTCCTGATAT
GGCGGAGATAATGAAGATTGGGATTGATTGCGTTTACGCGTGCAAGAGAA
CGGATCAATTGAATCATTGTTTCAGCATTGTCGAATGTTTGCCTTCGAGA
GAAGAGGGAGTCATTAGCCGTCCCGTGGAAGAGCTTCACATACAACTGGA
TCAATTGGAACATTTGCTGACAGGAGCGGAAATTTTACAGTATTACAACA
ACCCTCAGACCATCTCTTACATTTCTGAAATTAAAGATGACTCTACTATT
TGTAAACAACTCATTCAGCAATTGGTGAAAAACGCTGTTTGTAAAGGACG
TTGTGTTCCAAAGGAATTGAACAAATTACTCGGACATTTGATCAAGCTTT
CCAAAGAAGTTTTCCGGTGCTGTGATATCAAGATCGTTCACCAGATTTTC
GTTGAAGAATTACTACGGTCCGGTTCACGTGAGAACATAACAGTAGCTGA
AGAGTTGATCACGCCTTCCAAACTTGCCGGGAATTCACCTCAAAGTAAGA
AACCAGAACAACATTTGACGTCTGCACTCTACCTCCTCAAATATGATGTT
TCGGTTACCGTTGTGTTGGAAGCGAGTCGTGAATATTTCAATGCAGCAAT
GTCGGGTAATGACTCTTCAATGGAACTGGCTAGATTGTGTCTAACATTGG
TCAAAGATTGTCCAGAGAGTGTTCAAGATGAATTGGATTTGATCAACTCG
TTGGGTTTATTGTATGAATTCAATGTATCCATGCTACCCTTACAAGTTCG
CCTTTGCGCTGATAAATTGGAAATTATCGATCTTTGTTTGAAGGAGAAGA
AGAATGGGTACAAGAAAAAAGACAAGCTCATCCAATTGAGTAATCTTTTG
CAAATCTGTGGCCATGACAACAAAGAACGGATTGGACAAGTCAATATTAA
AATTGCTGAATCAGCATTTGAACATAAAGATTACACATACGCTGGTATCG
TTTGTGTACAATTGGTGGATGATAATTATTCTAATGCTTGGTATATTTGC
AGGAAACTTGGTGAATGTGCTAAATATACCAACTTCACAATCAGGCAAAA
GTTGTTGAGTTTTGCGTTAACTTATTGTCCAGTACATCACATTGAAGAAG
TTTTACAAGAGAAAACTCAACTGGAAACCCAGGTTTTGTACGAGAGGTTG
GGTGTATTTACGAAAGAAGGCAAGAAAGACAAAATTGTGACCTCATCTAA
GAAAGAAACTGAGGAAGAAAACGACGAAGACAATGTTGATGGGAATAACA
TATCAATCCTCAACAAGACCAAAACTACAACAAAGAAATTGATTTCAAGC
GTCGCCAGCGTGGCTGATAACCGCTGGGTTGGATCCGCAATGAATTGGGT
CAAACCGTCGTCGGAAGGGTCTGGTAACGAAGTTGATGTTGTTGAGCGGG
AAATTGAAAGCGTTCGGCATAACCCATTTTATAGTTCGCTGGATTCGAAA
AAGATTGACGAAGATGTTCAAAGATTTAATTATAACGAGTTCAGCGACCA
TTTGAGGTGCGTCACAACCGAAGAAAAAGTATTCAATCAGCTGGTGTTAA
GAAGTCAAAAATTGAACGAGCAAAGAACCCTGGGTAAAGAGCTCGAAAAC
ACTGACCAAGCAATGCTATCGTTGAGTGATATAGCTTATACTGAAGAAAG
TTGTTTGTGTCTGGCTTACATGATGGCTATTTCTCAGCCAAAAGAAATCC
ATTCCCTATCGACCAAGCATCGGAAAAACACTTTCACTTTCCTTTTCACT
GCTTATTACTATGCATTACAAGAATAtgttaaaaacaacaaaatcgAATT
CGATAAACAAGCACAGATTTACAGCGCGCCTCCGATTGATGTGATTACAT
GGATGCTAAAAGTGTTAGGTAAGAAGCAAGgagaaaaggaagaaaaagaa
aaaggagagACTTACTTTCTGTCTAACATGAACAAGTTGCAAGACTTGAT
GCAAGCAAAGATGCTACAAGCTCTTGACAAAGgaGTGGACATCGAAAGAT
TTTCAGTTGATAATGAATATAAACGTGAAACTATACTCGGATTAGCTATG
AGTGTCGAAGACGAGTTGATTAACACAAGTTTGCTGCTAGCAGAGAAATA
TGATATCCCCGCATGGGAAGTGTTGTTATCACACGTGGAATTTTTATTCA
CTGATAGTGGTCTAAAAGCCAAAGCTATCCGCGAATCACTAAACAAATGG
AAAGTTGATTCCCATTTGAAACCGAACGGTGATAAAGTCTTTGAGCGGAT
GAAGAAATATGTTTACCCAGAAATCAATGGTAAAGACCACAATGCATTGC
TGTTGTTCTACGTTTTCCTAATGAATTGCAGCTCGCCCACTAAAATATTG
GAGGGTACGCTTACATTAGATGCTCATTCcaaacttttgaagaaaatcaa
GGCTGCTGCATCATCCATCAATTACAAACTTCTCGTGCATGGAGATTCAC
CTTTGGAGGTGATTAGAGACTGTGTTGATGATAACAATGTACATTTGTTG
GCTAAAATTGCATCCAAAATCCCCCAGGCGGATGGTAGTTACCTGTCATC
AAACAAGATCTTCTTAGCAAACGCCATTCGGatgttttggaagaaaaaag
aGAACAAGGATTGGTTGAATACATTCGAAAACTGTAAACAACACTTCACC
AAACTCCTGATAGAAGACGTTGTCACTTTTGCTGACCATGCAATTTTTGG
CGAGGAAGCTTTAGACTCGCTGACCCAAGACACCAGACTGGAGATTGGTA
AAAGAGtaataaaatatttgagacaacaACGTGGTCAAGACGAGACCAAA
CAAAGAGGAGCTGACGATTATGATTCGCTTATGGAGCGCTACGATTCATC
TATCAATGATTTGGAACTTTCCATCGAACATCTCAAAACGCTGACTGATC
CAATTTTCAAAGCAGTCTTTGGTGACGATAACGAACTGAGCAAAACCTTT
GGACGAGTATACGACTTATCACGTGGTCGAAAACAACCACTCGAAAAACT
ATTCCGTGATTTGTTCATATCGNTACAACCATTAGACAAAATTTCGAAAC
TGCGGAGTCTTTGTCGCAATGCATCTATTGACGTCCGCACGTGTTTCCAA
GATGCTTTGCGCGGGATCCTGAGTGACATCCAAAGCGATAGAGATTACAC
AAAACTACAGACTTTAACGGAGAACATCAAAGCGCATCAAGAACATCAAA
CAGACCCTCTTGTTACCCATAGCGACGTCTTAGATGTGGTGCGGCCATTT
TGTTCTGATGTTACAGCTAGCACGGATGTGAAGAGTCACGTGTTACATNT
TTTGTTCTGAatggaaGAAAATGAGCAAATATTGTATGATTTGATTGTTC
ACGAAGAATGGAAACAAGAACCACAGTTGTTGGACCAAGTTGAAAGTTAT
TTTTGGCAATATCGTGGTTCACTTCTAAAGAAGCTATGGAAAGTTTCACA
AAGTTCTGCAATTTATATGTGGGACAACTTGAAGACACAATTCAGATATC
AAGCTACCTTTGGTTGCCCACCATTGAATTTTATCAATCTGATGAACAAT
TGCTTGCCATGGCTTATGGCTTTGTCACCGGATGGAAATTTTATTGCCAT
CCTTCAAGATTCTGTTATTGAAATAAGGACTGCTGGAAATTTTGAGCAAG
TCATTACAAAATATAAGATTGAAAAAGATATGTTTCCAAGATGGCGTAAA
TTGATTTGGAATCATGACAACACCTTACTTTGTTATTCAAACAGTTTTGG
AGATTTGACCATTTTGGATATTACCGGCactaaaaaacattttattccaT
CATCAAATAATGTCAAGTTAAAAGTGCCTGGAACGCTGAGTTTGGCATTG
TGTCATGTTGAATTTGTAGCCAAAGGAAATagCTTCTTGTTATATACCTG
CACCTATCAAGGATTTTTTACAGTTTATGAAGTGAATGAATCCTCCTGCA
CAATAAAATGGGACTACTCTTTCATAACATTCCATCCATATGGATTAGCT
GGTTTGGTTATTGATCATAAAAATGGGTTATTGGTTGCAGCTGGGAATTA
TGGGAAGGAACCATTTCCTAATGTCATGGGAGATGCATGTTATGGATCAT
ATTCTGGTATCAGTCTCTGGAGATTTTTGAATGACACACCTCATCTAACT
CTGGTTGAAGACCAGGGAAAAGCTTTGAAGAAGGTATCCAGAGGTGAATG
GTTAAAGAGTGTTGTTTTAAGACGTGGCGATGAAAAAAACGAAATGTTGA
AGCATGGTATTTACAAGTTGAAATTGTCAGAAGATGGTACACAAATTGTC
ACACTGCATCTTGATGGTCGCATATCTTTTTGGAGTATCCCGTCAATGAG
GCTAATCAAAACTTGGAGTAAATCTGAACAACCTGATGCAAGTGGCGGCT
CAAGTGAAGGGTTCTCCTTTGACTCGCAGAAAAAAGAAGaTCTCACCAAA
ACAAGGAATTCAATAGATGTCAGCTGGTGGTCTGAAAAGGAGATTGCTTT
GGCATCTGGGAGGGGTGATGTAACGATTGCTTCGACTGACAGCTTGAAGA
ATTTACTTGGAGAGTCGAGTGAGAAATTTGATCCATGGCCGTCACTCAGC
CAAGTGGTGGATGGAAGCATTCTTGTGCTCGAGTGTGAGAAACGAGTGAA
CGATCCAAACAACAAAACGAAGACATCTTGGAAATGGACTTCAGAAGAAG
ATGAAAGCCAAGATGAAGTGAACTCGATTCGTTATCGATTCAAAGAACTC
ACTAAACAGATGTTATATTTCATCACTGAGGCTGAAAGGTTTTTACCAGC
TGTCAAGCCTCCAAGAATTTTAACCAACGTTTATCGTTTACTATGCTTGA
AATCTACAACACCCGAAGAATTATACACGCGGAAAATCAATCTTGAACAT
TACGGAGAGGCCTTGGACCTAGCTAAACGTTTTGGTTTGAATACTGATTT
AGTTTATCAGCGACAGTGGAAAAAGAAAAGAGTTTCGAAGATTACCATTC
ATGATTATCtgtcCAAGATTAAAGATCGATATTGGGTTTTGGACGAGTGC
CTTTTACGAGTTGCCGATGACTTTGACTCGACAGAAGAGTTACTGAAATA
CGGTTTACTCGGTACAAGTTGGGAAATCTTGCAAAGGATTGATGAAGAGG
GTAAAGGTGatgcaaaggatgatgggaAGTTATTACCTTTTAAATTTGAC
GCCGCCCCACATGACGAGGATGACGAAAACTCAAGTAGAGAATTCCAAgg
gagTCTAACGAAGAAGCAATTGAAAATCTGCCAATATCGACGGCAATTAT
TACATTATCTTGATCGGCTTTCCACTTATGAGGTTGTTTTGGGAGGCTCA
TTCAAAGCACGAGATAAATTCTCAAAAGAGTATTTTACCAAATTTCGATC
GTGCAATATGGTACACCAAGCGGTCGAGTGTGCCCGCGACGAGGACGCTT
ATACTCTGGAGCATTTGTTTTCGTACCATGGGAAGCAGTTACTACCTTAT
TGGCTGCCGATATTATCAAACTTCCCGGAAACAACCGATATCCGATATTT
TGAGCCGGTCATCCCTGAGATTGGAGAGCCACCAGAAGATCCAGAGATTT
TACCTTGGTTAGAGAAACACCATCGTGAAGAGGATTGGGTCGAGCAATCG
AATATTGTCCAACAAATCAAGTCTAATGAAGAAGGTGACGCAAACGAAGA
TATAGGCTCATTCATTTTCGAATCCGATCCAGAGATacgaaaattttaca
aatgtGAAACAAAAGCTCAACTGAGAGAATGGTTTTTACATCGTGTACAC
TTGATTGATGAATATTCCGGTCAGATTGATAAATGTTGCGAGCTGTTAGA
TGTGGGAATCAAAAGAGGCTTGGAAGGGCTCACTAAGGTTCACCAAGAAA
TGGAAGCATGGAGACTCTTAGTTTACGACGTTGGAATTGACAGTAAAATG
ACTGCAAAGAGTTTCGTGGAATTATCTGAATCATCGAAAATCAAATTGCT
AATGTTCAAAACCTCAGATGTGACATTCGTTAACGATTTCAAGCTATATC
TAATGCCGTATTTAAGAAATATTGGAAAGAAGGATTTTAAGAAACGCCAA
GATTTACTTCATGAGTTTTTGGTGGAAATCGCTAAAACTGATTTGACATG
CTGCTTGAAGTTATTGGAAAAGTGTTCGCCAGAGCTGCCAGAACCACTGC
TTCCTGATATGGCGGAGATAATGAAGATTGGGATTGATTGCGTTTACGCG
TGCAAGAGAACGGATCAATTGAATCATTGTTTCAGCATTGTCGAATGTTT
GCCTTCGAGAGAAGAGGGAGTCATTAGCCGTCCCGTGGAAGAGCTTCACA
TACAACTGGATCAATTGGAACATTTGCTGACAGGAGCGGAAATTTTACAG
TATTACAACAACCCTCAGACCATCTCTTACATTTCTGAAATTAAAGATGA
CTCTACTATTTGTAAACAACTCATTCAGCAATTGGTGAAAAACGCTGTTT
GTAAAGGACGTTGTGTTCCAAAGGAATTGAACAAATTACTCGGACATTTG
ATCAAGCTTTCCAAAGAAGTTTTCCGGTGCTGTGATATCAAGATCGTTCA
CCAGATTTTCGTTGAAGAATTACTACGGTCCGGTTCACGTGAGAACATAA
CAGTAGCTGAAGAGTTGATCACGCCTTCCAAACTTGCCGGGAATTCACCT
CAAAGTAAGAAACCAGAACAACATTTGACGTCTGCACTCTACCTCCTCAA
ATATGATGTTTCGGTTACCGTTGTGTTGGAAGCGAGTCGTGAATATTTCA
ATGCAGCAATGTCGGGTAATGACTCTTCAATGGAACTGGCTAGATTGTGT
CTAACATTGGTCAAAGATTGTCCAGAGAGTGTTCAAGATGAATTGGATTT
GATCAACTCGTTGGGTTTATTGTATGAATTCAATGTATCCATGCTACCCT
TACAAGTTCGCCTTTGCGCTGATAAATTGGAAATTATCGATCTTTGTTTG
AAGGAGAAGAAGAATGGGTACAAGAAAAAAGACAAGCTCATCCAATTGAG
TAATCTTTTGCAAATCTGTGGCCATGACAACAAAGAACGGATTGGACAAG
TCAATATTAAAATTGCTGAATCAGCATTTGAACATAAAGATTACACATAC
GCTGGTATCGTTTGTGTACAATTGGTGGATGATAATTATTCTAATGCTTG
GTATATTTGCAGGAAACTTGGTGAATGTGCTAAATATACCAACTTCACAA
TCAGGCAAAAGTTGTTGAGTTTTGCGTTAACTTATTGTCCAGTACATCAC
ATTGAAGAAGTTTTACAAGAGAAAACTCAACTGGAAACCCAGGTTTTGTA
CGAGAGGTTGGGTGTATTTACGAAAGAAGGCAAGAAAGACAAAATTGTGA
CCTCATCTAAGAAAGAAACTGAGGAAGAAAACGACGAAGACAATGTTGAT
GGGAATAACATATCAATCCTCAACAAGACCAAAACTACAACAAAGAAATT
GATTTCAAGCGTCGCCAGCGTGGCTGATAACCGCTGGGTTGGATCCGCAA
TGAATTGGGTCAAACCGTCGTCGGAAGGGTCTGGTAACGAAGTTGATGTT
GTTGAGCGGGAAATTGAAAGCGTTCGGCATAACCCATTTTATAGTTCGCT
GGATTCGAAAAAGATTGACGAAGATGTTCAAAGATTTAATTATAACGAGT
TCAGCGACCATTTGAGGTGCGTCACAACCGAAGAAAAAGTATTCAATCAG
CTGGTGTTAAGAAGTCAAAAATTGAACGAGCAAAGAACCCTGGGTAAAGA
GCTCGAAAACACTGACCAAGCAATGCTATCGTTGAGTGATATAGCTTATA
CTGAAGAAAGTTGTTTGTGTCTGGCTTACATGATGGCTATTTCTCAGCCA
AAAGAAATCCATTCCCTATCGACCAAGCATCGGAAAAACACTTTCACTTT
CCTTTTCACTGCTTATTACTATGCATTACAAGAATAtgttaaaaacaaca
aaatcgAATTCGATAAACAAGCACAGATTTACAGCGCGCCTCCGATTGAT
GTGATTACATGGATGCTAAAAGTGTTAGGTAAGAAGCAAGgagaaaagga
agaaaaagaaaaaggagagACTTACTTTCTGTCTAACATGAACAAGTTGC
AAGACTTGATGCAAGCAAAGATGCTACAAGCTCTTGACAAAGgaGTGGAC
ATCGAAAGATTTTCAGTTGATAATGAATATAAACGTGAAACTATACTCGG
ATTAGCTATGAGTGTCGAAGACGAGTTGATTAACACAAGTTTGCTGCTAG
CAGAGAAATATGATATCCCCGCATGGGAAGTGTTGTTATCACACGTGGAA
TTTTTATTCACTGATAGTGGTCTAAAAGCCAAAGCTATCCGCGAATCACT
AAACAAATGGAAAGTTGATTCCCATTTGAAACCGAACGGTGATAAAGTCT
TTGAGCGGATGAAGAAATATGTTTACCCAGAAATCAATGGTAAAGACCAC
AATGCATTGCTGTTGTTCTACGTTTTCCTAATGAATTGCAGCTCGCCCAC
TAAAATATTGGAGGGTACGCTTACATTAGATGCTCATTCcaaacttttga
agaaaatcaaGGCTGCTGCATCATCCATCAATTACAAACTTCTCGTGCAT
GGAGATTCACCTTTGGAGGTGATTAGAGACTGTGTTGATGATAACAATGT
ACATTTGTTGGCTAAAATTGCATCCAAAATCCCCCAGGCGGATGGTAGTT
ACCTGTCATCAAACAAGATCTTCTTAGCAAACGCCATTCGGatgttttgg
aagaaaaaagaGAACAAGGATTGGTTGAATACATTCGAAAACTGTAAACA
ACACTTCACCAAACTCCTGATAGAAGACGTTGTCACTTTTGCTGACCATG
CAATTTTTGGCGAGGAAGCTTTAGACTCGCTGACCCAAGACACCAGACTG
GAGATTGGTAAAAGAGtaataaaatatttgagacaacaACGTGGTCAAGA
CGAGACCAAACAAAGAGGAGCTGACGATTATGATTCGCTTATGGAGCGCT
ACGATTCATCTATCAATGATTTGGAACTTTCCATCGAACATCTCAAAACG
CTGACTGATCCAATTTTCAAAGCAGTCTTTGGTGACGATAACGAACTGAG
CAAAACCTTTGGACGAGTATACGACTTATCACGTGGTCGAAAACAACCAC
TCGAAAAACTATTCCGTGATTTGTTCATATCGNTACAACCATTAGACAAA
ATTTCGAAACTGCGGAGTCTTTGTCGCAATGCATCTATTGACGTCCGCAC
GTGTTTCCAAGATGCTTTGCGCGGGATCCTGAGTGACATCCAAAGCGATA
GAGATTACACAAAACTACAGACTTTAACGGAGAACATCAAAGCGCATCAA
GAACATCAAACAGACCCTCTTGTTACCCATAGCGACGTCTTAGATGTGGT
GCGGCCATTTTGTTCTGATGTTACAGCTAGCACGGATGTGAAGAGTCACG
TGTTACATNTTTTGTTCTGAatggaaGAAAATGAGCAAATATTGTATGAT
TTGATTGTTCACGAAGAATGGAAACAAGAACCACAGTTGTTGGACCAAGT
TGAAAGTTATTTTTGGCAATATCGTGGTTCACTTCTAAAGAAGCTATGGA
AAGTTTCACAAAGTTCTGCAATTTATATGTGGGACAACTTGAAGACACAA
TTCAGATATCAAGCTACCTTTGGTTGCCCACCATTGAATTTTATCAATCT
GATGAACAATTGCTTGCCATGGCTTATGGCTTTGTCACCGGATGGAAATT
TTATTGCCATCCTTCAAGATTCTGTTATTGAAATAAGGACTGCTGGAAAT
TTTGAGCAAGTCATTACAAAATATAAGATTGAAAAAGATATGTTTCCAAG
ATGGCGTAAATTGATTTGGAATCATGACAACACCTTACTTTGTTATTCAA
ACAGTTTTGGAGATTTGACCATTTTGGATATTACCGGCactaaaaaacat
tttattccaTCATCAAATAATGTCAAGTTAAAAGTGCCTGGAACGCTGAG
TTTGGCATTGTGTCATGTTGAATTTGTAGCCAAAGGAAATagCTTCTTGT
TATATACCTGCACCTATCAAGGATTTTTTACAGTTTATGAAGTGAATGAA
TCCTCCTGCACAATAAAATGGGACTACTCTTTCATAACATTCCATCCATA
TGGATTAGCTGGTTTGGTTATTGATCATAAAAATGGGTTATTGGTTGCAG
CTGGGAATTATGGGAAGGAACCATTTCCTAATGTCATGGGAGATGCATGT
TATGGATCATATTCTGGTATCAGTCTCTGGAGATTTTTGAATGACACACC
TCATCTAACTCTGGTTGAAGACCAGGGAAAAGCTTTGAAGAAGGTATCCA
GAGGTGAATGGTTAAAGAGTGTTGTTTTAAGACGTGGCGATGAAAAAAAC
GAAATGTTGAAGCATGGTATTTACAAGTTGAAATTGTCAGAAGATGGTAC
ACAAATTGTCACACTGCATCTTGATGGTCGCATATCTTTTTGGAGTATCC
CGTCAATGAGGCTAATCAAAACTTGGAGTAAATCTGAACAACCTGATGCA
AGTGGCGGCTCAAGTGAAGGGTTCTCCTTTGACTCGCAGAAAAAAGAAGa
TCTCACCAAAACAAGGAATTCAATAGATGTCAGCTGGTGGTCTGAAAAGG
AGATTGCTTTGGCATCTGGGAGGGGTGATGTAACGATTGCTTCGACTGAC
AGCTTGAAGAATTTACTTGGAGAGTCGAGTGAGAAATTTGATCCATGGCC
GTCACTCAGCCAAGTGGTGGATGGAAGCATTCTTGTGCTCGAGTGTGAGA
AACGAGTGAACGATCCAAACAACAAAACGAAGACATCTTGGAAATGGACT
TCAGAAGAAGATGAAAGCCAAGATGAAGTGAACTCGATTCGTTATCGATT
CAAAGAACTCACTAAACAGATGTTATATTTCATCACTGAGGCTGAAAGGT
TTTTACCAGCTGTCAAGCCTCCAAGAATTTTAACCAACGTTTATCGTTTA
CTATGCTTGAAATCTACAACACCCGAAGAATTATACACGCGGAAAATCAA
TCTTGAACATTACGGAGAGGCCTTGGACCTAGCTAAACGTTTTGGTTTGA
ATACTGATTTAGTTTATCAGCGACAGTGGAAAAAGAAAAGAGTTTCGAAG
ATTACCATTCATGATTATCtgtcCAAGATTAAAGATCGATATTGGGTTTT
GGACGAGTGCCTTTTACGAGTTGCCGATGACTTTGACTCGACAGAAGAGT
TACTGAAATACGGTTTACTCGGTACAAGTTGGGAAATCTTGCAAAGGATT
GATGAAGAGGGTAAAGGTGatgcaaaggatgatgggaAGTTATTACCTTT
TAAATTTGACGCCGCCCCACATGACGAGGATGACGAAAACTCAAGTAGAG
AATTCCAAgggagTCTAACGAAGAAGCAATTGAAAATCTGCCAATATCGA
CGGCAATTATTACATTATCTTGATCGGCTTTCCACTTATGAGGTTGTTTT
GGGAGGCTCATTCAAAGCACGAGATAAATTCTCAAAAGAGTATTTTACCA
AATTTCGATCGTGCAATATGGTACACCAAGCGGTCGAGTGTGCCCGCGAC
GAGGACGCTTATACTCTGGAGCATTTGTTTTCGTACCATGGGAAGCAGTT
ACTACCTTATTGGCTGCCGATATTATCAAACTTCCCGGAAACAACCGATA
TCCGATATTTTGAGCCGGTCATCCCTGAGATTGGAGAGCCACCAGAAGAT
CCAGAGATTTTACCTTGGTTAGAGAAACACCATCGTGAAGAGGATTGGGT
CGAGCAATCGAATATTGTCCAACAAATCAAGTCTAATGAAGAAGGTGACG
CAAACGAAGATATAGGCTCATTCATTTTCGAATCCGATCCAGAGATacga
aaattttacaaatgtGAAACAAAAGCTCAACTGAGAGAATGGTTTTTACA
TCGTGTACACTTGATTGATGAATATTCCGGTCAGATTGATAAATGTTGCG
AGCTGTTAGATGTGGGAATCAAAAGAGGCTTGGAAGGGCTCACTAAGGTT
CACCAAGAAATGGAAGCATGGAGACTCTTAGTTTACGACGTTGGAATTGA
CAGTAAAATGACTGCAAAGAGTTTCGTGGAATTATCTGAATCATCGAAAA
TCAAATTGCTAATGTTCAAAACCTCAGATGTGACATTCGTTAACGATTTC
AAGCTATATCTAATGCCGTATTTAAGAAATATTGGAAAGAAGGATTTTAA
GAAACGCCAAGATTTACTTCATGAGTTTTTGGTGGAAATCGCTAAAACTG
ATTTGACATGCTGCTTGAAGTTATTGGAAAAGTGTTCGCCAGAGCTGCCA
GAACCACTGCTTCCTGATATGGCGGAGATAATGAAGATTGGGATTGATTG
CGTTTACGCGTGCAAGAGAACGGATCAATTGAATCATTGTTTCAGCATTG
TCGAATGTTTGCCTTCGAGAGAAGAGGGAGTCATTAGCCGTCCCGTGGAA
GAGCTTCACATACAACTGGATCAATTGGAACATTTGCTGACAGGAGCGGA
AATTTTACAGTATTACAACAACCCTCAGACCATCTCTTACATTTCTGAAA
TTAAAGATGACTCTACTATTTGTAAACAACTCATTCAGCAATTGGTGAAA
AACGCTGTTTGTAAAGGACGTTGTGTTCCAAAGGAATTGAACAAATTACT
CGGACATTTGATCAAGCTTTCCAAAGAAGTTTTCCGGTGCTGTGATATCA
AGATCGTTCACCAGATTTTCGTTGAAGAATTACTACGGTCCGGTTCACGT
GAGAACATAACAGTAGCTGAAGAGTTGATCACGCCTTCCAAACTTGCCGG
GAATTCACCTCAAAGTAAGAAACCAGAACAACATTTGACGTCTGCACTCT
ACCTCCTCAAATATGATGTTTCGGTTACCGTTGTGTTGGAAGCGAGTCGT
GAATATTTCAATGCAGCAATGTCGGGTAATGACTCTTCAATGGAACTGGC
TAGATTGTGTCTAACATTGGTCAAAGATTGTCCAGAGAGTGTTCAAGATG
AATTGGATTTGATCAACTCGTTGGGTTTATTGTATGAATTCAATGTATCC
ATGCTACCCTTACAAGTTCGCCTTTGCGCTGATAAATTGGAAATTATCGA
TCTTTGTTTGAAGGAGAAGAAGAATGGGTACAAGAAAAAAGACAAGCTCA
TCCAATTGAGTAATCTTTTGCAAATCTGTGGCCATGACAACAAAGAACGG
ATTGGACAAGTCAATATTAAAATTGCTGAATCAGCATTTGAACATAAAGA
TTACACATACGCTGGTATCGTTTGTGTACAATTGGTGGATGATAATTATT
CTAATGCTTGGTATATTTGCAGGAAACTTGGTGAATGTGCTAAATATACC
AACTTCACAATCAGGCAAAAGTTGTTGAGTTTTGCGTTAACTTATTGTCC
AGTACATCACATTGAAGAAGTTTTACAAGAGAAAACTCAACTGGAAACCC
AGGTTTTGTACGAGAGGTTGGGTGTATTTACGAAAGAAGGCAAGAAAGAC
AAAATTGTGACCTCATCTAAGAAAGAAACTGAGGAAGAAAACGACGAAGA
CAATGTTGATGGGAATAACATATCAATCCTCAACAAGACCAAAACTACAA
CAAAGAAATTGATTTCAAGCGTCGCCAGCGTGGCTGATAACCGCTGGGTT
GGATCCGCAATGAATTGGGTCAAACCGTCGTCGGAAGGGTCTGGTAACGA
AGTTGATGTTGTTGAGCGGGAAATTGAAAGCGTTCGGCATAACCCATTTT
ATAGTTCGCTGGATTCGAAAAAGATTGACGAAGATGTTCAAAGATTTAAT
TATAACGAGTTCAGCGACCATTTGAGGTGCGTCACAACCGAAGAAAAAGT
ATTCAATCAGCTGGTGTTAAGAAGTCAAAAATTGAACGAGCAAAGAACCC
TGGGTAAAGAGCTCGAAAACACTGACCAAGCAATGCTATCGTTGAGTGAT
ATAGCTTATACTGAAGAAAGTTGTTTGTGTCTGGCTTACATGATGGCTAT
TTCTCAGCCAAAAGAAATCCATTCCCTATCGACCAAGCATCGGAAAAACA
CTTTCACTTTCCTTTTCACTGCTTATTACTATGCATTACAAGAATAtgtt
aaaaacaacaaaatcgAATTCGATAAACAAGCACAGATTTACAGCGCGCC
TCCGATTGATGTGATTACATGGATGCTAAAAGTGTTAGGTAAGAAGCAAG
gagaaaaggaagaaaaagaaaaaggagagACTTACTTTCTGTCTAACATG
AACAAGTTGCAAGACTTGATGCAAGCAAAGATGCTACAAGCTCTTGACAA
AGgaGTGGACATCGAAAGATTTTCAGTTGATAATGAATATAAACGTGAAA
CTATACTCGGATTAGCTATGAGTGTCGAAGACGAGTTGATTAACACAAGT
TTGCTGCTAGCAGAGAAATATGATATCCCCGCATGGGAAGTGTTGTTATC
ACACGTGGAATTTTTATTCACTGATAGTGGTCTAAAAGCCAAAGCTATCC
GCGAATCACTAAACAAATGGAAAGTTGATTCCCATTTGAAACCGAACGGT
GATAAAGTCTTTGAGCGGATGAAGAAATATGTTTACCCAGAAATCAATGG
TAAAGACCACAATGCATTGCTGTTGTTCTACGTTTTCCTAATGAATTGCA
GCTCGCCCACTAAAATATTGGAGGGTACGCTTACATTAGATGCTCATTCc
aaacttttgaagaaaatcaaGGCTGCTGCATCATCCATCAATTACAAACT
TCTCGTGCATGGAGATTCACCTTTGGAGGTGATTAGAGACTGTGTTGATG
ATAACAATGTACATTTGTTGGCTAAAATTGCATCCAAAATCCCCCAGGCG
GATGGTAGTTACCTGTCATCAAACAAGATCTTCTTAGCAAACGCCATTCG
GatgttttggaagaaaaaagaGAACAAGGATTGGTTGAATACATTCGAAA
ACTGTAAACAACACTTCACCAAACTCCTGATAGAAGACGTTGTCACTTTT
GCTGACCATGCAATTTTTGGCGAGGAAGCTTTAGACTCGCTGACCCAAGA
CACCAGACTGGAGATTGGTAAAAGAGtaataaaatatttgagacaacaAC
GTGGTCAAGACGAGACCAAACAAAGAGGAGCTGACGATTATGATTCGCTT
ATGGAGCGCTACGATTCATCTATCAATGATTTGGAACTTTCCATCGAACA
TCTCAAAACGCTGACTGATCCAATTTTCAAAGCAGTCTTTGGTGACGATA
ACGAACTGAGCAAAACCTTTGGACGAGTATACGACTTATCACGTGGTCGA
AAACAACCACTCGAAAAACTATTCCGTGATTTGTTCATATCGNTACAACC
ATTAGACAAAATTTCGAAACTGCGGAGTCTTTGTCGCAATGCATCTATTG
ACGTCCGCACGTGTTTCCAAGATGCTTTGCGCGGGATCCTGAGTGACATC
CAAAGCGATAGAGATTACACAAAACTACAGACTTTAACGGAGAACATCAA
AGCGCATCAAGAACATCAAACAGACCCTCTTGTTACCCATAGCGACGTCT
TAGATGTGGTGCGGCCATTTTGTTCTGATGTTACAGCTAGCACGGATGTG
AAGAGTCACGTGTTACATNTTTTGTTCTGAatggaaGAAAATGAGCAAAT
ATTGTATGATTTGATTGTTCACGAAGAATGGAAACAAGAACCACAGTTGT
TGGACCAAGTTGAAAGTTATTTTTGGCAATATCGTGGTTCACTTCTAAAG
AAGCTATGGAAAGTTTCACAAAGTTCTGCAATTTATATGTGGGACAACTT
GAAGACACAATTCAGATATCAAGCTACCTTTGGTTGCCCACCATTGAATT
TTATCAATCTGATGAACAATTGCTTGCCATGGCTTATGGCTTTGTCACCG
GATGGAAATTTTATTGCCATCCTTCAAGATTCTGTTATTGAAATAAGGAC
TGCTGGAAATTTTGAGCAAGTCATTACAAAATATAAGATTGAAAAAGATA
TGTTTCCAAGATGGCGTAAATTGATTTGGAATCATGACAACACCTTACTT
TGTTATTCAAACAGTTTTGGAGATTTGACCATTTTGGATATTACCGGCac
taaaaaacattttattccaTCATCAAATAATGTCAAGTTAAAAGTGCCTG
GAACGCTGAGTTTGGCATTGTGTCATGTTGAATTTGTAGCCAAAGGAAAT
agCTTCTTGTTATATACCTGCACCTATCAAGGATTTTTTACAGTTTATGA
AGTGAATGAATCCTCCTGCACAATAAAATGGGACTACTCTTTCATAACAT
TCCATCCATATGGATTAGCTGGTTTGGTTATTGATCATAAAAATGGGTTA
TTGGTTGCAGCTGGGAATTATGGGAAGGAACCATTTCCTAATGTCATGGG
AGATGCATGTTATGGATCATATTCTGGTATCAGTCTCTGGAGATTTTTGA
ATGACACACCTCATCTAACTCTGGTTGAAGACCAGGGAAAAGCTTTGAAG
AAGGTATCCAGAGGTGAATGGTTAAAGAGTGTTGTTTTAAGACGTGGCGA
TGAAAAAAACGAAATGTTGAAGCATGGTATTTACAAGTTGAAATTGTCAG
AAGATGGTACACAAATTGTCACACTGCATCTTGATGGTCGCATATCTTTT
TGGAGTATCCCGTCAATGAGGCTAATCAAAACTTGGAGTAAATCTGAACA
ACCTGATGCAAGTGGCGGCTCAAGTGAAGGGTTCTCCTTTGACTCGCAGA
AAAAAGAAGaTCTCACCAAAACAAGGAATTCAATAGATGTCAGCTGGTGG
TCTGAAAAGGAGATTGCTTTGGCATCTGGGAGGGGTGATGTAACGATTGC
TTCGACTGACAGCTTGAAGAATTTACTTGGAGAGTCGAGTGAGAAATTTG
ATCCATGGCCGTCACTCAGCCAAGTGGTGGATGGAAGCATTCTTGTGCTC
GAGTGTGAGAAACGAGTGAACGATCCAAACAACAAAACGAAGACATCTTG
GAAATGGACTTCAGAAGAAGATGAAAGCCAAGATGAAGTGAACTCGATTC
GTTATCGATTCAAAGAACTCACTAAACAGATGTTATATTTCATCACTGAG
GCTGAAAGGTTTTTACCAGCTGTCAAGCCTCCAAGAATTTTAACCAACGT
TTATCGTTTACTATGCTTGAAATCTACAACACCCGAAGAATTATACACGC
GGAAAATCAATCTTGAACATTACGGAGAGGCCTTGGACCTAGCTAAACGT
TTTGGTTTGAATACTGATTTAGTTTATCAGCGACAGTGGAAAAAGAAAAG
AGTTTCGAAGATTACCATTCATGATTATCtgtcCAAGATTAAAGATCGAT
ATTGGGTTTTGGACGAGTGCCTTTTACGAGTTGCCGATGACTTTGACTCG
ACAGAAGAGTTACTGAAATACGGTTTACTCGGTACAAGTTGGGAAATCTT
GCAAAGGATTGATGAAGAGGGTAAAGGTGatgcaaaggatgatgggaAGT
TATTACCTTTTAAATTTGACGCCGCCCCACATGACGAGGATGACGAAAAC
TCAAGTAGAGAATTCCAAgggagTCTAACGAAGAAGCAATTGAAAATCTG
CCAATATCGACGGCAATTATTACATTATCTTGATCGGCTTTCCACTTATG
AGGTTGTTTTGGGAGGCTCATTCAAAGCACGAGATAAATTCTCAAAAGAG
TATTTTACCAAATTTCGATCGTGCAATATGGTACACCAAGCGGTCGAGTG
TGCCCGCGACGAGGACGCTTATACTCTGGAGCATTTGTTTTCGTACCATG
GGAAGCAGTTACTACCTTATTGGCTGCCGATATTATCAAACTTCCCGGAA
ACAACCGATATCCGATATTTTGAGCCGGTCATCCCTGAGATTGGAGAGCC
ACCAGAAGATCCAGAGATTTTACCTTGGTTAGAGAAACACCATCGTGAAG
AGGATTGGGTCGAGCAATCGAATATTGTCCAACAAATCAAGTCTAATGAA
GAAGGTGACGCAAACGAAGATATAGGCTCATTCATTTTCGAATCCGATCC
AGAGATacgaaaattttacaaatgtGAAACAAAAGCTCAACTGAGAGAAT
GGTTTTTACATCGTGTACACTTGATTGATGAATATTCCGGTCAGATTGAT
AAATGTTGCGAGCTGTTAGATGTGGGAATCAAAAGAGGCTTGGAAGGGCT
CACTAAGGTTCACCAAGAAATGGAAGCATGGAGACTCTTAGTTTACGACG
TTGGAATTGACAGTAAAATGACTGCAAAGAGTTTCGTGGAATTATCTGAA
TCATCGAAAATCAAATTGCTAATGTTCAAAACCTCAGATGTGACATTCGT
TAACGATTTCAAGCTATATCTAATGCCGTATTTAAGAAATATTGGAAAGA
AGGATTTTAAGAAACGCCAAGATTTACTTCATGAGTTTTTGGTGGAAATC
GCTAAAACTGATTTGACATGCTGCTTGAAGTTATTGGAAAAGTGTTCGCC
AGAGCTGCCAGAACCACTGCTTCCTGATATGGCGGAGATAATGAAGATTG
GGATTGATTGCGTTTACGCGTGCAAGAGAACGGATCAATTGAATCATTGT
TTCAGCATTGTCGAATGTTTGCCTTCGAGAGAAGAGGGAGTCATTAGCCG
TCCCGTGGAAGAGCTTCACATACAACTGGATCAATTGGAACATTTGCTGA
CAGGAGCGGAAATTTTACAGTATTACAACAACCCTCAGACCATCTCTTAC
ATTTCTGAAATTAAAGATGACTCTACTATTTGTAAACAACTCATTCAGCA
ATTGGTGAAAAACGCTGTTTGTAAAGGACGTTGTGTTCCAAAGGAATTGA
ACAAATTACTCGGACATTTGATCAAGCTTTCCAAAGAAGTTTTCCGGTGC
TGTGATATCAAGATCGTTCACCAGATTTTCGTTGAAGAATTACTACGGTC
CGGTTCACGTGAGAACATAACAGTAGCTGAAGAGTTGATCACGCCTTCCA
AACTTGCCGGGAATTCACCTCAAAGTAAGAAACCAGAACAACATTTGACG
TCTGCACTCTACCTCCTCAAATATGATGTTTCGGTTACCGTTGTGTTGGA
AGCGAGTCGTGAATATTTCAATGCAGCAATGTCGGGTAATGACTCTTCAA
TGGAACTGGCTAGATTGTGTCTAACATTGGTCAAAGATTGTCCAGAGAGT
GTTCAAGATGAATTGGATTTGATCAACTCGTTGGGTTTATTGTATGAATT
CAATGTATCCATGCTACCCTTACAAGTTCGCCTTTGCGCTGATAAATTGG
AAATTATCGATCTTTGTTTGAAGGAGAAGAAGAATGGGTACAAGAAAAAA
GACAAGCTCATCCAATTGAGTAATCTTTTGCAAATCTGTGGCCATGACAA
CAAAGAACGGATTGGACAAGTCAATATTAAAATTGCTGAATCAGCATTTG
AACATAAAGATTACACATACGCTGGTATCGTTTGTGTACAATTGGTGGAT
GATAATTATTCTAATGCTTGGTATATTTGCAGGAAACTTGGTGAATGTGC
TAAATATACCAACTTCACAATCAGGCAAAAGTTGTTGAGTTTTGCGTTAA
CTTATTGTCCAGTACATCACATTGAAGAAGTTTTACAAGAGAAAACTCAA
CTGGAAACCCAGGTTTTGTACGAGAGGTTGGGTGTATTTACGAAAGAAGG
CAAGAAAGACAAAATTGTGACCTCATCTAAGAAAGAAACTGAGGAAGAAA
ACGACGAAGACAATGTTGATGGGAATAACATATCAATCCTCAACAAGACC
AAAACTACAACAAAGAAATTGATTTCAAGCGTCGCCAGCGTGGCTGATAA
CCGCTGGGTTGGATCCGCAATGAATTGGGTCAAACCGTCGTCGGAAGGGT
CTGGTAACGAAGTTGATGTTGTTGAGCGGGAAATTGAAAGCGTTCGGCAT
AACCCATTTTATAGTTCGCTGGATTCGAAAAAGATTGACGAAGATGTTCA
AAGATTTAATTATAACGAGTTCAGCGACCATTTGAGGTGCGTCACAACCG
AAGAAAAAGTATTCAATCAGCTGGTGTTAAGAAGTCAAAAATTGAACGAG
CAAAGAACCCTGGGTAAAGAGCTCGAAAACACTGACCAAGCAATGCTATC
GTTGAGTGATATAGCTTATACTGAAGAAAGTTGTTTGTGTCTGGCTTACA
TGATGGCTATTTCTCAGCCAAAAGAAATCCATTCCCTATCGACCAAGCAT
CGGAAAAACACTTTCACTTTCCTTTTCACTGCTTATTACTATGCATTACA
AGAATAtgttaaaaacaacaaaatcgAATTCGATAAACAAGCACAGATTT
ACAGCGCGCCTCCGATTGATGTGATTACATGGATGCTAAAAGTGTTAGGT
AAGAAGCAAGgagaaaaggaagaaaaagaaaaaggagagACTTACTTTCT
GTCTAACATGAACAAGTTGCAAGACTTGATGCAAGCAAAGATGCTACAAG
CTCTTGACAAAGgaGTGGACATCGAAAGATTTTCAGTTGATAATGAATAT
AAACGTGAAACTATACTCGGATTAGCTATGAGTGTCGAAGACGAGTTGAT
TAACACAAGTTTGCTGCTAGCAGAGAAATATGATATCCCCGCATGGGAAG
TGTTGTTATCACACGTGGAATTTTTATTCACTGATAGTGGTCTAAAAGCC
AAAGCTATCCGCGAATCACTAAACAAATGGAAAGTTGATTCCCATTTGAA
ACCGAACGGTGATAAAGTCTTTGAGCGGATGAAGAAATATGTTTACCCAG
AAATCAATGGTAAAGACCACAATGCATTGCTGTTGTTCTACGTTTTCCTA
ATGAATTGCAGCTCGCCCACTAAAATATTGGAGGGTACGCTTACATTAGA
TGCTCATTCcaaacttttgaagaaaatcaaGGCTGCTGCATCATCCATCA
ATTACAAACTTCTCGTGCATGGAGATTCACCTTTGGAGGTGATTAGAGAC
TGTGTTGATGATAACAATGTACATTTGTTGGCTAAAATTGCATCCAAAAT
CCCCCAGGCGGATGGTAGTTACCTGTCATCAAACAAGATCTTCTTAGCAA
ACGCCATTCGGatgttttggaagaaaaaagaGAACAAGGATTGGTTGAAT
ACATTCGAAAACTGTAAACAACACTTCACCAAACTCCTGATAGAAGACGT
TGTCACTTTTGCTGACCATGCAATTTTTGGCGAGGAAGCTTTAGACTCGC
TGACCCAAGACACCAGACTGGAGATTGGTAAAAGAGtaataaaatatttg
agacaacaACGTGGTCAAGACGAGACCAAACAAAGAGGAGCTGACGATTA
TGATTCGCTTATGGAGCGCTACGATTCATCTATCAATGATTTGGAACTTT
CCATCGAACATCTCAAAACGCTGACTGATCCAATTTTCAAAGCAGTCTTT
GGTGACGATAACGAACTGAGCAAAACCTTTGGACGAGTATACGACTTATC
ACGTGGTCGAAAACAACCACTCGAAAAACTATTCCGTGATTTGTTCATAT
CGNTACAACCATTAGACAAAATTTCGAAACTGCGGAGTCTTTGTCGCAAT
GCATCTATTGACGTCCGCACGTGTTTCCAAGATGCTTTGCGCGGGATCCT
GAGTGACATCCAAAGCGATAGAGATTACACAAAACTACAGACTTTAACGG
AGAACATCAAAGCGCATCAAGAACATCAAACAGACCCTCTTGTTACCCAT
AGCGACGTCTTAGATGTGGTGCGGCCATTTTGTTCTGATGTTACAGCTAG
CACGGATGTGAAGAGTCACGTGTTACATNTTTTGTTCTGAatggaaGAAA
ATGAGCAAATATTGTATGATTTGATTGTTCACGAAGAATGGAAACAAGAA
CCACAGTTGTTGGACCAAGTTGAAAGTTATTTTTGGCAATATCGTGGTTC
ACTTCTAAAGAAGCTATGGAAAGTTTCACAAAGTTCTGCAATTTATATGT
GGGACAACTTGAAGACACAATTCAGATATCAAGCTACCTTTGGTTGCCCA
CCATTGAATTTTATCAATCTGATGAACAATTGCTTGCCATGGCTTATGGC
TTTGTCACCGGATGGAAATTTTATTGCCATCCTTCAAGATTCTGTTATTG
AAATAAGGACTGCTGGAAATTTTGAGCAAGTCATTACAAAATATAAGATT
GAAAAAGATATGTTTCCAAGATGGCGTAAATTGATTTGGAATCATGACAA
CACCTTACTTTGTTATTCAAACAGTTTTGGAGATTTGACCATTTTGGATA
TTACCGGCactaaaaaacattttattccaTCATCAAATAATGTCAAGTTA
AAAGTGCCTGGAACGCTGAGTTTGGCATTGTGTCATGTTGAATTTGTAGC
CAAAGGAAATagCTTCTTGTTATATACCTGCACCTATCAAGGATTTTTTA
CAGTTTATGAAGTGAATGAATCCTCCTGCACAATAAAATGGGACTACTCT
TTCATAACATTCCATCCATATGGATTAGCTGGTTTGGTTATTGATCATAA
AAATGGGTTATTGGTTGCAGCTGGGAATTATGGGAAGGAACCATTTCCTA
ATGTCATGGGAGATGCATGTTATGGATCATATTCTGGTATCAGTCTCTGG
AGATTTTTGAATGACACACCTCATCTAACTCTGGTTGAAGACCAGGGAAA
AGCTTTGAAGAAGGTATCCAGAGGTGAATGGTTAAAGAGTGTTGTTTTAA
GACGTGGCGATGAAAAAAACGAAATGTTGAAGCATGGTATTTACAAGTTG
AAATTGTCAGAAGATGGTACACAAATTGTCACACTGCATCTTGATGGTCG
CATATCTTTTTGGAGTATCCCGTCAATGAGGCTAATCAAAACTTGGAGTA
AATCTGAACAACCTGATGCAAGTGGCGGCTCAAGTGAAGGGTTCTCCTTT
GACTCGCAGAAAAAAGAAGaTCTCACCAAAACAAGGAATTCAATAGATGT
CAGCTGGTGGTCTGAAAAGGAGATTGCTTTGGCATCTGGGAGGGGTGATG
TAACGATTGCTTCGACTGACAGCTTGAAGAATTTACTTGGAGAGTCGAGT
GAGAAATTTGATCCATGGCCGTCACTCAGCCAAGTGGTGGATGGAAGCAT
TCTTGTGCTCGAGTGTGAGAAACGAGTGAACGATCCAAACAACAAAACGA
AGACATCTTGGAAATGGACTTCAGAAGAAGATGAAAGCCAAGATGAAGTG
AACTCGATTCGTTATCGATTCAAAGAACTCACTAAACAGATGTTATATTT
CATCACTGAGGCTGAAAGGTTTTTACCAGCTGTCAAGCCTCCAAGAATTT
TAACCAACGTTTATCGTTTACTATGCTTGAAATCTACAACACCCGAAGAA
TTATACACGCGGAAAATCAATCTTGAACATTACGGAGAGGCCTTGGACCT
AGCTAAACGTTTTGGTTTGAATACTGATTTAGTTTATCAGCGACAGTGGA
AAAAGAAAAGAGTTTCGAAGATTACCATTCATGATTATCtgtcCAAGATT
AAAGATCGATATTGGGTTTTGGACGAGTGCCTTTTACGAGTTGCCGATGA
CTTTGACTCGACAGAAGAGTTACTGAAATACGGTTTACTCGGTACAAGTT
GGGAAATCTTGCAAAGGATTGATGAAGAGGGTAAAGGTGatgcaaaggat
gatgggaAGTTATTACCTTTTAAATTTGACGCCGCCCCACATGACGAGGA
TGACGAAAACTCAAGTAGAGAATTCCAAgggagTCTAACGAAGAAGCAAT
TGAAAATCTGCCAATATCGACGGCAATTATTACATTATCTTGATCGGCTT
TCCACTTATGAGGTTGTTTTGGGAGGCTCATTCAAAGCACGAGATAAATT
CTCAAAAGAGTATTTTACCAAATTTCGATCGTGCAATATGGTACACCAAG
CGGTCGAGTGTGCCCGCGACGAGGACGCTTATACTCTGGAGCATTTGTTT
TCGTACCATGGGAAGCAGTTACTACCTTATTGGCTGCCGATATTATCAAA
CTTCCCGGAAACAACCGATATCCGATATTTTGAGCCGGTCATCCCTGAGA
TTGGAGAGCCACCAGAAGATCCAGAGATTTTACCTTGGTTAGAGAAACAC
CATCGTGAAGAGGATTGGGTCGAGCAATCGAATATTGTCCAACAAATCAA
GTCTAATGAAGAAGGTGACGCAAACGAAGATATAGGCTCATTCATTTTCG
AATCCGATCCAGAGATacgaaaattttacaaatgtGAAACAAAAGCTCAA
CTGAGAGAATGGTTTTTACATCGTGTACACTTGATTGATGAATATTCCGG
TCAGATTGATAAATGTTGCGAGCTGTTAGATGTGGGAATCAAAAGAGGCT
TGGAAGGGCTCACTAAGGTTCACCAAGAAATGGAAGCATGGAGACTCTTA
GTTTACGACGTTGGAATTGACAGTAAAATGACTGCAAAGAGTTTCGTGGA
ATTATCTGAATCATCGAAAATCAAATTGCTAATGTTCAAAACCTCAGATG
TGACATTCGTTAACGATTTCAAGCTATATCTAATGCCGTATTTAAGAAAT
ATTGGAAAGAAGGATTTTAAGAAACGCCAAGATTTACTTCATGAGTTTTT
GGTGGAAATCGCTAAAACTGATTTGACATGCTGCTTGAAGTTATTGGAAA
AGTGTTCGCCAGAGCTGCCAGAACCACTGCTTCCTGATATGGCGGAGATA
ATGAAGATTGGGATTGATTGCGTTTACGCGTGCAAGAGAACGGATCAATT
GAATCATTGTTTCAGCATTGTCGAATGTTTGCCTTCGAGAGAAGAGGGAG
TCATTAGCCGTCCCGTGGAAGAGCTTCACATACAACTGGATCAATTGGAA
CATTTGCTGACAGGAGCGGAAATTTTACAGTATTACAACAACCCTCAGAC
CATCTCTTACATTTCTGAAATTAAAGATGACTCTACTATTTGTAAACAAC
TCATTCAGCAATTGGTGAAAAACGCTGTTTGTAAAGGACGTTGTGTTCCA
AAGGAATTGAACAAATTACTCGGACATTTGATCAAGCTTTCCAAAGAAGT
TTTCCGGTGCTGTGATATCAAGATCGTTCACCAGATTTTCGTTGAAGAAT
TACTACGGTCCGGTTCACGTGAGAACATAACAGTAGCTGAAGAGTTGATC
ACGCCTTCCAAACTTGCCGGGAATTCACCTCAAAGTAAGAAACCAGAACA
ACATTTGACGTCTGCACTCTACCTCCTCAAATATGATGTTTCGGTTACCG
TTGTGTTGGAAGCGAGTCGTGAATATTTCAATGCAGCAATGTCGGGTAAT
GACTCTTCAATGGAACTGGCTAGATTGTGTCTAACATTGGTCAAAGATTG
TCCAGAGAGTGTTCAAGATGAATTGGATTTGATCAACTCGTTGGGTTTAT
TGTATGAATTCAATGTATCCATGCTACCCTTACAAGTTCGCCTTTGCGCT
GATAAATTGGAAATTATCGATCTTTGTTTGAAGGAGAAGAAGAATGGGTA
CAAGAAAAAAGACAAGCTCATCCAATTGAGTAATCTTTTGCAAATCTGTG
GCCATGACAACAAAGAACGGATTGGACAAGTCAATATTAAAATTGCTGAA
TCAGCATTTGAACATAAAGATTACACATACGCTGGTATCGTTTGTGTACA
ATTGGTGGATGATAATTATTCTAATGCTTGGTATATTTGCAGGAAACTTG
GTGAATGTGCTAAATATACCAACTTCACAATCAGGCAAAAGTTGTTGAGT
TTTGCGTTAACTTATTGTCCAGTACATCACATTGAAGAAGTTTTACAAGA
GAAAACTCAACTGGAAACCCAGGTTTTGTACGAGAGGTTGGGTGTATTTA
CGAAAGAAGGCAAGAAAGACAAAATTGTGACCTCATCTAAGAAAGAAACT
GAGGAAGAAAACGACGAAGACAATGTTGATGGGAATAACATATCAATCCT
CAACAAGACCAAAACTACAACAAAGAAATTGATTTCAAGCGTCGCCAGCG
TGGCTGATAACCGCTGGGTTGGATCCGCAATGAATTGGGTCAAACCGTCG
TCGGAAGGGTCTGGTAACGAAGTTGATGTTGTTGAGCGGGAAATTGAAAG
CGTTCGGCATAACCCATTTTATAGTTCGCTGGATTCGAAAAAGATTGACG
AAGATGTTCAAAGATTTAATTATAACGAGTTCAGCGACCATTTGAGGTGC
GTCACAACCGAAGAAAAAGTATTCAATCAGCTGGTGTTAAGAAGTCAAAA
ATTGAACGAGCAAAGAACCCTGGGTAAAGAGCTCGAAAACACTGACCAAG
CAATGCTATCGTTGAGTGATATAGCTTATACTGAAGAAAGTTGTTTGTGT
CTGGCTTACATGATGGCTATTTCTCAGCCAAAAGAAATCCATTCCCTATC
GACCAAGCATCGGAAAAACACTTTCACTTTCCTTTTCACTGCTTATTACT
ATGCATTACAAGAATAtgttaaaaacaacaaaatcgAATTCGATAAACAA
GCACAGATTTACAGCGCGCCTCCGATTGATGTGATTACATGGATGCTAAA
AGTGTTAGGTAAGAAGCAAGgagaaaaggaagaaaaagaaaaaggagagA
CTTACTTTCTGTCTAACATGAACAAGTTGCAAGACTTGATGCAAGCAAAG
ATGCTACAAGCTCTTGACAAAGgaGTGGACATCGAAAGATTTTCAGTTGA
TAATGAATATAAACGTGAAACTATACTCGGATTAGCTATGAGTGTCGAAG
ACGAGTTGATTAACACAAGTTTGCTGCTAGCAGAGAAATATGATATCCCC
GCATGGGAAGTGTTGTTATCACACGTGGAATTTTTATTCACTGATAGTGG
TCTAAAAGCCAAAGCTATCCGCGAATCACTAAACAAATGGAAAGTTGATT
CCCATTTGAAACCGAACGGTGATAAAGTCTTTGAGCGGATGAAGAAATAT
GTTTACCCAGAAATCAATGGTAAAGACCACAATGCATTGCTGTTGTTCTA
CGTTTTCCTAATGAATTGCAGCTCGCCCACTAAAATATTGGAGGGTACGC
TTACATTAGATGCTCATTCcaaacttttgaagaaaatcaaGGCTGCTGCA
TCATCCATCAATTACAAACTTCTCGTGCATGGAGATTCACCTTTGGAGGT
GATTAGAGACTGTGTTGATGATAACAATGTACATTTGTTGGCTAAAATTG
CATCCAAAATCCCCCAGGCGGATGGTAGTTACCTGTCATCAAACAAGATC
TTCTTAGCAAACGCCATTCGGatgttttggaagaaaaaagaGAACAAGGA
TTGGTTGAATACATTCGAAAACTGTAAACAACACTTCACCAAACTCCTGA
TAGAAGACGTTGTCACTTTTGCTGACCATGCAATTTTTGGCGAGGAAGCT
TTAGACTCGCTGACCCAAGACACCAGACTGGAGATTGGTAAAAGAGtaat
aaaatatttgagacaacaACGTGGTCAAGACGAGACCAAACAAAGAGGAG
CTGACGATTATGATTCGCTTATGGAGCGCTACGATTCATCTATCAATGAT
TTGGAACTTTCCATCGAACATCTCAAAACGCTGACTGATCCAATTTTCAA
AGCAGTCTTTGGTGACGATAACGAACTGAGCAAAACCTTTGGACGAGTAT
ACGACTTATCACGTGGTCGAAAACAACCACTCGAAAAACTATTCCGTGAT
TTGTTCATATCGNTACAACCATTAGACAAAATTTCGAAACTGCGGAGTCT
TTGTCGCAATGCATCTATTGACGTCCGCACGTGTTTCCAAGATGCTTTGC
GCGGGATCCTGAGTGACATCCAAAGCGATAGAGATTACACAAAACTACAG
ACTTTAACGGAGAACATCAAAGCGCATCAAGAACATCAAACAGACCCTCT
TGTTACCCATAGCGACGTCTTAGATGTGGTGCGGCCATTTTGTTCTGATG
TTACAGCTAGCACGGATGTGAAGAGTCACGTGTTACATNTTTTGTTCTGA
atggaaGAAAATGAGCAAATATTGTATGATTTGATTGTTCACGAAGAATG
GAAACAAGAACCACAGTTGTTGGACCAAGTTGAAAGTTATTTTTGGCAAT
ATCGTGGTTCACTTCTAAAGAAGCTATGGAAAGTTTCACAAAGTTCTGCA
ATTTATATGTGGGACAACTTGAAGACACAATTCAGATATCAAGCTACCTT
TGGTTGCCCACCATTGAATTTTATCAATCTGATGAACAATTGCTTGCCAT
GGCTTATGGCTTTGTCACCGGATGGAAATTTTATTGCCATCCTTCAAGAT
TCTGTTATTGAAATAAGGACTGCTGGAAATTTTGAGCAAGTCATTACAAA
ATATAAGATTGAAAAAGATATGTTTCCAAGATGGCGTAAATTGATTTGGA
ATCATGACAACACCTTACTTTGTTATTCAAACAGTTTTGGAGATTTGACC
ATTTTGGATATTACCGGCactaaaaaacattttattccaTCATCAAATAA
TGTCAAGTTAAAAGTGCCTGGAACGCTGAGTTTGGCATTGTGTCATGTTG
AATTTGTAGCCAAAGGAAATagCTTCTTGTTATATACCTGCACCTATCAA
GGATTTTTTACAGTTTATGAAGTGAATGAATCCTCCTGCACAATAAAATG
GGACTACTCTTTCATAACATTCCATCCATATGGATTAGCTGGTTTGGTTA
TTGATCATAAAAATGGGTTATTGGTTGCAGCTGGGAATTATGGGAAGGAA
CCATTTCCTAATGTCATGGGAGATGCATGTTATGGATCATATTCTGGTAT
CAGTCTCTGGAGATTTTTGAATGACACACCTCATCTAACTCTGGTTGAAG
ACCAGGGAAAAGCTTTGAAGAAGGTATCCAGAGGTGAATGGTTAAAGAGT
GTTGTTTTAAGACGTGGCGATGAAAAAAACGAAATGTTGAAGCATGGTAT
TTACAAGTTGAAATTGTCAGAAGATGGTACACAAATTGTCACACTGCATC
TTGATGGTCGCATATCTTTTTGGAGTATCCCGTCAATGAGGCTAATCAAA
ACTTGGAGTAAATCTGAACAACCTGATGCAAGTGGCGGCTCAAGTGAAGG
GTTCTCCTTTGACTCGCAGAAAAAAGAAGaTCTCACCAAAACAAGGAATT
CAATAGATGTCAGCTGGTGGTCTGAAAAGGAGATTGCTTTGGCATCTGGG
AGGGGTGATGTAACGATTGCTTCGACTGACAGCTTGAAGAATTTACTTGG
AGAGTCGAGTGAGAAATTTGATCCATGGCCGTCACTCAGCCAAGTGGTGG
ATGGAAGCATTCTTGTGCTCGAGTGTGAGAAACGAGTGAACGATCCAAAC
AACAAAACGAAGACATCTTGGAAATGGACTTCAGAAGAAGATGAAAGCCA
AGATGAAGTGAACTCGATTCGTTATCGATTCAAAGAACTCACTAAACAGA
TGTTATATTTCATCACTGAGGCTGAAAGGTTTTTACCAGCTGTCAAGCCT
CCAAGAATTTTAACCAACGTTTATCGTTTACTATGCTTGAAATCTACAAC
ACCCGAAGAATTATACACGCGGAAAATCAATCTTGAACATTACGGAGAGG
CCTTGGACCTAGCTAAACGTTTTGGTTTGAATACTGATTTAGTTTATCAG
CGACAGTGGAAAAAGAAAAGAGTTTCGAAGATTACCATTCATGATTATCt
gtcCAAGATTAAAGATCGATATTGGGTTTTGGACGAGTGCCTTTTACGAG
TTGCCGATGACTTTGACTCGACAGAAGAGTTACTGAAATACGGTTTACTC
GGTACAAGTTGGGAAATCTTGCAAAGGATTGATGAAGAGGGTAAAGGTGa
tgcaaaggatgatgggaAGTTATTACCTTTTAAATTTGACGCCGCCCCAC
ATGACGAGGATGACGAAAACTCAAGTAGAGAATTCCAAgggagTCTAACG
AAGAAGCAATTGAAAATCTGCCAATATCGACGGCAATTATTACATTATCT
TGATCGGCTTTCCACTTATGAGGTTGTTTTGGGAGGCTCATTCAAAGCAC
GAGATAAATTCTCAAAAGAGTATTTTACCAAATTTCGATCGTGCAATATG
GTACACCAAGCGGTCGAGTGTGCCCGCGACGAGGACGCTTATACTCTGGA
GCATTTGTTTTCGTACCATGGGAAGCAGTTACTACCTTATTGGCTGCCGA
TATTATCAAACTTCCCGGAAACAACCGATATCCGATATTTTGAGCCGGTC
ATCCCTGAGATTGGAGAGCCACCAGAAGATCCAGAGATTTTACCTTGGTT
AGAGAAACACCATCGTGAAGAGGATTGGGTCGAGCAATCGAATATTGTCC
AACAAATCAAGTCTAATGAAGAAGGTGACGCAAACGAAGATATAGGCTCA
TTCATTTTCGAATCCGATCCAGAGATacgaaaattttacaaatgtGAAAC
AAAAGCTCAACTGAGAGAATGGTTTTTACATCGTGTACACTTGATTGATG
AATATTCCGGTCAGATTGATAAATGTTGCGAGCTGTTAGATGTGGGAATC
AAAAGAGGCTTGGAAGGGCTCACTAAGGTTCACCAAGAAATGGAAGCATG
GAGACTCTTAGTTTACGACGTTGGAATTGACAGTAAAATGACTGCAAAGA
GTTTCGTGGAATTATCTGAATCATCGAAAATCAAATTGCTAATGTTCAAA
ACCTCAGATGTGACATTCGTTAACGATTTCAAGCTATATCTAATGCCGTA
TTTAAGAAATATTGGAAAGAAGGATTTTAAGAAACGCCAAGATTTACTTC
ATGAGTTTTTGGTGGAAATCGCTAAAACTGATTTGACATGCTGCTTGAAG
TTATTGGAAAAGTGTTCGCCAGAGCTGCCAGAACCACTGCTTCCTGATAT
GGCGGAGATAATGAAGATTGGGATTGATTGCGTTTACGCGTGCAAGAGAA
CGGATCAATTGAATCATTGTTTCAGCATTGTCGAATGTTTGCCTTCGAGA
GAAGAGGGAGTCATTAGCCGTCCCGTGGAAGAGCTTCACATACAACTGGA
TCAATTGGAACATTTGCTGACAGGAGCGGAAATTTTACAGTATTACAACA
ACCCTCAGACCATCTCTTACATTTCTGAAATTAAAGATGACTCTACTATT
TGTAAACAACTCATTCAGCAATTGGTGAAAAACGCTGTTTGTAAAGGACG
TTGTGTTCCAAAGGAATTGAACAAATTACTCGGACATTTGATCAAGCTTT
CCAAAGAAGTTTTCCGGTGCTGTGATATCAAGATCGTTCACCAGATTTTC
GTTGAAGAATTACTACGGTCCGGTTCACGTGAGAACATAACAGTAGCTGA
AGAGTTGATCACGCCTTCCAAACTTGCCGGGAATTCACCTCAAAGTAAGA
AACCAGAACAACATTTGACGTCTGCACTCTACCTCCTCAAATATGATGTT
TCGGTTACCGTTGTGTTGGAAGCGAGTCGTGAATATTTCAATGCAGCAAT
GTCGGGTAATGACTCTTCAATGGAACTGGCTAGATTGTGTCTAACATTGG
TCAAAGATTGTCCAGAGAGTGTTCAAGATGAATTGGATTTGATCAACTCG
TTGGGTTTATTGTATGAATTCAATGTATCCATGCTACCCTTACAAGTTCG
CCTTTGCGCTGATAAATTGGAAATTATCGATCTTTGTTTGAAGGAGAAGA
AGAATGGGTACAAGAAAAAAGACAAGCTCATCCAATTGAGTAATCTTTTG
CAAATCTGTGGCCATGACAACAAAGAACGGATTGGACAAGTCAATATTAA
AATTGCTGAATCAGCATTTGAACATAAAGATTACACATACGCTGGTATCG
TTTGTGTACAATTGGTGGATGATAATTATTCTAATGCTTGGTATATTTGC
AGGAAACTTGGTGAATGTGCTAAATATACCAACTTCACAATCAGGCAAAA
GTTGTTGAGTTTTGCGTTAACTTATTGTCCAGTACATCACATTGAAGAAG
TTTTACAAGAGAAAACTCAACTGGAAACCCAGGTTTTGTACGAGAGGTTG
GGTGTATTTACGAAAGAAGGCAAGAAAGACAAAATTGTGACCTCATCTAA
GAAAGAAACTGAGGAAGAAAACGACGAAGACAATGTTGATGGGAATAACA
TATCAATCCTCAACAAGACCAAAACTACAACAAAGAAATTGATTTCAAGC
GTCGCCAGCGTGGCTGATAACCGCTGGGTTGGATCCGCAATGAATTGGGT
CAAACCGTCGTCGGAAGGGTCTGGTAACGAAGTTGATGTTGTTGAGCGGG
AAATTGAAAGCGTTCGGCATAACCCATTTTATAGTTCGCTGGATTCGAAA
AAGATTGACGAAGATGTTCAAAGATTTAATTATAACGAGTTCAGCGACCA
TTTGAGGTGCGTCACAACCGAAGAAAAAGTATTCAATCAGCTGGTGTTAA
GAAGTCAAAAATTGAACGAGCAAAGAACCCTGGGTAAAGAGCTCGAAAAC
ACTGACCAAGCAATGCTATCGTTGAGTGATATAGCTTATACTGAAGAAAG
TTGTTTGTGTCTGGCTTACATGATGGCTATTTCTCAGCCAAAAGAAATCC
ATTCCCTATCGACCAAGCATCGGAAAAACACTTTCACTTTCCTTTTCACT
GCTTATTACTATGCATTACAAGAATAtgttaaaaacaacaaaatcgAATT
CGATAAACAAGCACAGATTTACAGCGCGCCTCCGATTGATGTGATTACAT
GGATGCTAAAAGTGTTAGGTAAGAAGCAAGgagaaaaggaagaaaaagaa
aaaggagagACTTACTTTCTGTCTAACATGAACAAGTTGCAAGACTTGAT
GCAAGCAAAGATGCTACAAGCTCTTGACAAAGgaGTGGACATCGAAAGAT
TTTCAGTTGATAATGAATATAAACGTGAAACTATACTCGGATTAGCTATG
AGTGTCGAAGACGAGTTGATTAACACAAGTTTGCTGCTAGCAGAGAAATA
TGATATCCCCGCATGGGAAGTGTTGTTATCACACGTGGAATTTTTATTCA
CTGATAGTGGTCTAAAAGCCAAAGCTATCCGCGAATCACTAAACAAATGG
AAAGTTGATTCCCATTTGAAACCGAACGGTGATAAAGTCTTTGAGCGGAT
GAAGAAATATGTTTACCCAGAAATCAATGGTAAAGACCACAATGCATTGC
TGTTGTTCTACGTTTTCCTAATGAATTGCAGCTCGCCCACTAAAATATTG
GAGGGTACGCTTACATTAGATGCTCATTCcaaacttttgaagaaaatcaa
GGCTGCTGCATCATCCATCAATTACAAACTTCTCGTGCATGGAGATTCAC
CTTTGGAGGTGATTAGAGACTGTGTTGATGATAACAATGTACATTTGTTG
GCTAAAATTGCATCCAAAATCCCCCAGGCGGATGGTAGTTACCTGTCATC
AAACAAGATCTTCTTAGCAAACGCCATTCGGatgttttggaagaaaaaag
aGAACAAGGATTGGTTGAATACATTCGAAAACTGTAAACAACACTTCACC
AAACTCCTGATAGAAGACGTTGTCACTTTTGCTGACCATGCAATTTTTGG
CGAGGAAGCTTTAGACTCGCTGACCCAAGACACCAGACTGGAGATTGGTA
AAAGAGtaataaaatatttgagacaacaACGTGGTCAAGACGAGACCAAA
CAAAGAGGAGCTGACGATTATGATTCGCTTATGGAGCGCTACGATTCATC
TATCAATGATTTGGAACTTTCCATCGAACATCTCAAAACGCTGACTGATC
CAATTTTCAAAGCAGTCTTTGGTGACGATAACGAACTGAGCAAAACCTTT
GGACGAGTATACGACTTATCACGTGGTCGAAAACAACCACTCGAAAAACT
ATTCCGTGATTTGTTCATATCGNTACAACCATTAGACAAAATTTCGAAAC
TGCGGAGTCTTTGTCGCAATGCATCTATTGACGTCCGCACGTGTTTCCAA
GATGCTTTGCGCGGGATCCTGAGTGACATCCAAAGCGATAGAGATTACAC
AAAACTACAGACTTTAACGGAGAACATCAAAGCGCATCAAGAACATCAAA
CAGACCCTCTTGTTACCCATAGCGACGTCTTAGATGTGGTGCGGCCATTT
TGTTCTGATGTTACAGCTAGCACGGATGTGAAGAGTCACGTGTTACATNT
TTTGTTCTGAatggaaGAAAATGAGCAAATATTGTATGATTTGATTGTTC
ACGAAGAATGGAAACAAGAACCACAGTTGTTGGACCAAGTTGAAAGTTAT
TTTTGGCAATATCGTGGTTCACTTCTAAAGAAGCTATGGAAAGTTTCACA
AAGTTCTGCAATTTATATGTGGGACAACTTGAAGACACAATTCAGATATC
AAGCTACCTTTGGTTGCCCACCATTGAATTTTATCAATCTGATGAACAAT
TGCTTGCCATGGCTTATGGCTTTGTCACCGGATGGAAATTTTATTGCCAT
CCTTCAAGATTCTGTTATTGAAATAAGGACTGCTGGAAATTTTGAGCAAG
TCATTACAAAATATAAGATTGAAAAAGATATGTTTCCAAGATGGCGTAAA
TTGATTTGGAATCATGACAACACCTTACTTTGTTATTCAAACAGTTTTGG
AGATTTGACCATTTTGGATATTACCGGCactaaaaaacattttattccaT
CATCAAATAATGTCAAGTTAAAAGTGCCTGGAACGCTGAGTTTGGCATTG
TGTCATGTTGAATTTGTAGCCAAAGGAAATagCTTCTTGTTATATACCTG
CACCTATCAAGGATTTTTTACAGTTTATGAAGTGAATGAATCCTCCTGCA
CAATAAAATGGGACTACTCTTTCATAACATTCCATCCATATGGATTAGCT
GGTTTGGTTATTGATCATAAAAATGGGTTATTGGTTGCAGCTGGGAATTA
TGGGAAGGAACCATTTCCTAATGTCATGGGAGATGCATGTTATGGATCAT
ATTCTGGTATCAGTCTCTGGAGATTTTTGAATGACACACCTCATCTAACT
CTGGTTGAAGACCAGGGAAAAGCTTTGAAGAAGGTATCCAGAGGTGAATG
GTTAAAGAGTGTTGTTTTAAGACGTGGCGATGAAAAAAACGAAATGTTGA
AGCATGGTATTTACAAGTTGAAATTGTCAGAAGATGGTACACAAATTGTC
ACACTGCATCTTGATGGTCGCATATCTTTTTGGAGTATCCCGTCAATGAG
GCTAATCAAAACTTGGAGTAAATCTGAACAACCTGATGCAAGTGGCGGCT
CAAGTGAAGGGTTCTCCTTTGACTCGCAGAAAAAAGAAGaTCTCACCAAA
ACAAGGAATTCAATAGATGTCAGCTGGTGGTCTGAAAAGGAGATTGCTTT
GGCATCTGGGAGGGGTGATGTAACGATTGCTTCGACTGACAGCTTGAAGA
ATTTACTTGGAGAGTCGAGTGAGAAATTTGATCCATGGCCGTCACTCAGC
CAAGTGGTGGATGGAAGCATTCTTGTGCTCGAGTGTGAGAAACGAGTGAA
CGATCCAAACAACAAAACGAAGACATCTTGGAAATGGACTTCAGAAGAAG
ATGAAAGCCAAGATGAAGTGAACTCGATTCGTTATCGATTCAAAGAACTC
ACTAAACAGATGTTATATTTCATCACTGAGGCTGAAAGGTTTTTACCAGC
TGTCAAGCCTCCAAGAATTTTAACCAACGTTTATCGTTTACTATGCTTGA
AATCTACAACACCCGAAGAATTATACACGCGGAAAATCAATCTTGAACAT
TACGGAGAGGCCTTGGACCTAGCTAAACGTTTTGGTTTGAATACTGATTT
AGTTTATCAGCGACAGTGGAAAAAGAAAAGAGTTTCGAAGATTACCATTC
ATGATTATCtgtcCAAGATTAAAGATCGATATTGGGTTTTGGACGAGTGC
CTTTTACGAGTTGCCGATGACTTTGACTCGACAGAAGAGTTACTGAAATA
CGGTTTACTCGGTACAAGTTGGGAAATCTTGCAAAGGATTGATGAAGAGG
GTAAAGGTGatgcaaaggatgatgggaAGTTATTACCTTTTAAATTTGAC
GCCGCCCCACATGACGAGGATGACGAAAACTCAAGTAGAGAATTCCAAgg
gagTCTAACGAAGAAGCAATTGAAAATCTGCCAATATCGACGGCAATTAT
TACATTATCTTGATCGGCTTTCCACTTATGAGGTTGTTTTGGGAGGCTCA
TTCAAAGCACGAGATAAATTCTCAAAAGAGTATTTTACCAAATTTCGATC
GTGCAATATGGTACACCAAGCGGTCGAGTGTGCCCGCGACGAGGACGCTT
ATACTCTGGAGCATTTGTTTTCGTACCATGGGAAGCAGTTACTACCTTAT
TGGCTGCCGATATTATCAAACTTCCCGGAAACAACCGATATCCGATATTT
TGAGCCGGTCATCCCTGAGATTGGAGAGCCACCAGAAGATCCAGAGATTT
TACCTTGGTTAGAGAAACACCATCGTGAAGAGGATTGGGTCGAGCAATCG
AATATTGTCCAACAAATCAAGTCTAATGAAGAAGGTGACGCAAACGAAGA
TATAGGCTCATTCATTTTCGAATCCGATCCAGAGATacgaaaattttaca
aatgtGAAACAAAAGCTCAACTGAGAGAATGGTTTTTACATCGTGTACAC
TTGATTGATGAATATTCCGGTCAGATTGATAAATGTTGCGAGCTGTTAGA
TGTGGGAATCAAAAGAGGCTTGGAAGGGCTCACTAAGGTTCACCAAGAAA
TGGAAGCATGGAGACTCTTAGTTTACGACGTTGGAATTGACAGTAAAATG
ACTGCAAAGAGTTTCGTGGAATTATCTGAATCATCGAAAATCAAATTGCT
AATGTTCAAAACCTCAGATGTGACATTCGTTAACGATTTCAAGCTATATC
TAATGCCGTATTTAAGAAATATTGGAAAGAAGGATTTTAAGAAACGCCAA
GATTTACTTCATGAGTTTTTGGTGGAAATCGCTAAAACTGATTTGACATG
CTGCTTGAAGTTATTGGAAAAGTGTTCGCCAGAGCTGCCAGAACCACTGC
TTCCTGATATGGCGGAGATAATGAAGATTGGGATTGATTGCGTTTACGCG
TGCAAGAGAACGGATCAATTGAATCATTGTTTCAGCATTGTCGAATGTTT
GCCTTCGAGAGAAGAGGGAGTCATTAGCCGTCCCGTGGAAGAGCTTCACA
TACAACTGGATCAATTGGAACATTTGCTGACAGGAGCGGAAATTTTACAG
TATTACAACAACCCTCAGACCATCTCTTACATTTCTGAAATTAAAGATGA
CTCTACTATTTGTAAACAACTCATTCAGCAATTGGTGAAAAACGCTGTTT
GTAAAGGACGTTGTGTTCCAAAGGAATTGAACAAATTACTCGGACATTTG
ATCAAGCTTTCCAAAGAAGTTTTCCGGTGCTGTGATATCAAGATCGTTCA
CCAGATTTTCGTTGAAGAATTACTACGGTCCGGTTCACGTGAGAACATAA
CAGTAGCTGAAGAGTTGATCACGCCTTCCAAACTTGCCGGGAATTCACCT
CAAAGTAAGAAACCAGAACAACATTTGACGTCTGCACTCTACCTCCTCAA
ATATGATGTTTCGGTTACCGTTGTGTTGGAAGCGAGTCGTGAATATTTCA
ATGCAGCAATGTCGGGTAATGACTCTTCAATGGAACTGGCTAGATTGTGT
CTAACATTGGTCAAAGATTGTCCAGAGAGTGTTCAAGATGAATTGGATTT
GATCAACTCGTTGGGTTTATTGTATGAATTCAATGTATCCATGCTACCCT
TACAAGTTCGCCTTTGCGCTGATAAATTGGAAATTATCGATCTTTGTTTG
AAGGAGAAGAAGAATGGGTACAAGAAAAAAGACAAGCTCATCCAATTGAG
TAATCTTTTGCAAATCTGTGGCCATGACAACAAAGAACGGATTGGACAAG
TCAATATTAAAATTGCTGAATCAGCATTTGAACATAAAGATTACACATAC
GCTGGTATCGTTTGTGTACAATTGGTGGATGATAATTATTCTAATGCTTG
GTATATTTGCAGGAAACTTGGTGAATGTGCTAAATATACCAACTTCACAA
TCAGGCAAAAGTTGTTGAGTTTTGCGTTAACTTATTGTCCAGTACATCAC
ATTGAAGAAGTTTTACAAGAGAAAACTCAACTGGAAACCCAGGTTTTGTA
CGAGAGGTTGGGTGTATTTACGAAAGAAGGCAAGAAAGACAAAATTGTGA
CCTCATCTAAGAAAGAAACTGAGGAAGAAAACGACGAAGACAATGTTGAT
GGGAATAACATATCAATCCTCAACAAGACCAAAACTACAACAAAGAAATT
GATTTCAAGCGTCGCCAGCGTGGCTGATAACCGCTGGGTTGGATCCGCAA
TGAATTGGGTCAAACCGTCGTCGGAAGGGTCTGGTAACGAAGTTGATGTT
GTTGAGCGGGAAATTGAAAGCGTTCGGCATAACCCATTTTATAGTTCGCT
GGATTCGAAAAAGATTGACGAAGATGTTCAAAGATTTAATTATAACGAGT
TCAGCGACCATTTGAGGTGCGTCACAACCGAAGAAAAAGTATTCAATCAG
CTGGTGTTAAGAAGTCAAAAATTGAACGAGCAAAGAACCCTGGGTAAAGA
GCTCGAAAACACTGACCAAGCAATGCTATCGTTGAGTGATATAGCTTATA
CTGAAGAAAGTTGTTTGTGTCTGGCTTACATGATGGCTATTTCTCAGCCA
AAAGAAATCCATTCCCTATCGACCAAGCATCGGAAAAACACTTTCACTTT
CCTTTTCACTGCTTATTACTATGCATTACAAGAATAtgttaaaaacaaca
aaatcgAATTCGATAAACAAGCACAGATTTACAGCGCGCCTCCGATTGAT
GTGATTACATGGATGCTAAAAGTGTTAGGTAAGAAGCAAGgagaaaagga
agaaaaagaaaaaggagagACTTACTTTCTGTCTAACATGAACAAGTTGC
AAGACTTGATGCAAGCAAAGATGCTACAAGCTCTTGACAAAGgaGTGGAC
ATCGAAAGATTTTCAGTTGATAATGAATATAAACGTGAAACTATACTCGG
ATTAGCTATGAGTGTCGAAGACGAGTTGATTAACACAAGTTTGCTGCTAG
CAGAGAAATATGATATCCCCGCATGGGAAGTGTTGTTATCACACGTGGAA
TTTTTATTCACTGATAGTGGTCTAAAAGCCAAAGCTATCCGCGAATCACT
AAACAAATGGAAAGTTGATTCCCATTTGAAACCGAACGGTGATAAAGTCT
TTGAGCGGATGAAGAAATATGTTTACCCAGAAATCAATGGTAAAGACCAC
AATGCATTGCTGTTGTTCTACGTTTTCCTAATGAATTGCAGCTCGCCCAC
TAAAATATTGGAGGGTACGCTTACATTAGATGCTCATTCcaaacttttga
agaaaatcaaGGCTGCTGCATCATCCATCAATTACAAACTTCTCGTGCAT
GGAGATTCACCTTTGGAGGTGATTAGAGACTGTGTTGATGATAACAATGT
ACATTTGTTGGCTAAAATTGCATCCAAAATCCCCCAGGCGGATGGTAGTT
ACCTGTCATCAAACAAGATCTTCTTAGCAAACGCCATTCGGatgttttgg
aagaaaaaagaGAACAAGGATTGGTTGAATACATTCGAAAACTGTAAACA
ACACTTCACCAAACTCCTGATAGAAGACGTTGTCACTTTTGCTGACCATG
CAATTTTTGGCGAGGAAGCTTTAGACTCGCTGACCCAAGACACCAGACTG
GAGATTGGTAAAAGAGtaataaaatatttgagacaacaACGTGGTCAAGA
CGAGACCAAACAAAGAGGAGCTGACGATTATGATTCGCTTATGGAGCGCT
ACGATTCATCTATCAATGATTTGGAACTTTCCATCGAACATCTCAAAACG
CTGACTGATCCAATTTTCAAAGCAGTCTTTGGTGACGATAACGAACTGAG
CAAAACCTTTGGACGAGTATACGACTTATCACGTGGTCGAAAACAACCAC
TCGAAAAACTATTCCGTGATTTGTTCATATCGNTACAACCATTAGACAAA
ATTTCGAAACTGCGGAGTCTTTGTCGCAATGCATCTATTGACGTCCGCAC
GTGTTTCCAAGATGCTTTGCGCGGGATCCTGAGTGACATCCAAAGCGATA
GAGATTACACAAAACTACAGACTTTAACGGAGAACATCAAAGCGCATCAA
GAACATCAAACAGACCCTCTTGTTACCCATAGCGACGTCTTAGATGTGGT
GCGGCCATTTTGTTCTGATGTTACAGCTAGCACGGATGTGAAGAGTCACG
TGTTACATNTTTTGTTCTGAatggaaGAAAATGAGCAAATATTGTATGAT
TTGATTGTTCACGAAGAATGGAAACAAGAACCACAGTTGTTGGACCAAGT
TGAAAGTTATTTTTGGCAATATCGTGGTTCACTTCTAAAGAAGCTATGGA
AAGTTTCACAAAGTTCTGCAATTTATATGTGGGACAACTTGAAGACACAA
TTCAGATATCAAGCTACCTTTGGTTGCCCACCATTGAATTTTATCAATCT
GATGAACAATTGCTTGCCATGGCTTATGGCTTTGTCACCGGATGGAAATT
TTATTGCCATCCTTCAAGATTCTGTTATTGAAATAAGGACTGCTGGAAAT
TTTGAGCAAGTCATTACAAAATATAAGATTGAAAAAGATATGTTTCCAAG
ATGGCGTAAATTGATTTGGAATCATGACAACACCTTACTTTGTTATTCAA
ACAGTTTTGGAGATTTGACCATTTTGGATATTACCGGCactaaaaaacat
tttattccaTCATCAAATAATGTCAAGTTAAAAGTGCCTGGAACGCTGAG
TTTGGCATTGTGTCATGTTGAATTTGTAGCCAAAGGAAATagCTTCTTGT
TATATACCTGCACCTATCAAGGATTTTTTACAGTTTATGAAGTGAATGAA
TCCTCCTGCACAATAAAATGGGACTACTCTTTCATAACATTCCATCCATA
TGGATTAGCTGGTTTGGTTATTGATCATAAAAATGGGTTATTGGTTGCAG
CTGGGAATTATGGGAAGGAACCATTTCCTAATGTCATGGGAGATGCATGT
TATGGATCATATTCTGGTATCAGTCTCTGGAGATTTTTGAATGACACACC
TCATCTAACTCTGGTTGAAGACCAGGGAAAAGCTTTGAAGAAGGTATCCA
GAGGTGAATGGTTAAAGAGTGTTGTTTTAAGACGTGGCGATGAAAAAAAC
GAAATGTTGAAGCATGGTATTTACAAGTTGAAATTGTCAGAAGATGGTAC
ACAAATTGTCACACTGCATCTTGATGGTCGCATATCTTTTTGGAGTATCC
CGTCAATGAGGCTAATCAAAACTTGGAGTAAATCTGAACAACCTGATGCA
AGTGGCGGCTCAAGTGAAGGGTTCTCCTTTGACTCGCAGAAAAAAGAAGa
TCTCACCAAAACAAGGAATTCAATAGATGTCAGCTGGTGGTCTGAAAAGG
AGATTGCTTTGGCATCTGGGAGGGGTGATGTAACGATTGCTTCGACTGAC
AGCTTGAAGAATTTACTTGGAGAGTCGAGTGAGAAATTTGATCCATGGCC
GTCACTCAGCCAAGTGGTGGATGGAAGCATTCTTGTGCTCGAGTGTGAGA
AACGAGTGAACGATCCAAACAACAAAACGAAGACATCTTGGAAATGGACT
TCAGAAGAAGATGAAAGCCAAGATGAAGTGAACTCGATTCGTTATCGATT
CAAAGAACTCACTAAACAGATGTTATATTTCATCACTGAGGCTGAAAGGT
TTTTACCAGCTGTCAAGCCTCCAAGAATTTTAACCAACGTTTATCGTTTA
CTATGCTTGAAATCTACAACACCCGAAGAATTATACACGCGGAAAATCAA
TCTTGAACATTACGGAGAGGCCTTGGACCTAGCTAAACGTTTTGGTTTGA
ATACTGATTTAGTTTATCAGCGACAGTGGAAAAAGAAAAGAGTTTCGAAG
ATTACCATTCATGATTATCtgtcCAAGATTAAAGATCGATATTGGGTTTT
GGACGAGTGCCTTTTACGAGTTGCCGATGACTTTGACTCGACAGAAGAGT
TACTGAAATACGGTTTACTCGGTACAAGTTGGGAAATCTTGCAAAGGATT
GATGAAGAGGGTAAAGGTGatgcaaaggatgatgggaAGTTATTACCTTT
TAAATTTGACGCCGCCCCACATGACGAGGATGACGAAAACTCAAGTAGAG
AATTCCAAgggagTCTAACGAAGAAGCAATTGAAAATCTGCCAATATCGA
CGGCAATTATTACATTATCTTGATCGGCTTTCCACTTATGAGGTTGTTTT
GGGAGGCTCATTCAAAGCACGAGATAAATTCTCAAAAGAGTATTTTACCA
AATTTCGATCGTGCAATATGGTACACCAAGCGGTCGAGTGTGCCCGCGAC
GAGGACGCTTATACTCTGGAGCATTTGTTTTCGTACCATGGGAAGCAGTT
ACTACCTTATTGGCTGCCGATATTATCAAACTTCCCGGAAACAACCGATA
TCCGATATTTTGAGCCGGTCATCCCTGAGATTGGAGAGCCACCAGAAGAT
CCAGAGATTTTACCTTGGTTAGAGAAACACCATCGTGAAGAGGATTGGGT
CGAGCAATCGAATATTGTCCAACAAATCAAGTCTAATGAAGAAGGTGACG
CAAACGAAGATATAGGCTCATTCATTTTCGAATCCGATCCAGAGATacga
aaattttacaaatgtGAAACAAAAGCTCAACTGAGAGAATGGTTTTTACA
TCGTGTACACTTGATTGATGAATATTCCGGTCAGATTGATAAATGTTGCG
AGCTGTTAGATGTGGGAATCAAAAGAGGCTTGGAAGGGCTCACTAAGGTT
CACCAAGAAATGGAAGCATGGAGACTCTTAGTTTACGACGTTGGAATTGA
CAGTAAAATGACTGCAAAGAGTTTCGTGGAATTATCTGAATCATCGAAAA
TCAAATTGCTAATGTTCAAAACCTCAGATGTGACATTCGTTAACGATTTC
AAGCTATATCTAATGCCGTATTTAAGAAATATTGGAAAGAAGGATTTTAA
GAAACGCCAAGATTTACTTCATGAGTTTTTGGTGGAAATCGCTAAAACTG
ATTTGACATGCTGCTTGAAGTTATTGGAAAAGTGTTCGCCAGAGCTGCCA
GAACCACTGCTTCCTGATATGGCGGAGATAATGAAGATTGGGATTGATTG
CGTTTACGCGTGCAAGAGAACGGATCAATTGAATCATTGTTTCAGCATTG
TCGAATGTTTGCCTTCGAGAGAAGAGGGAGTCATTAGCCGTCCCGTGGAA
GAGCTTCACATACAACTGGATCAATTGGAACATTTGCTGACAGGAGCGGA
AATTTTACAGTATTACAACAACCCTCAGACCATCTCTTACATTTCTGAAA
TTAAAGATGACTCTACTATTTGTAAACAACTCATTCAGCAATTGGTGAAA
AACGCTGTTTGTAAAGGACGTTGTGTTCCAAAGGAATTGAACAAATTACT
CGGACATTTGATCAAGCTTTCCAAAGAAGTTTTCCGGTGCTGTGATATCA
AGATCGTTCACCAGATTTTCGTTGAAGAATTACTACGGTCCGGTTCACGT
GAGAACATAACAGTAGCTGAAGAGTTGATCACGCCTTCCAAACTTGCCGG
GAATTCACCTCAAAGTAAGAAACCAGAACAACATTTGACGTCTGCACTCT
ACCTCCTCAAATATGATGTTTCGGTTACCGTTGTGTTGGAAGCGAGTCGT
GAATATTTCAATGCAGCAATGTCGGGTAATGACTCTTCAATGGAACTGGC
TAGATTGTGTCTAACATTGGTCAAAGATTGTCCAGAGAGTGTTCAAGATG
AATTGGATTTGATCAACTCGTTGGGTTTATTGTATGAATTCAATGTATCC
ATGCTACCCTTACAAGTTCGCCTTTGCGCTGATAAATTGGAAATTATCGA
TCTTTGTTTGAAGGAGAAGAAGAATGGGTACAAGAAAAAAGACAAGCTCA
TCCAATTGAGTAATCTTTTGCAAATCTGTGGCCATGACAACAAAGAACGG
ATTGGACAAGTCAATATTAAAATTGCTGAATCAGCATTTGAACATAAAGA
TTACACATACGCTGGTATCGTTTGTGTACAATTGGTGGATGATAATTATT
CTAATGCTTGGTATATTTGCAGGAAACTTGGTGAATGTGCTAAATATACC
AACTTCACAATCAGGCAAAAGTTGTTGAGTTTTGCGTTAACTTATTGTCC
AGTACATCACATTGAAGAAGTTTTACAAGAGAAAACTCAACTGGAAACCC
AGGTTTTGTACGAGAGGTTGGGTGTATTTACGAAAGAAGGCAAGAAAGAC
AAAATTGTGACCTCATCTAAGAAAGAAACTGAGGAAGAAAACGACGAAGA
CAATGTTGATGGGAATAACATATCAATCCTCAACAAGACCAAAACTACAA
CAAAGAAATTGATTTCAAGCGTCGCCAGCGTGGCTGATAACCGCTGGGTT
GGATCCGCAATGAATTGGGTCAAACCGTCGTCGGAAGGGTCTGGTAACGA
AGTTGATGTTGTTGAGCGGGAAATTGAAAGCGTTCGGCATAACCCATTTT
ATAGTTCGCTGGATTCGAAAAAGATTGACGAAGATGTTCAAAGATTTAAT
TATAACGAGTTCAGCGACCATTTGAGGTGCGTCACAACCGAAGAAAAAGT
ATTCAATCAGCTGGTGTTAAGAAGTCAAAAATTGAACGAGCAAAGAACCC
TGGGTAAAGAGCTCGAAAACACTGACCAAGCAATGCTATCGTTGAGTGAT
ATAGCTTATACTGAAGAAAGTTGTTTGTGTCTGGCTTACATGATGGCTAT
TTCTCAGCCAAAAGAAATCCATTCCCTATCGACCAAGCATCGGAAAAACA
CTTTCACTTTCCTTTTCACTGCTTATTACTATGCATTACAAGAATAtgtt
aaaaacaacaaaatcgAATTCGATAAACAAGCACAGATTTACAGCGCGCC
TCCGATTGATGTGATTACATGGATGCTAAAAGTGTTAGGTAAGAAGCAAG
gagaaaaggaagaaaaagaaaaaggagagACTTACTTTCTGTCTAACATG
AACAAGTTGCAAGACTTGATGCAAGCAAAGATGCTACAAGCTCTTGACAA
AGgaGTGGACATCGAAAGATTTTCAGTTGATAATGAATATAAACGTGAAA
CTATACTCGGATTAGCTATGAGTGTCGAAGACGAGTTGATTAACACAAGT
TTGCTGCTAGCAGAGAAATATGATATCCCCGCATGGGAAGTGTTGTTATC
ACACGTGGAATTTTTATTCACTGATAGTGGTCTAAAAGCCAAAGCTATCC
GCGAATCACTAAACAAATGGAAAGTTGATTCCCATTTGAAACCGAACGGT
GATAAAGTCTTTGAGCGGATGAAGAAATATGTTTACCCAGAAATCAATGG
TAAAGACCACAATGCATTGCTGTTGTTCTACGTTTTCCTAATGAATTGCA
GCTCGCCCACTAAAATATTGGAGGGTACGCTTACATTAGATGCTCATTCc
aaacttttgaagaaaatcaaGGCTGCTGCATCATCCATCAATTACAAACT
TCTCGTGCATGGAGATTCACCTTTGGAGGTGATTAGAGACTGTGTTGATG
ATAACAATGTACATTTGTTGGCTAAAATTGCATCCAAAATCCCCCAGGCG
GATGGTAGTTACCTGTCATCAAACAAGATCTTCTTAGCAAACGCCATTCG
GatgttttggaagaaaaaagaGAACAAGGATTGGTTGAATACATTCGAAA
ACTGTAAACAACACTTCACCAAACTCCTGATAGAAGACGTTGTCACTTTT
GCTGACCATGCAATTTTTGGCGAGGAAGCTTTAGACTCGCTGACCCAAGA
CACCAGACTGGAGATTGGTAAAAGAGtaataaaatatttgagacaacaAC
GTGGTCAAGACGAGACCAAACAAAGAGGAGCTGACGATTATGATTCGCTT
ATGGAGCGCTACGATTCATCTATCAATGATTTGGAACTTTCCATCGAACA
TCTCAAAACGCTGACTGATCCAATTTTCAAAGCAGTCTTTGGTGACGATA
ACGAACTGAGCAAAACCTTTGGACGAGTATACGACTTATCACGTGGTCGA
AAACAACCACTCGAAAAACTATTCCGTGATTTGTTCATATCGNTACAACC
ATTAGACAAAATTTCGAAACTGCGGAGTCTTTGTCGCAATGCATCTATTG
ACGTCCGCACGTGTTTCCAAGATGCTTTGCGCGGGATCCTGAGTGACATC
CAAAGCGATAGAGATTACACAAAACTACAGACTTTAACGGAGAACATCAA
AGCGCATCAAGAACATCAAACAGACCCTCTTGTTACCCATAGCGACGTCT
TAGATGTGGTGCGGCCATTTTGTTCTGATGTTACAGCTAGCACGGATGTG
AAGAGTCACGTGTTACATNTTTTGTTCTGAatggaaGAAAATGAGCAAAT
ATTGTATGATTTGATTGTTCACGAAGAATGGAAACAAGAACCACAGTTGT
TGGACCAAGTTGAAAGTTATTTTTGGCAATATCGTGGTTCACTTCTAAAG
AAGCTATGGAAAGTTTCACAAAGTTCTGCAATTTATATGTGGGACAACTT
GAAGACACAATTCAGATATCAAGCTACCTTTGGTTGCCCACCATTGAATT
TTATCAATCTGATGAACAATTGCTTGCCATGGCTTATGGCTTTGTCACCG
GATGGAAATTTTATTGCCATCCTTCAAGATTCTGTTATTGAAATAAGGAC
TGCTGGAAATTTTGAGCAAGTCATTACAAAATATAAGATTGAAAAAGATA
TGTTTCCAAGATGGCGTAAATTGATTTGGAATCATGACAACACCTTACTT
TGTTATTCAAACAGTTTTGGAGATTTGACCATTTTGGATATTACCGGCac
taaaaaacattttattccaTCATCAAATAATGTCAAGTTAAAAGTGCCTG
GAACGCTGAGTTTGGCATTGTGTCATGTTGAATTTGTAGCCAAAGGAAAT
agCTTCTTGTTATATACCTGCACCTATCAAGGATTTTTTACAGTTTATGA
AGTGAATGAATCCTCCTGCACAATAAAATGGGACTACTCTTTCATAACAT
TCCATCCATATGGATTAGCTGGTTTGGTTATTGATCATAAAAATGGGTTA
TTGGTTGCAGCTGGGAATTATGGGAAGGAACCATTTCCTAATGTCATGGG
AGATGCATGTTATGGATCATATTCTGGTATCAGTCTCTGGAGATTTTTGA
ATGACACACCTCATCTAACTCTGGTTGAAGACCAGGGAAAAGCTTTGAAG
AAGGTATCCAGAGGTGAATGGTTAAAGAGTGTTGTTTTAAGACGTGGCGA
TGAAAAAAACGAAATGTTGAAGCATGGTATTTACAAGTTGAAATTGTCAG
AAGATGGTACACAAATTGTCACACTGCATCTTGATGGTCGCATATCTTTT
TGGAGTATCCCGTCAATGAGGCTAATCAAAACTTGGAGTAAATCTGAACA
ACCTGATGCAAGTGGCGGCTCAAGTGAAGGGTTCTCCTTTGACTCGCAGA
AAAAAGAAGaTCTCACCAAAACAAGGAATTCAATAGATGTCAGCTGGTGG
TCTGAAAAGGAGATTGCTTTGGCATCTGGGAGGGGTGATGTAACGATTGC
TTCGACTGACAGCTTGAAGAATTTACTTGGAGAGTCGAGTGAGAAATTTG
ATCCATGGCCGTCACTCAGCCAAGTGGTGGATGGAAGCATTCTTGTGCTC
GAGTGTGAGAAACGAGTGAACGATCCAAACAACAAAACGAAGACATCTTG
GAAATGGACTTCAGAAGAAGATGAAAGCCAAGATGAAGTGAACTCGATTC
GTTATCGATTCAAAGAACTCACTAAACAGATGTTATATTTCATCACTGAG
GCTGAAAGGTTTTTACCAGCTGTCAAGCCTCCAAGAATTTTAACCAACGT
TTATCGTTTACTATGCTTGAAATCTACAACACCCGAAGAATTATACACGC
GGAAAATCAATCTTGAACATTACGGAGAGGCCTTGGACCTAGCTAAACGT
TTTGGTTTGAATACTGATTTAGTTTATCAGCGACAGTGGAAAAAGAAAAG
AGTTTCGAAGATTACCATTCATGATTATCtgtcCAAGATTAAAGATCGAT
ATTGGGTTTTGGACGAGTGCCTTTTACGAGTTGCCGATGACTTTGACTCG
ACAGAAGAGTTACTGAAATACGGTTTACTCGGTACAAGTTGGGAAATCTT
GCAAAGGATTGATGAAGAGGGTAAAGGTGatgcaaaggatgatgggaAGT
TATTACCTTTTAAATTTGACGCCGCCCCACATGACGAGGATGACGAAAAC
TCAAGTAGAGAATTCCAAgggagTCTAACGAAGAAGCAATTGAAAATCTG
CCAATATCGACGGCAATTATTACATTATCTTGATCGGCTTTCCACTTATG
AGGTTGTTTTGGGAGGCTCATTCAAAGCACGAGATAAATTCTCAAAAGAG
TATTTTACCAAATTTCGATCGTGCAATATGGTACACCAAGCGGTCGAGTG
TGCCCGCGACGAGGACGCTTATACTCTGGAGCATTTGTTTTCGTACCATG
GGAAGCAGTTACTACCTTATTGGCTGCCGATATTATCAAACTTCCCGGAA
ACAACCGATATCCGATATTTTGAGCCGGTCATCCCTGAGATTGGAGAGCC
ACCAGAAGATCCAGAGATTTTACCTTGGTTAGAGAAACACCATCGTGAAG
AGGATTGGGTCGAGCAATCGAATATTGTCCAACAAATCAAGTCTAATGAA
GAAGGTGACGCAAACGAAGATATAGGCTCATTCATTTTCGAATCCGATCC
AGAGATacgaaaattttacaaatgtGAAACAAAAGCTCAACTGAGAGAAT
GGTTTTTACATCGTGTACACTTGATTGATGAATATTCCGGTCAGATTGAT
AAATGTTGCGAGCTGTTAGATGTGGGAATCAAAAGAGGCTTGGAAGGGCT
CACTAAGGTTCACCAAGAAATGGAAGCATGGAGACTCTTAGTTTACGACG
TTGGAATTGACAGTAAAATGACTGCAAAGAGTTTCGTGGAATTATCTGAA
TCATCGAAAATCAAATTGCTAATGTTCAAAACCTCAGATGTGACATTCGT
TAACGATTTCAAGCTATATCTAATGCCGTATTTAAGAAATATTGGAAAGA
AGGATTTTAAGAAACGCCAAGATTTACTTCATGAGTTTTTGGTGGAAATC
GCTAAAACTGATTTGACATGCTGCTTGAAGTTATTGGAAAAGTGTTCGCC
AGAGCTGCCAGAACCACTGCTTCCTGATATGGCGGAGATAATGAAGATTG
GGATTGATTGCGTTTACGCGTGCAAGAGAACGGATCAATTGAATCATTGT
TTCAGCATTGTCGAATGTTTGCCTTCGAGAGAAGAGGGAGTCATTAGCCG
TCCCGTGGAAGAGCTTCACATACAACTGGATCAATTGGAACATTTGCTGA
CAGGAGCGGAAATTTTACAGTATTACAACAACCCTCAGACCATCTCTTAC
ATTTCTGAAATTAAAGATGACTCTACTATTTGTAAACAACTCATTCAGCA
ATTGGTGAAAAACGCTGTTTGTAAAGGACGTTGTGTTCCAAAGGAATTGA
ACAAATTACTCGGACATTTGATCAAGCTTTCCAAAGAAGTTTTCCGGTGC
TGTGATATCAAGATCGTTCACCAGATTTTCGTTGAAGAATTACTACGGTC
CGGTTCACGTGAGAACATAACAGTAGCTGAAGAGTTGATCACGCCTTCCA
AACTTGCCGGGAATTCACCTCAAAGTAAGAAACCAGAACAACATTTGACG
TCTGCACTCTACCTCCTCAAATATGATGTTTCGGTTACCGTTGTGTTGGA
AGCGAGTCGTGAATATTTCAATGCAGCAATGTCGGGTAATGACTCTTCAA
TGGAACTGGCTAGATTGTGTCTAACATTGGTCAAAGATTGTCCAGAGAGT
GTTCAAGATGAATTGGATTTGATCAACTCGTTGGGTTTATTGTATGAATT
CAATGTATCCATGCTACCCTTACAAGTTCGCCTTTGCGCTGATAAATTGG
AAATTATCGATCTTTGTTTGAAGGAGAAGAAGAATGGGTACAAGAAAAAA
GACAAGCTCATCCAATTGAGTAATCTTTTGCAAATCTGTGGCCATGACAA
CAAAGAACGGATTGGACAAGTCAATATTAAAATTGCTGAATCAGCATTTG
AACATAAAGATTACACATACGCTGGTATCGTTTGTGTACAATTGGTGGAT
GATAATTATTCTAATGCTTGGTATATTTGCAGGAAACTTGGTGAATGTGC
TAAATATACCAACTTCACAATCAGGCAAAAGTTGTTGAGTTTTGCGTTAA
CTTATTGTCCAGTACATCACATTGAAGAAGTTTTACAAGAGAAAACTCAA
CTGGAAACCCAGGTTTTGTACGAGAGGTTGGGTGTATTTACGAAAGAAGG
CAAGAAAGACAAAATTGTGACCTCATCTAAGAAAGAAACTGAGGAAGAAA
ACGACGAAGACAATGTTGATGGGAATAACATATCAATCCTCAACAAGACC
AAAACTACAACAAAGAAATTGATTTCAAGCGTCGCCAGCGTGGCTGATAA
CCGCTGGGTTGGATCCGCAATGAATTGGGTCAAACCGTCGTCGGAAGGGT
CTGGTAACGAAGTTGATGTTGTTGAGCGGGAAATTGAAAGCGTTCGGCAT
AACCCATTTTATAGTTCGCTGGATTCGAAAAAGATTGACGAAGATGTTCA
AAGATTTAATTATAACGAGTTCAGCGACCATTTGAGGTGCGTCACAACCG
AAGAAAAAGTATTCAATCAGCTGGTGTTAAGAAGTCAAAAATTGAACGAG
CAAAGAACCCTGGGTAAAGAGCTCGAAAACACTGACCAAGCAATGCTATC
GTTGAGTGATATAGCTTATACTGAAGAAAGTTGTTTGTGTCTGGCTTACA
TGATGGCTATTTCTCAGCCAAAAGAAATCCATTCCCTATCGACCAAGCAT
CGGAAAAACACTTTCACTTTCCTTTTCACTGCTTATTACTATGCATTACA
AGAATAtgttaaaaacaacaaaatcgAATTCGATAAACAAGCACAGATTT
ACAGCGCGCCTCCGATTGATGTGATTACATGGATGCTAAAAGTGTTAGGT
AAGAAGCAAGgagaaaaggaagaaaaagaaaaaggagagACTTACTTTCT
GTCTAACATGAACAAGTTGCAAGACTTGATGCAAGCAAAGATGCTACAAG
CTCTTGACAAAGgaGTGGACATCGAAAGATTTTCAGTTGATAATGAATAT
AAACGTGAAACTATACTCGGATTAGCTATGAGTGTCGAAGACGAGTTGAT
TAACACAAGTTTGCTGCTAGCAGAGAAATATGATATCCCCGCATGGGAAG
TGTTGTTATCACACGTGGAATTTTTATTCACTGATAGTGGTCTAAAAGCC
AAAGCTATCCGCGAATCACTAAACAAATGGAAAGTTGATTCCCATTTGAA
ACCGAACGGTGATAAAGTCTTTGAGCGGATGAAGAAATATGTTTACCCAG
AAATCAATGGTAAAGACCACAATGCATTGCTGTTGTTCTACGTTTTCCTA
ATGAATTGCAGCTCGCCCACTAAAATATTGGAGGGTACGCTTACATTAGA
TGCTCATTCcaaacttttgaagaaaatcaaGGCTGCTGCATCATCCATCA
ATTACAAACTTCTCGTGCATGGAGATTCACCTTTGGAGGTGATTAGAGAC
TGTGTTGATGATAACAATGTACATTTGTTGGCTAAAATTGCATCCAAAAT
CCCCCAGGCGGATGGTAGTTACCTGTCATCAAACAAGATCTTCTTAGCAA
ACGCCATTCGGatgttttggaagaaaaaagaGAACAAGGATTGGTTGAAT
ACATTCGAAAACTGTAAACAACACTTCACCAAACTCCTGATAGAAGACGT
TGTCACTTTTGCTGACCATGCAATTTTTGGCGAGGAAGCTTTAGACTCGC
TGACCCAAGACACCAGACTGGAGATTGGTAAAAGAGtaataaaatatttg
agacaacaACGTGGTCAAGACGAGACCAAACAAAGAGGAGCTGACGATTA
TGATTCGCTTATGGAGCGCTACGATTCATCTATCAATGATTTGGAACTTT
CCATCGAACATCTCAAAACGCTGACTGATCCAATTTTCAAAGCAGTCTTT
GGTGACGATAACGAACTGAGCAAAACCTTTGGACGAGTATACGACTTATC
ACGTGGTCGAAAACAACCACTCGAAAAACTATTCCGTGATTTGTTCATAT
CGNTACAACCATTAGACAAAATTTCGAAACTGCGGAGTCTTTGTCGCAAT
GCATCTATTGACGTCCGCACGTGTTTCCAAGATGCTTTGCGCGGGATCCT
GAGTGACATCCAAAGCGATAGAGATTACACAAAACTACAGACTTTAACGG
AGAACATCAAAGCGCATCAAGAACATCAAACAGACCCTCTTGTTACCCAT
AGCGACGTCTTAGATGTGGTGCGGCCATTTTGTTCTGATGTTACAGCTAG
CACGGATGTGAAGAGTCACGTGTTACATNTTTTGTTCTGAatggaaGAAA
ATGAGCAAATATTGTATGATTTGATTGTTCACGAAGAATGGAAACAAGAA
CCACAGTTGTTGGACCAAGTTGAAAGTTATTTTTGGCAATATCGTGGTTC
ACTTCTAAAGAAGCTATGGAAAGTTTCACAAAGTTCTGCAATTTATATGT
GGGACAACTTGAAGACACAATTCAGATATCAAGCTACCTTTGGTTGCCCA
CCATTGAATTTTATCAATCTGATGAACAATTGCTTGCCATGGCTTATGGC
TTTGTCACCGGATGGAAATTTTATTGCCATCCTTCAAGATTCTGTTATTG
AAATAAGGACTGCTGGAAATTTTGAGCAAGTCATTACAAAATATAAGATT
GAAAAAGATATGTTTCCAAGATGGCGTAAATTGATTTGGAATCATGACAA
CACCTTACTTTGTTATTCAAACAGTTTTGGAGATTTGACCATTTTGGATA
TTACCGGCactaaaaaacattttattccaTCATCAAATAATGTCAAGTTA
AAAGTGCCTGGAACGCTGAGTTTGGCATTGTGTCATGTTGAATTTGTAGC
CAAAGGAAATagCTTCTTGTTATATACCTGCACCTATCAAGGATTTTTTA
CAGTTTATGAAGTGAATGAATCCTCCTGCACAATAAAATGGGACTACTCT
TTCATAACATTCCATCCATATGGATTAGCTGGTTTGGTTATTGATCATAA
AAATGGGTTATTGGTTGCAGCTGGGAATTATGGGAAGGAACCATTTCCTA
ATGTCATGGGAGATGCATGTTATGGATCATATTCTGGTATCAGTCTCTGG
AGATTTTTGAATGACACACCTCATCTAACTCTGGTTGAAGACCAGGGAAA
AGCTTTGAAGAAGGTATCCAGAGGTGAATGGTTAAAGAGTGTTGTTTTAA
GACGTGGCGATGAAAAAAACGAAATGTTGAAGCATGGTATTTACAAGTTG
AAATTGTCAGAAGATGGTACACAAATTGTCACACTGCATCTTGATGGTCG
CATATCTTTTTGGAGTATCCCGTCAATGAGGCTAATCAAAACTTGGAGTA
AATCTGAACAACCTGATGCAAGTGGCGGCTCAAGTGAAGGGTTCTCCTTT
GACTCGCAGAAAAAAGAAGaTCTCACCAAAACAAGGAATTCAATAGATGT
CAGCTGGTGGTCTGAAAAGGAGATTGCTTTGGCATCTGGGAGGGGTGATG
TAACGATTGCTTCGACTGACAGCTTGAAGAATTTACTTGGAGAGTCGAGT
GAGAAATTTGATCCATGGCCGTCACTCAGCCAAGTGGTGGATGGAAGCAT
TCTTGTGCTCGAGTGTGAGAAACGAGTGAACGATCCAAACAACAAAACGA
AGACATCTTGGAAATGGACTTCAGAAGAAGATGAAAGCCAAGATGAAGTG
AACTCGATTCGTTATCGATTCAAAGAACTCACTAAACAGATGTTATATTT
CATCACTGAGGCTGAAAGGTTTTTACCAGCTGTCAAGCCTCCAAGAATTT
TAACCAACGTTTATCGTTTACTATGCTTGAAATCTACAACACCCGAAGAA
TTATACACGCGGAAAATCAATCTTGAACATTACGGAGAGGCCTTGGACCT
AGCTAAACGTTTTGGTTTGAATACTGATTTAGTTTATCAGCGACAGTGGA
AAAAGAAAAGAGTTTCGAAGATTACCATTCATGATTATCtgtcCAAGATT
AAAGATCGATATTGGGTTTTGGACGAGTGCCTTTTACGAGTTGCCGATGA
CTTTGACTCGACAGAAGAGTTACTGAAATACGGTTTACTCGGTACAAGTT
GGGAAATCTTGCAAAGGATTGATGAAGAGGGTAAAGGTGatgcaaaggat
gatgggaAGTTATTACCTTTTAAATTTGACGCCGCCCCACATGACGAGGA
TGACGAAAACTCAAGTAGAGAATTCCAAgggagTCTAACGAAGAAGCAAT
TGAAAATCTGCCAATATCGACGGCAATTATTACATTATCTTGATCGGCTT
TCCACTTATGAGGTTGTTTTGGGAGGCTCATTCAAAGCACGAGATAAATT
CTCAAAAGAGTATTTTACCAAATTTCGATCGTGCAATATGGTACACCAAG
CGGTCGAGTGTGCCCGCGACGAGGACGCTTATACTCTGGAGCATTTGTTT
TCGTACCATGGGAAGCAGTTACTACCTTATTGGCTGCCGATATTATCAAA
CTTCCCGGAAACAACCGATATCCGATATTTTGAGCCGGTCATCCCTGAGA
TTGGAGAGCCACCAGAAGATCCAGAGATTTTACCTTGGTTAGAGAAACAC
CATCGTGAAGAGGATTGGGTCGAGCAATCGAATATTGTCCAACAAATCAA
GTCTAATGAAGAAGGTGACGCAAACGAAGATATAGGCTCATTCATTTTCG
AATCCGATCCAGAGATacgaaaattttacaaatgtGAAACAAAAGCTCAA
CTGAGAGAATGGTTTTTACATCGTGTACACTTGATTGATGAATATTCCGG
TCAGATTGATAAATGTTGCGAGCTGTTAGATGTGGGAATCAAAAGAGGCT
TGGAAGGGCTCACTAAGGTTCACCAAGAAATGGAAGCATGGAGACTCTTA
GTTTACGACGTTGGAATTGACAGTAAAATGACTGCAAAGAGTTTCGTGGA
ATTATCTGAATCATCGAAAATCAAATTGCTAATGTTCAAAACCTCAGATG
TGACATTCGTTAACGATTTCAAGCTATATCTAATGCCGTATTTAAGAAAT
ATTGGAAAGAAGGATTTTAAGAAACGCCAAGATTTACTTCATGAGTTTTT
GGTGGAAATCGCTAAAACTGATTTGACATGCTGCTTGAAGTTATTGGAAA
AGTGTTCGCCAGAGCTGCCAGAACCACTGCTTCCTGATATGGCGGAGATA
ATGAAGATTGGGATTGATTGCGTTTACGCGTGCAAGAGAACGGATCAATT
GAATCATTGTTTCAGCATTGTCGAATGTTTGCCTTCGAGAGAAGAGGGAG
TCATTAGCCGTCCCGTGGAAGAGCTTCACATACAACTGGATCAATTGGAA
CATTTGCTGACAGGAGCGGAAATTTTACAGTATTACAACAACCCTCAGAC
CATCTCTTACATTTCTGAAATTAAAGATGACTCTACTATTTGTAAACAAC
TCATTCAGCAATTGGTGAAAAACGCTGTTTGTAAAGGACGTTGTGTTCCA
AAGGAATTGAACAAATTACTCGGACATTTGATCAAGCTTTCCAAAGAAGT
TTTCCGGTGCTGTGATATCAAGATCGTTCACCAGATTTTCGTTGAAGAAT
TACTACGGTCCGGTTCACGTGAGAACATAACAGTAGCTGAAGAGTTGATC
ACGCCTTCCAAACTTGCCGGGAATTCACCTCAAAGTAAGAAACCAGAACA
ACATTTGACGTCTGCACTCTACCTCCTCAAATATGATGTTTCGGTTACCG
TTGTGTTGGAAGCGAGTCGTGAATATTTCAATGCAGCAATGTCGGGTAAT
GACTCTTCAATGGAACTGGCTAGATTGTGTCTAACATTGGTCAAAGATTG
TCCAGAGAGTGTTCAAGATGAATTGGATTTGATCAACTCGTTGGGTTTAT
TGTATGAATTCAATGTATCCATGCTACCCTTACAAGTTCGCCTTTGCGCT
GATAAATTGGAAATTATCGATCTTTGTTTGAAGGAGAAGAAGAATGGGTA
CAAGAAAAAAGACAAGCTCATCCAATTGAGTAATCTTTTGCAAATCTGTG
GCCATGACAACAAAGAACGGATTGGACAAGTCAATATTAAAATTGCTGAA
TCAGCATTTGAACATAAAGATTACACATACGCTGGTATCGTTTGTGTACA
ATTGGTGGATGATAATTATTCTAATGCTTGGTATATTTGCAGGAAACTTG
GTGAATGTGCTAAATATACCAACTTCACAATCAGGCAAAAGTTGTTGAGT
TTTGCGTTAACTTATTGTCCAGTACATCACATTGAAGAAGTTTTACAAGA
GAAAACTCAACTGGAAACCCAGGTTTTGTACGAGAGGTTGGGTGTATTTA
CGAAAGAAGGCAAGAAAGACAAAATTGTGACCTCATCTAAGAAAGAAACT
GAGGAAGAAAACGACGAAGACAATGTTGATGGGAATAACATATCAATCCT
CAACAAGACCAAAACTACAACAAAGAAATTGATTTCAAGCGTCGCCAGCG
TGGCTGATAACCGCTGGGTTGGATCCGCAATGAATTGGGTCAAACCGTCG
TCGGAAGGGTCTGGTAACGAAGTTGATGTTGTTGAGCGGGAAATTGAAAG
CGTTCGGCATAACCCATTTTATAGTTCGCTGGATTCGAAAAAGATTGACG
AAGATGTTCAAAGATTTAATTATAACGAGTTCAGCGACCATTTGAGGTGC
GTCACAACCGAAGAAAAAGTATTCAATCAGCTGGTGTTAAGAAGTCAAAA
ATTGAACGAGCAAAGAACCCTGGGTAAAGAGCTCGAAAACACTGACCAAG
CAATGCTATCGTTGAGTGATATAGCTTATACTGAAGAAAGTTGTTTGTGT
CTGGCTTACATGATGGCTATTTCTCAGCCAAAAGAAATCCATTCCCTATC
GACCAAGCATCGGAAAAACACTTTCACTTTCCTTTTCACTGCTTATTACT
ATGCATTACAAGAATAtgttaaaaacaacaaaatcgAATTCGATAAACAA
GCACAGATTTACAGCGCGCCTCCGATTGATGTGATTACATGGATGCTAAA
AGTGTTAGGTAAGAAGCAAGgagaaaaggaagaaaaagaaaaaggagagA
CTTACTTTCTGTCTAACATGAACAAGTTGCAAGACTTGATGCAAGCAAAG
ATGCTACAAGCTCTTGACAAAGgaGTGGACATCGAAAGATTTTCAGTTGA
TAATGAATATAAACGTGAAACTATACTCGGATTAGCTATGAGTGTCGAAG
ACGAGTTGATTAACACAAGTTTGCTGCTAGCAGAGAAATATGATATCCCC
GCATGGGAAGTGTTGTTATCACACGTGGAATTTTTATTCACTGATAGTGG
TCTAAAAGCCAAAGCTATCCGCGAATCACTAAACAAATGGAAAGTTGATT
CCCATTTGAAACCGAACGGTGATAAAGTCTTTGAGCGGATGAAGAAATAT
GTTTACCCAGAAATCAATGGTAAAGACCACAATGCATTGCTGTTGTTCTA
CGTTTTCCTAATGAATTGCAGCTCGCCCACTAAAATATTGGAGGGTACGC
TTACATTAGATGCTCATTCcaaacttttgaagaaaatcaaGGCTGCTGCA
TCATCCATCAATTACAAACTTCTCGTGCATGGAGATTCACCTTTGGAGGT
GATTAGAGACTGTGTTGATGATAACAATGTACATTTGTTGGCTAAAATTG
CATCCAAAATCCCCCAGGCGGATGGTAGTTACCTGTCATCAAACAAGATC
TTCTTAGCAAACGCCATTCGGatgttttggaagaaaaaagaGAACAAGGA
TTGGTTGAATACATTCGAAAACTGTAAACAACACTTCACCAAACTCCTGA
TAGAAGACGTTGTCACTTTTGCTGACCATGCAATTTTTGGCGAGGAAGCT
TTAGACTCGCTGACCCAAGACACCAGACTGGAGATTGGTAAAAGAGtaat
aaaatatttgagacaacaACGTGGTCAAGACGAGACCAAACAAAGAGGAG
CTGACGATTATGATTCGCTTATGGAGCGCTACGATTCATCTATCAATGAT
TTGGAACTTTCCATCGAACATCTCAAAACGCTGACTGATCCAATTTTCAA
AGCAGTCTTTGGTGACGATAACGAACTGAGCAAAACCTTTGGACGAGTAT
ACGACTTATCACGTGGTCGAAAACAACCACTCGAAAAACTATTCCGTGAT
TTGTTCATATCGNTACAACCATTAGACAAAATTTCGAAACTGCGGAGTCT
TTGTCGCAATGCATCTATTGACGTCCGCACGTGTTTCCAAGATGCTTTGC
GCGGGATCCTGAGTGACATCCAAAGCGATAGAGATTACACAAAACTACAG
ACTTTAACGGAGAACATCAAAGCGCATCAAGAACATCAAACAGACCCTCT
TGTTACCCATAGCGACGTCTTAGATGTGGTGCGGCCATTTTGTTCTGATG
TTACAGCTAGCACGGATGTGAAGAGTCACGTGTTACATNTTTTGTTCTGA
atggaaGAAAATGAGCAAATATTGTATGATTTGATTGTTCACGAAGAATG
GAAACAAGAACCACAGTTGTTGGACCAAGTTGAAAGTTATTTTTGGCAAT
ATCGTGGTTCACTTCTAAAGAAGCTATGGAAAGTTTCACAAAGTTCTGCA
ATTTATATGTGGGACAACTTGAAGACACAATTCAGATATCAAGCTACCTT
TGGTTGCCCACCATTGAATTTTATCAATCTGATGAACAATTGCTTGCCAT
GGCTTATGGCTTTGTCACCGGATGGAAATTTTATTGCCATCCTTCAAGAT
TCTGTTATTGAAATAAGGACTGCTGGAAATTTTGAGCAAGTCATTACAAA
ATATAAGATTGAAAAAGATATGTTTCCAAGATGGCGTAAATTGATTTGGA
ATCATGACAACACCTTACTTTGTTATTCAAACAGTTTTGGAGATTTGACC
ATTTTGGATATTACCGGCactaaaaaacattttattccaTCATCAAATAA
TGTCAAGTTAAAAGTGCCTGGAACGCTGAGTTTGGCATTGTGTCATGTTG
AATTTGTAGCCAAAGGAAATagCTTCTTGTTATATACCTGCACCTATCAA
GGATTTTTTACAGTTTATGAAGTGAATGAATCCTCCTGCACAATAAAATG
GGACTACTCTTTCATAACATTCCATCCATATGGATTAGCTGGTTTGGTTA
TTGATCATAAAAATGGGTTATTGGTTGCAGCTGGGAATTATGGGAAGGAA
CCATTTCCTAATGTCATGGGAGATGCATGTTATGGATCATATTCTGGTAT
CAGTCTCTGGAGATTTTTGAATGACACACCTCATCTAACTCTGGTTGAAG
ACCAGGGAAAAGCTTTGAAGAAGGTATCCAGAGGTGAATGGTTAAAGAGT
GTTGTTTTAAGACGTGGCGATGAAAAAAACGAAATGTTGAAGCATGGTAT
TTACAAGTTGAAATTGTCAGAAGATGGTACACAAATTGTCACACTGCATC
TTGATGGTCGCATATCTTTTTGGAGTATCCCGTCAATGAGGCTAATCAAA
ACTTGGAGTAAATCTGAACAACCTGATGCAAGTGGCGGCTCAAGTGAAGG
GTTCTCCTTTGACTCGCAGAAAAAAGAAGaTCTCACCAAAACAAGGAATT
CAATAGATGTCAGCTGGTGGTCTGAAAAGGAGATTGCTTTGGCATCTGGG
AGGGGTGATGTAACGATTGCTTCGACTGACAGCTTGAAGAATTTACTTGG
AGAGTCGAGTGAGAAATTTGATCCATGGCCGTCACTCAGCCAAGTGGTGG
ATGGAAGCATTCTTGTGCTCGAGTGTGAGAAACGAGTGAACGATCCAAAC
AACAAAACGAAGACATCTTGGAAATGGACTTCAGAAGAAGATGAAAGCCA
AGATGAAGTGAACTCGATTCGTTATCGATTCAAAGAACTCACTAAACAGA
TGTTATATTTCATCACTGAGGCTGAAAGGTTTTTACCAGCTGTCAAGCCT
CCAAGAATTTTAACCAACGTTTATCGTTTACTATGCTTGAAATCTACAAC
ACCCGAAGAATTATACACGCGGAAAATCAATCTTGAACATTACGGAGAGG
CCTTGGACCTAGCTAAACGTTTTGGTTTGAATACTGATTTAGTTTATCAG
CGACAGTGGAAAAAGAAAAGAGTTTCGAAGATTACCATTCATGATTATCt
gtcCAAGATTAAAGATCGATATTGGGTTTTGGACGAGTGCCTTTTACGAG
TTGCCGATGACTTTGACTCGACAGAAGAGTTACTGAAATACGGTTTACTC
GGTACAAGTTGGGAAATCTTGCAAAGGATTGATGAAGAGGGTAAAGGTGa
tgcaaaggatgatgggaAGTTATTACCTTTTAAATTTGACGCCGCCCCAC
ATGACGAGGATGACGAAAACTCAAGTAGAGAATTCCAAgggagTCTAACG
AAGAAGCAATTGAAAATCTGCCAATATCGACGGCAATTATTACATTATCT
TGATCGGCTTTCCACTTATGAGGTTGTTTTGGGAGGCTCATTCAAAGCAC
GAGATAAATTCTCAAAAGAGTATTTTACCAAATTTCGATCGTGCAATATG
GTACACCAAGCGGTCGAGTGTGCCCGCGACGAGGACGCTTATACTCTGGA
GCATTTGTTTTCGTACCATGGGAAGCAGTTACTACCTTATTGGCTGCCGA
TATTATCAAACTTCCCGGAAACAACCGATATCCGATATTTTGAGCCGGTC
ATCCCTGAGATTGGAGAGCCACCAGAAGATCCAGAGATTTTACCTTGGTT
AGAGAAACACCATCGTGAAGAGGATTGGGTCGAGCAATCGAATATTGTCC
AACAAATCAAGTCTAATGAAGAAGGTGACGCAAACGAAGATATAGGCTCA
TTCATTTTCGAATCCGATCCAGAGATacgaaaattttacaaatgtGAAAC
AAAAGCTCAACTGAGAGAATGGTTTTTACATCGTGTACACTTGATTGATG
AATATTCCGGTCAGATTGATAAATGTTGCGAGCTGTTAGATGTGGGAATC
AAAAGAGGCTTGGAAGGGCTCACTAAGGTTCACCAAGAAATGGAAGCATG
GAGACTCTTAGTTTACGACGTTGGAATTGACAGTAAAATGACTGCAAAGA
GTTTCGTGGAATTATCTGAATCATCGAAAATCAAATTGCTAATGTTCAAA
ACCTCAGATGTGACATTCGTTAACGATTTCAAGCTATATCTAATGCCGTA
TTTAAGAAATATTGGAAAGAAGGATTTTAAGAAACGCCAAGATTTACTTC
ATGAGTTTTTGGTGGAAATCGCTAAAACTGATTTGACATGCTGCTTGAAG
TTATTGGAAAAGTGTTCGCCAGAGCTGCCAGAACCACTGCTTCCTGATAT
GGCGGAGATAATGAAGATTGGGATTGATTGCGTTTACGCGTGCAAGAGAA
CGGATCAATTGAATCATTGTTTCAGCATTGTCGAATGTTTGCCTTCGAGA
GAAGAGGGAGTCATTAGCCGTCCCGTGGAAGAGCTTCACATACAACTGGA
TCAATTGGAACATTTGCTGACAGGAGCGGAAATTTTACAGTATTACAACA
ACCCTCAGACCATCTCTTACATTTCTGAAATTAAAGATGACTCTACTATT
TGTAAACAACTCATTCAGCAATTGGTGAAAAACGCTGTTTGTAAAGGACG
TTGTGTTCCAAAGGAATTGAACAAATTACTCGGACATTTGATCAAGCTTT
CCAAAGAAGTTTTCCGGTGCTGTGATATCAAGATCGTTCACCAGATTTTC
GTTGAAGAATTACTACGGTCCGGTTCACGTGAGAACATAACAGTAGCTGA
AGAGTTGATCACGCCTTCCAAACTTGCCGGGAATTCACCTCAAAGTAAGA
AACCAGAACAACATTTGACGTCTGCACTCTACCTCCTCAAATATGATGTT
TCGGTTACCGTTGTGTTGGAAGCGAGTCGTGAATATTTCAATGCAGCAAT
GTCGGGTAATGACTCTTCAATGGAACTGGCTAGATTGTGTCTAACATTGG
TCAAAGATTGTCCAGAGAGTGTTCAAGATGAATTGGATTTGATCAACTCG
TTGGGTTTATTGTATGAATTCAATGTATCCATGCTACCCTTACAAGTTCG
CCTTTGCGCTGATAAATTGGAAATTATCGATCTTTGTTTGAAGGAGAAGA
AGAATGGGTACAAGAAAAAAGACAAGCTCATCCAATTGAGTAATCTTTTG
CAAATCTGTGGCCATGACAACAAAGAACGGATTGGACAAGTCAATATTAA
AATTGCTGAATCAGCATTTGAACATAAAGATTACACATACGCTGGTATCG
TTTGTGTACAATTGGTGGATGATAATTATTCTAATGCTTGGTATATTTGC
AGGAAACTTGGTGAATGTGCTAAATATACCAACTTCACAATCAGGCAAAA
GTTGTTGAGTTTTGCGTTAACTTATTGTCCAGTACATCACATTGAAGAAG
TTTTACAAGAGAAAACTCAACTGGAAACCCAGGTTTTGTACGAGAGGTTG
GGTGTATTTACGAAAGAAGGCAAGAAAGACAAAATTGTGACCTCATCTAA
GAAAGAAACTGAGGAAGAAAACGACGAAGACAATGTTGATGGGAATAACA
TATCAATCCTCAACAAGACCAAAACTACAACAAAGAAATTGATTTCAAGC
GTCGCCAGCGTGGCTGATAACCGCTGGGTTGGATCCGCAATGAATTGGGT
CAAACCGTCGTCGGAAGGGTCTGGTAACGAAGTTGATGTTGTTGAGCGGG
AAATTGAAAGCGTTCGGCATAACCCATTTTATAGTTCGCTGGATTCGAAA
AAGATTGACGAAGATGTTCAAAGATTTAATTATAACGAGTTCAGCGACCA
TTTGAGGTGCGTCACAACCGAAGAAAAAGTATTCAATCAGCTGGTGTTAA
GAAGTCAAAAATTGAACGAGCAAAGAACCCTGGGTAAAGAGCTCGAAAAC
ACTGACCAAGCAATGCTATCGTTGAGTGATATAGCTTATACTGAAGAAAG
TTGTTTGTGTCTGGCTTACATGATGGCTATTTCTCAGCCAAAAGAAATCC
ATTCCCTATCGACCAAGCATCGGAAAAACACTTTCACTTTCCTTTTCACT
GCTTATTACTATGCATTACAAGAATAtgttaaaaacaacaaaatcgAATT
CGATAAACAAGCACAGATTTACAGCGCGCCTCCGATTGATGTGATTACAT
GGATGCTAAAAGTGTTAGGTAAGAAGCAAGgagaaaaggaagaaaaagaa
aaaggagagACTTACTTTCTGTCTAACATGAACAAGTTGCAAGACTTGAT
GCAAGCAAAGATGCTACAAGCTCTTGACAAAGgaGTGGACATCGAAAGAT
TTTCAGTTGATAATGAATATAAACGTGAAACTATACTCGGATTAGCTATG
AGTGTCGAAGACGAGTTGATTAACACAAGTTTGCTGCTAGCAGAGAAATA
TGATATCCCCGCATGGGAAGTGTTGTTATCACACGTGGAATTTTTATTCA
CTGATAGTGGTCTAAAAGCCAAAGCTATCCGCGAATCACTAAACAAATGG
AAAGTTGATTCCCATTTGAAACCGAACGGTGATAAAGTCTTTGAGCGGAT
GAAGAAATATGTTTACCCAGAAATCAATGGTAAAGACCACAATGCATTGC
TGTTGTTCTACGTTTTCCTAATGAATTGCAGCTCGCCCACTAAAATATTG
GAGGGTACGCTTACATTAGATGCTCATTCcaaacttttgaagaaaatcaa
GGCTGCTGCATCATCCATCAATTACAAACTTCTCGTGCATGGAGATTCAC
CTTTGGAGGTGATTAGAGACTGTGTTGATGATAACAATGTACATTTGTTG
GCTAAAATTGCATCCAAAATCCCCCAGGCGGATGGTAGTTACCTGTCATC
AAACAAGATCTTCTTAGCAAACGCCATTCGGatgttttggaagaaaaaag
aGAACAAGGATTGGTTGAATACATTCGAAAACTGTAAACAACACTTCACC
AAACTCCTGATAGAAGACGTTGTCACTTTTGCTGACCATGCAATTTTTGG
CGAGGAAGCTTTAGACTCGCTGACCCAAGACACCAGACTGGAGATTGGTA
AAAGAGtaataaaatatttgagacaacaACGTGGTCAAGACGAGACCAAA
CAAAGAGGAGCTGACGATTATGATTCGCTTATGGAGCGCTACGATTCATC
TATCAATGATTTGGAACTTTCCATCGAACATCTCAAAACGCTGACTGATC
CAATTTTCAAAGCAGTCTTTGGTGACGATAACGAACTGAGCAAAACCTTT
GGACGAGTATACGACTTATCACGTGGTCGAAAACAACCACTCGAAAAACT
ATTCCGTGATTTGTTCATATCGNTACAACCATTAGACAAAATTTCGAAAC
TGCGGAGTCTTTGTCGCAATGCATCTATTGACGTCCGCACGTGTTTCCAA
GATGCTTTGCGCGGGATCCTGAGTGACATCCAAAGCGATAGAGATTACAC
AAAACTACAGACTTTAACGGAGAACATCAAAGCGCATCAAGAACATCAAA
CAGACCCTCTTGTTACCCATAGCGACGTCTTAGATGTGGTGCGGCCATTT
TGTTCTGATGTTACAGCTAGCACGGATGTGAAGAGTCACGTGTTACATNT
TTTGTTCTGAatggaaGAAAATGAGCAAATATTGTATGATTTGATTGTTC
ACGAAGAATGGAAACAAGAACCACAGTTGTTGGACCAAGTTGAAAGTTAT
TTTTGGCAATATCGTGGTTCACTTCTAAAGAAGCTATGGAAAGTTTCACA
AAGTTCTGCAATTTATATGTGGGACAACTTGAAGACACAATTCAGATATC
AAGCTACCTTTGGTTGCCCACCATTGAATTTTATCAATCTGATGAACAAT
TGCTTGCCATGGCTTATGGCTTTGTCACCGGATGGAAATTTTATTGCCAT
CCTTCAAGATTCTGTTATTGAAATAAGGACTGCTGGAAATTTTGAGCAAG
TCATTACAAAATATAAGATTGAAAAAGATATGTTTCCAAGATGGCGTAAA
TTGATTTGGAATCATGACAACACCTTACTTTGTTATTCAAACAGTTTTGG
AGATTTGACCATTTTGGATATTACCGGCactaaaaaacattttattccaT
CATCAAATAATGTCAAGTTAAAAGTGCCTGGAACGCTGAGTTTGGCATTG
TGTCATGTTGAATTTGTAGCCAAAGGAAATagCTTCTTGTTATATACCTG
CACCTATCAAGGATTTTTTACAGTTTATGAAGTGAATGAATCCTCCTGCA
CAATAAAATGGGACTACTCTTTCATAACATTCCATCCATATGGATTAGCT
GGTTTGGTTATTGATCATAAAAATGGGTTATTGGTTGCAGCTGGGAATTA
TGGGAAGGAACCATTTCCTAATGTCATGGGAGATGCATGTTATGGATCAT
ATTCTGGTATCAGTCTCTGGAGATTTTTGAATGACACACCTCATCTAACT
CTGGTTGAAGACCAGGGAAAAGCTTTGAAGAAGGTATCCAGAGGTGAATG
GTTAAAGAGTGTTGTTTTAAGACGTGGCGATGAAAAAAACGAAATGTTGA
AGCATGGTATTTACAAGTTGAAATTGTCAGAAGATGGTACACAAATTGTC
ACACTGCATCTTGATGGTCGCATATCTTTTTGGAGTATCCCGTCAATGAG
GCTAATCAAAACTTGGAGTAAATCTGAACAACCTGATGCAAGTGGCGGCT
CAAGTGAAGGGTTCTCCTTTGACTCGCAGAAAAAAGAAGaTCTCACCAAA
ACAAGGAATTCAATAGATGTCAGCTGGTGGTCTGAAAAGGAGATTGCTTT
GGCATCTGGGAGGGGTGATGTAACGATTGCTTCGACTGACAGCTTGAAGA
ATTTACTTGGAGAGTCGAGTGAGAAATTTGATCCATGGCCGTCACTCAGC
CAAGTGGTGGATGGAAGCATTCTTGTGCTCGAGTGTGAGAAACGAGTGAA
CGATCCAAACAACAAAACGAAGACATCTTGGAAATGGACTTCAGAAGAAG
ATGAAAGCCAAGATGAAGTGAACTCGATTCGTTATCGATTCAAAGAACTC
ACTAAACAGATGTTATATTTCATCACTGAGGCTGAAAGGTTTTTACCAGC
TGTCAAGCCTCCAAGAATTTTAACCAACGTTTATCGTTTACTATGCTTGA
AATCTACAACACCCGAAGAATTATACACGCGGAAAATCAATCTTGAACAT
TACGGAGAGGCCTTGGACCTAGCTAAACGTTTTGGTTTGAATACTGATTT
AGTTTATCAGCGACAGTGGAAAAAGAAAAGAGTTTCGAAGATTACCATTC
ATGATTATCtgtcCAAGATTAAAGATCGATATTGGGTTTTGGACGAGTGC
CTTTTACGAGTTGCCGATGACTTTGACTCGACAGAAGAGTTACTGAAATA
CGGTTTACTCGGTACAAGTTGGGAAATCTTGCAAAGGATTGATGAAGAGG
GTAAAGGTGatgcaaaggatgatgggaAGTTATTACCTTTTAAATTTGAC
GCCGCCCCACATGACGAGGATGACGAAAACTCAAGTAGAGAATTCCAAgg
gagTCTAACGAAGAAGCAATTGAAAATCTGCCAATATCGACGGCAATTAT
TACATTATCTTGATCGGCTTTCCACTTATGAGGTTGTTTTGGGAGGCTCA
TTCAAAGCACGAGATAAATTCTCAAAAGAGTATTTTACCAAATTTCGATC
GTGCAATATGGTACACCAAGCGGTCGAGTGTGCCCGCGACGAGGACGCTT
ATACTCTGGAGCATTTGTTTTCGTACCATGGGAAGCAGTTACTACCTTAT
TGGCTGCCGATATTATCAAACTTCCCGGAAACAACCGATATCCGATATTT
TGAGCCGGTCATCCCTGAGATTGGAGAGCCACCAGAAGATCCAGAGATTT
TACCTTGGTTAGAGAAACACCATCGTGAAGAGGATTGGGTCGAGCAATCG
AATATTGTCCAACAAATCAAGTCTAATGAAGAAGGTGACGCAAACGAAGA
TATAGGCTCATTCATTTTCGAATCCGATCCAGAGATacgaaaattttaca
aatgtGAAACAAAAGCTCAACTGAGAGAATGGTTTTTACATCGTGTACAC
TTGATTGATGAATATTCCGGTCAGATTGATAAATGTTGCGAGCTGTTAGA
TGTGGGAATCAAAAGAGGCTTGGAAGGGCTCACTAAGGTTCACCAAGAAA
TGGAAGCATGGAGACTCTTAGTTTACGACGTTGGAATTGACAGTAAAATG
ACTGCAAAGAGTTTCGTGGAATTATCTGAATCATCGAAAATCAAATTGCT
AATGTTCAAAACCTCAGATGTGACATTCGTTAACGATTTCAAGCTATATC
TAATGCCGTATTTAAGAAATATTGGAAAGAAGGATTTTAAGAAACGCCAA
GATTTACTTCATGAGTTTTTGGTGGAAATCGCTAAAACTGATTTGACATG
CTGCTTGAAGTTATTGGAAAAGTGTTCGCCAGAGCTGCCAGAACCACTGC
TTCCTGATATGGCGGAGATAATGAAGATTGGGATTGATTGCGTTTACGCG
TGCAAGAGAACGGATCAATTGAATCATTGTTTCAGCATTGTCGAATGTTT
GCCTTCGAGAGAAGAGGGAGTCATTAGCCGTCCCGTGGAAGAGCTTCACA
TACAACTGGATCAATTGGAACATTTGCTGACAGGAGCGGAAATTTTACAG
TATTACAACAACCCTCAGACCATCTCTTACATTTCTGAAATTAAAGATGA
CTCTACTATTTGTAAACAACTCATTCAGCAATTGGTGAAAAACGCTGTTT
GTAAAGGACGTTGTGTTCCAAAGGAATTGAACAAATTACTCGGACATTTG
ATCAAGCTTTCCAAAGAAGTTTTCCGGTGCTGTGATATCAAGATCGTTCA
CCAGATTTTCGTTGAAGAATTACTACGGTCCGGTTCACGTGAGAACATAA
CAGTAGCTGAAGAGTTGATCACGCCTTCCAAACTTGCCGGGAATTCACCT
CAAAGTAAGAAACCAGAACAACATTTGACGTCTGCACTCTACCTCCTCAA
ATATGATGTTTCGGTTACCGTTGTGTTGGAAGCGAGTCGTGAATATTTCA
ATGCAGCAATGTCGGGTAATGACTCTTCAATGGAACTGGCTAGATTGTGT
CTAACATTGGTCAAAGATTGTCCAGAGAGTGTTCAAGATGAATTGGATTT
GATCAACTCGTTGGGTTTATTGTATGAATTCAATGTATCCATGCTACCCT
TACAAGTTCGCCTTTGCGCTGATAAATTGGAAATTATCGATCTTTGTTTG
AAGGAGAAGAAGAATGGGTACAAGAAAAAAGACAAGCTCATCCAATTGAG
TAATCTTTTGCAAATCTGTGGCCATGACAACAAAGAACGGATTGGACAAG
TCAATATTAAAATTGCTGAATCAGCATTTGAACATAAAGATTACACATAC
GCTGGTATCGTTTGTGTACAATTGGTGGATGATAATTATTCTAATGCTTG
GTATATTTGCAGGAAACTTGGTGAATGTGCTAAATATACCAACTTCACAA
TCAGGCAAAAGTTGTTGAGTTTTGCGTTAACTTATTGTCCAGTACATCAC
ATTGAAGAAGTTTTACAAGAGAAAACTCAACTGGAAACCCAGGTTTTGTA
CGAGAGGTTGGGTGTATTTACGAAAGAAGGCAAGAAAGACAAAATTGTGA
CCTCATCTAAGAAAGAAACTGAGGAAGAAAACGACGAAGACAATGTTGAT
GGGAATAACATATCAATCCTCAACAAGACCAAAACTACAACAAAGAAATT
GATTTCAAGCGTCGCCAGCGTGGCTGATAACCGCTGGGTTGGATCCGCAA
TGAATTGGGTCAAACCGTCGTCGGAAGGGTCTGGTAACGAAGTTGATGTT
GTTGAGCGGGAAATTGAAAGCGTTCGGCATAACCCATTTTATAGTTCGCT
GGATTCGAAAAAGATTGACGAAGATGTTCAAAGATTTAATTATAACGAGT
TCAGCGACCATTTGAGGTGCGTCACAACCGAAGAAAAAGTATTCAATCAG
CTGGTGTTAAGAAGTCAAAAATTGAACGAGCAAAGAACCCTGGGTAAAGA
GCTCGAAAACACTGACCAAGCAATGCTATCGTTGAGTGATATAGCTTATA
CTGAAGAAAGTTGTTTGTGTCTGGCTTACATGATGGCTATTTCTCAGCCA
AAAGAAATCCATTCCCTATCGACCAAGCATCGGAAAAACACTTTCACTTT
CCTTTTCACTGCTTATTACTATGCATTACAAGAATAtgttaaaaacaaca
aaatcgAATTCGATAAACAAGCACAGATTTACAGCGCGCCTCCGATTGAT
GTGATTACATGGATGCTAAAAGTGTTAGGTAAGAAGCAAGgagaaaagga
agaaaaagaaaaaggagagACTTACTTTCTGTCTAACATGAACAAGTTGC
AAGACTTGATGCAAGCAAAGATGCTACAAGCTCTTGACAAAGgaGTGGAC
ATCGAAAGATTTTCAGTTGATAATGAATATAAACGTGAAACTATACTCGG
ATTAGCTATGAGTGTCGAAGACGAGTTGATTAACACAAGTTTGCTGCTAG
CAGAGAAATATGATATCCCCGCATGGGAAGTGTTGTTATCACACGTGGAA
TTTTTATTCACTGATAGTGGTCTAAAAGCCAAAGCTATCCGCGAATCACT
AAACAAATGGAAAGTTGATTCCCATTTGAAACCGAACGGTGATAAAGTCT
TTGAGCGGATGAAGAAATATGTTTACCCAGAAATCAATGGTAAAGACCAC
AATGCATTGCTGTTGTTCTACGTTTTCCTAATGAATTGCAGCTCGCCCAC
TAAAATATTGGAGGGTACGCTTACATTAGATGCTCATTCcaaacttttga
agaaaatcaaGGCTGCTGCATCATCCATCAATTACAAACTTCTCGTGCAT
GGAGATTCACCTTTGGAGGTGATTAGAGACTGTGTTGATGATAACAATGT
ACATTTGTTGGCTAAAATTGCATCCAAAATCCCCCAGGCGGATGGTAGTT
ACCTGTCATCAAACAAGATCTTCTTAGCAAACGCCATTCGGatgttttgg
aagaaaaaagaGAACAAGGATTGGTTGAATACATTCGAAAACTGTAAACA
ACACTTCACCAAACTCCTGATAGAAGACGTTGTCACTTTTGCTGACCATG
CAATTTTTGGCGAGGAAGCTTTAGACTCGCTGACCCAAGACACCAGACTG
GAGATTGGTAAAAGAGtaataaaatatttgagacaacaACGTGGTCAAGA
CGAGACCAAACAAAGAGGAGCTGACGATTATGATTCGCTTATGGAGCGCT
ACGATTCATCTATCAATGATTTGGAACTTTCCATCGAACATCTCAAAACG
CTGACTGATCCAATTTTCAAAGCAGTCTTTGGTGACGATAACGAACTGAG
CAAAACCTTTGGACGAGTATACGACTTATCACGTGGTCGAAAACAACCAC
TCGAAAAACTATTCCGTGATTTGTTCATATCGNTACAACCATTAGACAAA
ATTTCGAAACTGCGGAGTCTTTGTCGCAATGCATCTATTGACGTCCGCAC
GTGTTTCCAAGATGCTTTGCGCGGGATCCTGAGTGACATCCAAAGCGATA
GAGATTACACAAAACTACAGACTTTAACGGAGAACATCAAAGCGCATCAA
GAACATCAAACAGACCCTCTTGTTACCCATAGCGACGTCTTAGATGTGGT
GCGGCCATTTTGTTCTGATGTTACAGCTAGCACGGATGTGAAGAGTCACG
TGTTACATNTTTTGTTCTGAatggaaGAAAATGAGCAAATATTGTATGAT
TTGATTGTTCACGAAGAATGGAAACAAGAACCACAGTTGTTGGACCAAGT
TGAAAGTTATTTTTGGCAATATCGTGGTTCACTTCTAAAGAAGCTATGGA
AAGTTTCACAAAGTTCTGCAATTTATATGTGGGACAACTTGAAGACACAA
TTCAGATATCAAGCTACCTTTGGTTGCCCACCATTGAATTTTATCAATCT
GATGAACAATTGCTTGCCATGGCTTATGGCTTTGTCACCGGATGGAAATT
TTATTGCCATCCTTCAAGATTCTGTTATTGAAATAAGGACTGCTGGAAAT
TTTGAGCAAGTCATTACAAAATATAAGATTGAAAAAGATATGTTTCCAAG
ATGGCGTAAATTGATTTGGAATCATGACAACACCTTACTTTGTTATTCAA
ACAGTTTTGGAGATTTGACCATTTTGGATATTACCGGCactaaaaaacat
tttattccaTCATCAAATAATGTCAAGTTAAAAGTGCCTGGAACGCTGAG
TTTGGCATTGTGTCATGTTGAATTTGTAGCCAAAGGAAATagCTTCTTGT
TATATACCTGCACCTATCAAGGATTTTTTACAGTTTATGAAGTGAATGAA
TCCTCCTGCACAATAAAATGGGACTACTCTTTCATAACATTCCATCCATA
TGGATTAGCTGGTTTGGTTATTGATCATAAAAATGGGTTATTGGTTGCAG
CTGGGAATTATGGGAAGGAACCATTTCCTAATGTCATGGGAGATGCATGT
TATGGATCATATTCTGGTATCAGTCTCTGGAGATTTTTGAATGACACACC
TCATCTAACTCTGGTTGAAGACCAGGGAAAAGCTTTGAAGAAGGTATCCA
GAGGTGAATGGTTAAAGAGTGTTGTTTTAAGACGTGGCGATGAAAAAAAC
GAAATGTTGAAGCATGGTATTTACAAGTTGAAATTGTCAGAAGATGGTAC
ACAAATTGTCACACTGCATCTTGATGGTCGCATATCTTTTTGGAGTATCC
CGTCAATGAGGCTAATCAAAACTTGGAGTAAATCTGAACAACCTGATGCA
AGTGGCGGCTCAAGTGAAGGGTTCTCCTTTGACTCGCAGAAAAAAGAAGa
TCTCACCAAAACAAGGAATTCAATAGATGTCAGCTGGTGGTCTGAAAAGG
AGATTGCTTTGGCATCTGGGAGGGGTGATGTAACGATTGCTTCGACTGAC
AGCTTGAAGAATTTACTTGGAGAGTCGAGTGAGAAATTTGATCCATGGCC
GTCACTCAGCCAAGTGGTGGATGGAAGCATTCTTGTGCTCGAGTGTGAGA
AACGAGTGAACGATCCAAACAACAAAACGAAGACATCTTGGAAATGGACT
TCAGAAGAAGATGAAAGCCAAGATGAAGTGAACTCGATTCGTTATCGATT
CAAAGAACTCACTAAACAGATGTTATATTTCATCACTGAGGCTGAAAGGT
TTTTACCAGCTGTCAAGCCTCCAAGAATTTTAACCAACGTTTATCGTTTA
CTATGCTTGAAATCTACAACACCCGAAGAATTATACACGCGGAAAATCAA
TCTTGAACATTACGGAGAGGCCTTGGACCTAGCTAAACGTTTTGGTTTGA
ATACTGATTTAGTTTATCAGCGACAGTGGAAAAAGAAAAGAGTTTCGAAG
ATTACCATTCATGATTATCtgtcCAAGATTAAAGATCGATATTGGGTTTT
GGACGAGTGCCTTTTACGAGTTGCCGATGACTTTGACTCGACAGAAGAGT
TACTGAAATACGGTTTACTCGGTACAAGTTGGGAAATCTTGCAAAGGATT
GATGAAGAGGGTAAAGGTGatgcaaaggatgatgggaAGTTATTACCTTT
TAAATTTGACGCCGCCCCACATGACGAGGATGACGAAAACTCAAGTAGAG
AATTCCAAgggagTCTAACGAAGAAGCAATTGAAAATCTGCCAATATCGA
CGGCAATTATTACATTATCTTGATCGGCTTTCCACTTATGAGGTTGTTTT
GGGAGGCTCATTCAAAGCACGAGATAAATTCTCAAAAGAGTATTTTACCA
AATTTCGATCGTGCAATATGGTACACCAAGCGGTCGAGTGTGCCCGCGAC
GAGGACGCTTATACTCTGGAGCATTTGTTTTCGTACCATGGGAAGCAGTT
ACTACCTTATTGGCTGCCGATATTATCAAACTTCCCGGAAACAACCGATA
TCCGATATTTTGAGCCGGTCATCCCTGAGATTGGAGAGCCACCAGAAGAT
CCAGAGATTTTACCTTGGTTAGAGAAACACCATCGTGAAGAGGATTGGGT
CGAGCAATCGAATATTGTCCAACAAATCAAGTCTAATGAAGAAGGTGACG
CAAACGAAGATATAGGCTCATTCATTTTCGAATCCGATCCAGAGATacga
aaattttacaaatgtGAAACAAAAGCTCAACTGAGAGAATGGTTTTTACA
TCGTGTACACTTGATTGATGAATATTCCGGTCAGATTGATAAATGTTGCG
AGCTGTTAGATGTGGGAATCAAAAGAGGCTTGGAAGGGCTCACTAAGGTT
CACCAAGAAATGGAAGCATGGAGACTCTTAGTTTACGACGTTGGAATTGA
CAGTAAAATGACTGCAAAGAGTTTCGTGGAATTATCTGAATCATCGAAAA
TCAAATTGCTAATGTTCAAAACCTCAGATGTGACATTCGTTAACGATTTC
AAGCTATATCTAATGCCGTATTTAAGAAATATTGGAAAGAAGGATTTTAA
GAAACGCCAAGATTTACTTCATGAGTTTTTGGTGGAAATCGCTAAAACTG
ATTTGACATGCTGCTTGAAGTTATTGGAAAAGTGTTCGCCAGAGCTGCCA
GAACCACTGCTTCCTGATATGGCGGAGATAATGAAGATTGGGATTGATTG
CGTTTACGCGTGCAAGAGAACGGATCAATTGAATCATTGTTTCAGCATTG
TCGAATGTTTGCCTTCGAGAGAAGAGGGAGTCATTAGCCGTCCCGTGGAA
GAGCTTCACATACAACTGGATCAATTGGAACATTTGCTGACAGGAGCGGA
AATTTTACAGTATTACAACAACCCTCAGACCATCTCTTACATTTCTGAAA
TTAAAGATGACTCTACTATTTGTAAACAACTCATTCAGCAATTGGTGAAA
AACGCTGTTTGTAAAGGACGTTGTGTTCCAAAGGAATTGAACAAATTACT
CGGACATTTGATCAAGCTTTCCAAAGAAGTTTTCCGGTGCTGTGATATCA
AGATCGTTCACCAGATTTTCGTTGAAGAATTACTACGGTCCGGTTCACGT
GAGAACATAACAGTAGCTGAAGAGTTGATCACGCCTTCCAAACTTGCCGG
GAATTCACCTCAAAGTAAGAAACCAGAACAACATTTGACGTCTGCACTCT
ACCTCCTCAAATATGATGTTTCGGTTACCGTTGTGTTGGAAGCGAGTCGT
GAATATTTCAATGCAGCAATGTCGGGTAATGACTCTTCAATGGAACTGGC
TAGATTGTGTCTAACATTGGTCAAAGATTGTCCAGAGAGTGTTCAAGATG
AATTGGATTTGATCAACTCGTTGGGTTTATTGTATGAATTCAATGTATCC
ATGCTACCCTTACAAGTTCGCCTTTGCGCTGATAAATTGGAAATTATCGA
TCTTTGTTTGAAGGAGAAGAAGAATGGGTACAAGAAAAAAGACAAGCTCA
TCCAATTGAGTAATCTTTTGCAAATCTGTGGCCATGACAACAAAGAACGG
ATTGGACAAGTCAATATTAAAATTGCTGAATCAGCATTTGAACATAAAGA
TTACACATACGCTGGTATCGTTTGTGTACAATTGGTGGATGATAATTATT
CTAATGCTTGGTATATTTGCAGGAAACTTGGTGAATGTGCTAAATATACC
AACTTCACAATCAGGCAAAAGTTGTTGAGTTTTGCGTTAACTTATTGTCC
AGTACATCACATTGAAGAAGTTTTACAAGAGAAAACTCAACTGGAAACCC
AGGTTTTGTACGAGAGGTTGGGTGTATTTACGAAAGAAGGCAAGAAAGAC
AAAATTGTGACCTCATCTAAGAAAGAAACTGAGGAAGAAAACGACGAAGA
CAATGTTGATGGGAATAACATATCAATCCTCAACAAGACCAAAACTACAA
CAAAGAAATTGATTTCAAGCGTCGCCAGCGTGGCTGATAACCGCTGGGTT
GGATCCGCAATGAATTGGGTCAAACCGTCGTCGGAAGGGTCTGGTAACGA
AGTTGATGTTGTTGAGCGGGAAATTGAAAGCGTTCGGCATAACCCATTTT
ATAGTTCGCTGGATTCGAAAAAGATTGACGAAGATGTTCAAAGATTTAAT
TATAACGAGTTCAGCGACCATTTGAGGTGCGTCACAACCGAAGAAAAAGT
ATTCAATCAGCTGGTGTTAAGAAGTCAAAAATTGAACGAGCAAAGAACCC
TGGGTAAAGAGCTCGAAAACACTGACCAAGCAATGCTATCGTTGAGTGAT
ATAGCTTATACTGAAGAAAGTTGTTTGTGTCTGGCTTACATGATGGCTAT
TTCTCAGCCAAAAGAAATCCATTCCCTATCGACCAAGCATCGGAAAAACA
CTTTCACTTTCCTTTTCACTGCTTATTACTATGCATTACAAGAATAtgtt
aaaaacaacaaaatcgAATTCGATAAACAAGCACAGATTTACAGCGCGCC
TCCGATTGATGTGATTACATGGATGCTAAAAGTGTTAGGTAAGAAGCAAG
gagaaaaggaagaaaaagaaaaaggagagACTTACTTTCTGTCTAACATG
AACAAGTTGCAAGACTTGATGCAAGCAAAGATGCTACAAGCTCTTGACAA
AGgaGTGGACATCGAAAGATTTTCAGTTGATAATGAATATAAACGTGAAA
CTATACTCGGATTAGCTATGAGTGTCGAAGACGAGTTGATTAACACAAGT
TTGCTGCTAGCAGAGAAATATGATATCCCCGCATGGGAAGTGTTGTTATC
ACACGTGGAATTTTTATTCACTGATAGTGGTCTAAAAGCCAAAGCTATCC
GCGAATCACTAAACAAATGGAAAGTTGATTCCCATTTGAAACCGAACGGT
GATAAAGTCTTTGAGCGGATGAAGAAATATGTTTACCCAGAAATCAATGG
TAAAGACCACAATGCATTGCTGTTGTTCTACGTTTTCCTAATGAATTGCA
GCTCGCCCACTAAAATATTGGAGGGTACGCTTACATTAGATGCTCATTCc
aaacttttgaagaaaatcaaGGCTGCTGCATCATCCATCAATTACAAACT
TCTCGTGCATGGAGATTCACCTTTGGAGGTGATTAGAGACTGTGTTGATG
ATAACAATGTACATTTGTTGGCTAAAATTGCATCCAAAATCCCCCAGGCG
GATGGTAGTTACCTGTCATCAAACAAGATCTTCTTAGCAAACGCCATTCG
GatgttttggaagaaaaaagaGAACAAGGATTGGTTGAATACATTCGAAA
ACTGTAAACAACACTTCACCAAACTCCTGATAGAAGACGTTGTCACTTTT
GCTGACCATGCAATTTTTGGCGAGGAAGCTTTAGACTCGCTGACCCAAGA
CACCAGACTGGAGATTGGTAAAAGAGtaataaaatatttgagacaacaAC
GTGGTCAAGACGAGACCAAACAAAGAGGAGCTGACGATTATGATTCGCTT
ATGGAGCGCTACGATTCATCTATCAATGATTTGGAACTTTCCATCGAACA
TCTCAAAACGCTGACTGATCCAATTTTCAAAGCAGTCTTTGGTGACGATA
ACGAACTGAGCAAAACCTTTGGACGAGTATACGACTTATCACGTGGTCGA
AAACAACCACTCGAAAAACTATTCCGTGATTTGTTCATATCGNTACAACC
ATTAGACAAAATTTCGAAACTGCGGAGTCTTTGTCGCAATGCATCTATTG
ACGTCCGCACGTGTTTCCAAGATGCTTTGCGCGGGATCCTGAGTGACATC
CAAAGCGATAGAGATTACACAAAACTACAGACTTTAACGGAGAACATCAA
AGCGCATCAAGAACATCAAACAGACCCTCTTGTTACCCATAGCGACGTCT
TAGATGTGGTGCGGCCATTTTGTTCTGATGTTACAGCTAGCACGGATGTG
AAGAGTCACGTGTTACATNTTTTGTTCTGAatggaaGAAAATGAGCAAAT
ATTGTATGATTTGATTGTTCACGAAGAATGGAAACAAGAACCACAGTTGT
TGGACCAAGTTGAAAGTTATTTTTGGCAATATCGTGGTTCACTTCTAAAG
AAGCTATGGAAAGTTTCACAAAGTTCTGCAATTTATATGTGGGACAACTT
GAAGACACAATTCAGATATCAAGCTACCTTTGGTTGCCCACCATTGAATT
TTATCAATCTGATGAACAATTGCTTGCCATGGCTTATGGCTTTGTCACCG
GATGGAAATTTTATTGCCATCCTTCAAGATTCTGTTATTGAAATAAGGAC
TGCTGGAAATTTTGAGCAAGTCATTACAAAATATAAGATTGAAAAAGATA
TGTTTCCAAGATGGCGTAAATTGATTTGGAATCATGACAACACCTTACTT
TGTTATTCAAACAGTTTTGGAGATTTGACCATTTTGGATATTACCGGCac
taaaaaacattttattccaTCATCAAATAATGTCAAGTTAAAAGTGCCTG
GAACGCTGAGTTTGGCATTGTGTCATGTTGAATTTGTAGCCAAAGGAAAT
agCTTCTTGTTATATACCTGCACCTATCAAGGATTTTTTACAGTTTATGA
AGTGAATGAATCCTCCTGCACAATAAAATGGGACTACTCTTTCATAACAT
TCCATCCATATGGATTAGCTGGTTTGGTTATTGATCATAAAAATGGGTTA
TTGGTTGCAGCTGGGAATTATGGGAAGGAACCATTTCCTAATGTCATGGG
AGATGCATGTTATGGATCATATTCTGGTATCAGTCTCTGGAGATTTTTGA
ATGACACACCTCATCTAACTCTGGTTGAAGACCAGGGAAAAGCTTTGAAG
AAGGTATCCAGAGGTGAATGGTTAAAGAGTGTTGTTTTAAGACGTGGCGA
TGAAAAAAACGAAATGTTGAAGCATGGTATTTACAAGTTGAAATTGTCAG
AAGATGGTACACAAATTGTCACACTGCATCTTGATGGTCGCATATCTTTT
TGGAGTATCCCGTCAATGAGGCTAATCAAAACTTGGAGTAAATCTGAACA
ACCTGATGCAAGTGGCGGCTCAAGTGAAGGGTTCTCCTTTGACTCGCAGA
AAAAAGAAGaTCTCACCAAAACAAGGAATTCAATAGATGTCAGCTGGTGG
TCTGAAAAGGAGATTGCTTTGGCATCTGGGAGGGGTGATGTAACGATTGC
TTCGACTGACAGCTTGAAGAATTTACTTGGAGAGTCGAGTGAGAAATTTG
ATCCATGGCCGTCACTCAGCCAAGTGGTGGATGGAAGCATTCTTGTGCTC
GAGTGTGAGAAACGAGTGAACGATCCAAACAACAAAACGAAGACATCTTG
GAAATGGACTTCAGAAGAAGATGAAAGCCAAGATGAAGTGAACTCGATTC
GTTATCGATTCAAAGAACTCACTAAACAGATGTTATATTTCATCACTGAG
GCTGAAAGGTTTTTACCAGCTGTCAAGCCTCCAAGAATTTTAACCAACGT
TTATCGTTTACTATGCTTGAAATCTACAACACCCGAAGAATTATACACGC
GGAAAATCAATCTTGAACATTACGGAGAGGCCTTGGACCTAGCTAAACGT
TTTGGTTTGAATACTGATTTAGTTTATCAGCGACAGTGGAAAAAGAAAAG
AGTTTCGAAGATTACCATTCATGATTATCtgtcCAAGATTAAAGATCGAT
ATTGGGTTTTGGACGAGTGCCTTTTACGAGTTGCCGATGACTTTGACTCG
ACAGAAGAGTTACTGAAATACGGTTTACTCGGTACAAGTTGGGAAATCTT
GCAAAGGATTGATGAAGAGGGTAAAGGTGatgcaaaggatgatgggaAGT
TATTACCTTTTAAATTTGACGCCGCCCCACATGACGAGGATGACGAAAAC
TCAAGTAGAGAATTCCAAgggagTCTAACGAAGAAGCAATTGAAAATCTG
CCAATATCGACGGCAATTATTACATTATCTTGATCGGCTTTCCACTTATG
AGGTTGTTTTGGGAGGCTCATTCAAAGCACGAGATAAATTCTCAAAAGAG
TATTTTACCAAATTTCGATCGTGCAATATGGTACACCAAGCGGTCGAGTG
TGCCCGCGACGAGGACGCTTATACTCTGGAGCATTTGTTTTCGTACCATG
GGAAGCAGTTACTACCTTATTGGCTGCCGATATTATCAAACTTCCCGGAA
ACAACCGATATCCGATATTTTGAGCCGGTCATCCCTGAGATTGGAGAGCC
ACCAGAAGATCCAGAGATTTTACCTTGGTTAGAGAAACACCATCGTGAAG
AGGATTGGGTCGAGCAATCGAATATTGTCCAACAAATCAAGTCTAATGAA
GAAGGTGACGCAAACGAAGATATAGGCTCATTCATTTTCGAATCCGATCC
AGAGATacgaaaattttacaaatgtGAAACAAAAGCTCAACTGAGAGAAT
GGTTTTTACATCGTGTACACTTGATTGATGAATATTCCGGTCAGATTGAT
AAATGTTGCGAGCTGTTAGATGTGGGAATCAAAAGAGGCTTGGAAGGGCT
CACTAAGGTTCACCAAGAAATGGAAGCATGGAGACTCTTAGTTTACGACG
TTGGAATTGACAGTAAAATGACTGCAAAGAGTTTCGTGGAATTATCTGAA
TCATCGAAAATCAAATTGCTAATGTTCAAAACCTCAGATGTGACATTCGT
TAACGATTTCAAGCTATATCTAATGCCGTATTTAAGAAATATTGGAAAGA
AGGATTTTAAGAAACGCCAAGATTTACTTCATGAGTTTTTGGTGGAAATC
GCTAAAACTGATTTGACATGCTGCTTGAAGTTATTGGAAAAGTGTTCGCC
AGAGCTGCCAGAACCACTGCTTCCTGATATGGCGGAGATAATGAAGATTG
GGATTGATTGCGTTTACGCGTGCAAGAGAACGGATCAATTGAATCATTGT
TTCAGCATTGTCGAATGTTTGCCTTCGAGAGAAGAGGGAGTCATTAGCCG
TCCCGTGGAAGAGCTTCACATACAACTGGATCAATTGGAACATTTGCTGA
CAGGAGCGGAAATTTTACAGTATTACAACAACCCTCAGACCATCTCTTAC
ATTTCTGAAATTAAAGATGACTCTACTATTTGTAAACAACTCATTCAGCA
ATTGGTGAAAAACGCTGTTTGTAAAGGACGTTGTGTTCCAAAGGAATTGA
ACAAATTACTCGGACATTTGATCAAGCTTTCCAAAGAAGTTTTCCGGTGC
TGTGATATCAAGATCGTTCACCAGATTTTCGTTGAAGAATTACTACGGTC
CGGTTCACGTGAGAACATAACAGTAGCTGAAGAGTTGATCACGCCTTCCA
AACTTGCCGGGAATTCACCTCAAAGTAAGAAACCAGAACAACATTTGACG
TCTGCACTCTACCTCCTCAAATATGATGTTTCGGTTACCGTTGTGTTGGA
AGCGAGTCGTGAATATTTCAATGCAGCAATGTCGGGTAATGACTCTTCAA
TGGAACTGGCTAGATTGTGTCTAACATTGGTCAAAGATTGTCCAGAGAGT
GTTCAAGATGAATTGGATTTGATCAACTCGTTGGGTTTATTGTATGAATT
CAATGTATCCATGCTACCCTTACAAGTTCGCCTTTGCGCTGATAAATTGG
AAATTATCGATCTTTGTTTGAAGGAGAAGAAGAATGGGTACAAGAAAAAA
GACAAGCTCATCCAATTGAGTAATCTTTTGCAAATCTGTGGCCATGACAA
CAAAGAACGGATTGGACAAGTCAATATTAAAATTGCTGAATCAGCATTTG
AACATAAAGATTACACATACGCTGGTATCGTTTGTGTACAATTGGTGGAT
GATAATTATTCTAATGCTTGGTATATTTGCAGGAAACTTGGTGAATGTGC
TAAATATACCAACTTCACAATCAGGCAAAAGTTGTTGAGTTTTGCGTTAA
CTTATTGTCCAGTACATCACATTGAAGAAGTTTTACAAGAGAAAACTCAA
CTGGAAACCCAGGTTTTGTACGAGAGGTTGGGTGTATTTACGAAAGAAGG
CAAGAAAGACAAAATTGTGACCTCATCTAAGAAAGAAACTGAGGAAGAAA
ACGACGAAGACAATGTTGATGGGAATAACATATCAATCCTCAACAAGACC
AAAACTACAACAAAGAAATTGATTTCAAGCGTCGCCAGCGTGGCTGATAA
CCGCTGGGTTGGATCCGCAATGAATTGGGTCAAACCGTCGTCGGAAGGGT
CTGGTAACGAAGTTGATGTTGTTGAGCGGGAAATTGAAAGCGTTCGGCAT
AACCCATTTTATAGTTCGCTGGATTCGAAAAAGATTGACGAAGATGTTCA
AAGATTTAATTATAACGAGTTCAGCGACCATTTGAGGTGCGTCACAACCG
AAGAAAAAGTATTCAATCAGCTGGTGTTAAGAAGTCAAAAATTGAACGAG
CAAAGAACCCTGGGTAAAGAGCTCGAAAACACTGACCAAGCAATGCTATC
GTTGAGTGATATAGCTTATACTGAAGAAAGTTGTTTGTGTCTGGCTTACA
TGATGGCTATTTCTCAGCCAAAAGAAATCCATTCCCTATCGACCAAGCAT
CGGAAAAACACTTTCACTTTCCTTTTCACTGCTTATTACTATGCATTACA
AGAATAtgttaaaaacaacaaaatcgAATTCGATAAACAAGCACAGATTT
ACAGCGCGCCTCCGATTGATGTGATTACATGGATGCTAAAAGTGTTAGGT
AAGAAGCAAGgagaaaaggaagaaaaagaaaaaggagagACTTACTTTCT
GTCTAACATGAACAAGTTGCAAGACTTGATGCAAGCAAAGATGCTACAAG
CTCTTGACAAAGgaGTGGACATCGAAAGATTTTCAGTTGATAATGAATAT
AAACGTGAAACTATACTCGGATTAGCTATGAGTGTCGAAGACGAGTTGAT
TAACACAAGTTTGCTGCTAGCAGAGAAATATGATATCCCCGCATGGGAAG
TGTTGTTATCACACGTGGAATTTTTATTCACTGATAGTGGTCTAAAAGCC
AAAGCTATCCGCGAATCACTAAACAAATGGAAAGTTGATTCCCATTTGAA
ACCGAACGGTGATAAAGTCTTTGAGCGGATGAAGAAATATGTTTACCCAG
AAATCAATGGTAAAGACCACAATGCATTGCTGTTGTTCTACGTTTTCCTA
ATGAATTGCAGCTCGCCCACTAAAATATTGGAGGGTACGCTTACATTAGA
TGCTCATTCcaaacttttgaagaaaatcaaGGCTGCTGCATCATCCATCA
ATTACAAACTTCTCGTGCATGGAGATTCACCTTTGGAGGTGATTAGAGAC
TGTGTTGATGATAACAATGTACATTTGTTGGCTAAAATTGCATCCAAAAT
CCCCCAGGCGGATGGTAGTTACCTGTCATCAAACAAGATCTTCTTAGCAA
ACGCCATTCGGatgttttggaagaaaaaagaGAACAAGGATTGGTTGAAT
ACATTCGAAAACTGTAAACAACACTTCACCAAACTCCTGATAGAAGACGT
TGTCACTTTTGCTGACCATGCAATTTTTGGCGAGGAAGCTTTAGACTCGC
TGACCCAAGACACCAGACTGGAGATTGGTAAAAGAGtaataaaatatttg
agacaacaACGTGGTCAAGACGAGACCAAACAAAGAGGAGCTGACGATTA
TGATTCGCTTATGGAGCGCTACGATTCATCTATCAATGATTTGGAACTTT
CCATCGAACATCTCAAAACGCTGACTGATCCAATTTTCAAAGCAGTCTTT
GGTGACGATAACGAACTGAGCAAAACCTTTGGACGAGTATACGACTTATC
ACGTGGTCGAAAACAACCACTCGAAAAACTATTCCGTGATTTGTTCATAT
CGNTACAACCATTAGACAAAATTTCGAAACTGCGGAGTCTTTGTCGCAAT
GCATCTATTGACGTCCGCACGTGTTTCCAAGATGCTTTGCGCGGGATCCT
GAGTGACATCCAAAGCGATAGAGATTACACAAAACTACAGACTTTAACGG
AGAACATCAAAGCGCATCAAGAACATCAAACAGACCCTCTTGTTACCCAT
AGCGACGTCTTAGATGTGGTGCGGCCATTTTGTTCTGATGTTACAGCTAG
CACGGATGTGAAGAGTCACGTGTTACATNTTTTGTTCTGAatggaaGAAA
ATGAGCAAATATTGTATGATTTGATTGTTCACGAAGAATGGAAACAAGAA
CCACAGTTGTTGGACCAAGTTGAAAGTTATTTTTGGCAATATCGTGGTTC
ACTTCTAAAGAAGCTATGGAAAGTTTCACAAAGTTCTGCAATTTATATGT
GGGACAACTTGAAGACACAATTCAGATATCAAGCTACCTTTGGTTGCCCA
CCATTGAATTTTATCAATCTGATGAACAATTGCTTGCCATGGCTTATGGC
TTTGTCACCGGATGGAAATTTTATTGCCATCCTTCAAGATTCTGTTATTG
AAATAAGGACTGCTGGAAATTTTGAGCAAGTCATTACAAAATATAAGATT
GAAAAAGATATGTTTCCAAGATGGCGTAAATTGATTTGGAATCATGACAA
CACCTTACTTTGTTATTCAAACAGTTTTGGAGATTTGACCATTTTGGATA
TTACCGGCactaaaaaacattttattccaTCATCAAATAATGTCAAGTTA
AAAGTGCCTGGAACGCTGAGTTTGGCATTGTGTCATGTTGAATTTGTAGC
CAAAGGAAATagCTTCTTGTTATATACCTGCACCTATCAAGGATTTTTTA
CAGTTTATGAAGTGAATGAATCCTCCTGCACAATAAAATGGGACTACTCT
TTCATAACATTCCATCCATATGGATTAGCTGGTTTGGTTATTGATCATAA
AAATGGGTTATTGGTTGCAGCTGGGAATTATGGGAAGGAACCATTTCCTA
ATGTCATGGGAGATGCATGTTATGGATCATATTCTGGTATCAGTCTCTGG
AGATTTTTGAATGACACACCTCATCTAACTCTGGTTGAAGACCAGGGAAA
AGCTTTGAAGAAGGTATCCAGAGGTGAATGGTTAAAGAGTGTTGTTTTAA
GACGTGGCGATGAAAAAAACGAAATGTTGAAGCATGGTATTTACAAGTTG
AAATTGTCAGAAGATGGTACACAAATTGTCACACTGCATCTTGATGGTCG
CATATCTTTTTGGAGTATCCCGTCAATGAGGCTAATCAAAACTTGGAGTA
AATCTGAACAACCTGATGCAAGTGGCGGCTCAAGTGAAGGGTTCTCCTTT
GACTCGCAGAAAAAAGAAGaTCTCACCAAAACAAGGAATTCAATAGATGT
CAGCTGGTGGTCTGAAAAGGAGATTGCTTTGGCATCTGGGAGGGGTGATG
TAACGATTGCTTCGACTGACAGCTTGAAGAATTTACTTGGAGAGTCGAGT
GAGAAATTTGATCCATGGCCGTCACTCAGCCAAGTGGTGGATGGAAGCAT
TCTTGTGCTCGAGTGTGAGAAACGAGTGAACGATCCAAACAACAAAACGA
AGACATCTTGGAAATGGACTTCAGAAGAAGATGAAAGCCAAGATGAAGTG
AACTCGATTCGTTATCGATTCAAAGAACTCACTAAACAGATGTTATATTT
CATCACTGAGGCTGAAAGGTTTTTACCAGCTGTCAAGCCTCCAAGAATTT
TAACCAACGTTTATCGTTTACTATGCTTGAAATCTACAACACCCGAAGAA
TTATACACGCGGAAAATCAATCTTGAACATTACGGAGAGGCCTTGGACCT
AGCTAAACGTTTTGGTTTGAATACTGATTTAGTTTATCAGCGACAGTGGA
AAAAGAAAAGAGTTTCGAAGATTACCATTCATGATTATCtgtcCAAGATT
AAAGATCGATATTGGGTTTTGGACGAGTGCCTTTTACGAGTTGCCGATGA
CTTTGACTCGACAGAAGAGTTACTGAAATACGGTTTACTCGGTACAAGTT
GGGAAATCTTGCAAAGGATTGATGAAGAGGGTAAAGGTGatgcaaaggat
gatgggaAGTTATTACCTTTTAAATTTGACGCCGCCCCACATGACGAGGA
TGACGAAAACTCAAGTAGAGAATTCCAAgggagTCTAACGAAGAAGCAAT
TGAAAATCTGCCAATATCGACGGCAATTATTACATTATCTTGATCGGCTT
TCCACTTATGAGGTTGTTTTGGGAGGCTCATTCAAAGCACGAGATAAATT
CTCAAAAGAGTATTTTACCAAATTTCGATCGTGCAATATGGTACACCAAG
CGGTCGAGTGTGCCCGCGACGAGGACGCTTATACTCTGGAGCATTTGTTT
TCGTACCATGGGAAGCAGTTACTACCTTATTGGCTGCCGATATTATCAAA
CTTCCCGGAAACAACCGATATCCGATATTTTGAGCCGGTCATCCCTGAGA
TTGGAGAGCCACCAGAAGATCCAGAGATTTTACCTTGGTTAGAGAAACAC
CATCGTGAAGAGGATTGGGTCGAGCAATCGAATATTGTCCAACAAATCAA
GTCTAATGAAGAAGGTGACGCAAACGAAGATATAGGCTCATTCATTTTCG
AATCCGATCCAGAGATacgaaaattttacaaatgtGAAACAAAAGCTCAA
CTGAGAGAATGGTTTTTACATCGTGTACACTTGATTGATGAATATTCCGG
TCAGATTGATAAATGTTGCGAGCTGTTAGATGTGGGAATCAAAAGAGGCT
TGGAAGGGCTCACTAAGGTTCACCAAGAAATGGAAGCATGGAGACTCTTA
GTTTACGACGTTGGAATTGACAGTAAAATGACTGCAAAGAGTTTCGTGGA
ATTATCTGAATCATCGAAAATCAAATTGCTAATGTTCAAAACCTCAGATG
TGACATTCGTTAACGATTTCAAGCTATATCTAATGCCGTATTTAAGAAAT
ATTGGAAAGAAGGATTTTAAGAAACGCCAAGATTTACTTCATGAGTTTTT
GGTGGAAATCGCTAAAACTGATTTGACATGCTGCTTGAAGTTATTGGAAA
AGTGTTCGCCAGAGCTGCCAGAACCACTGCTTCCTGATATGGCGGAGATA
ATGAAGATTGGGATTGATTGCGTTTACGCGTGCAAGAGAACGGATCAATT
GAATCATTGTTTCAGCATTGTCGAATGTTTGCCTTCGAGAGAAGAGGGAG
TCATTAGCCGTCCCGTGGAAGAGCTTCACATACAACTGGATCAATTGGAA
CATTTGCTGACAGGAGCGGAAATTTTACAGTATTACAACAACCCTCAGAC
CATCTCTTACATTTCTGAAATTAAAGATGACTCTACTATTTGTAAACAAC
TCATTCAGCAATTGGTGAAAAACGCTGTTTGTAAAGGACGTTGTGTTCCA
AAGGAATTGAACAAATTACTCGGACATTTGATCAAGCTTTCCAAAGAAGT
TTTCCGGTGCTGTGATATCAAGATCGTTCACCAGATTTTCGTTGAAGAAT
TACTACGGTCCGGTTCACGTGAGAACATAACAGTAGCTGAAGAGTTGATC
ACGCCTTCCAAACTTGCCGGGAATTCACCTCAAAGTAAGAAACCAGAACA
ACATTTGACGTCTGCACTCTACCTCCTCAAATATGATGTTTCGGTTACCG
TTGTGTTGGAAGCGAGTCGTGAATATTTCAATGCAGCAATGTCGGGTAAT
GACTCTTCAATGGAACTGGCTAGATTGTGTCTAACATTGGTCAAAGATTG
TCCAGAGAGTGTTCAAGATGAATTGGATTTGATCAACTCGTTGGGTTTAT
TGTATGAATTCAATGTATCCATGCTACCCTTACAAGTTCGCCTTTGCGCT
GATAAATTGGAAATTATCGATCTTTGTTTGAAGGAGAAGAAGAATGGGTA
CAAGAAAAAAGACAAGCTCATCCAATTGAGTAATCTTTTGCAAATCTGTG
GCCATGACAACAAAGAACGGATTGGACAAGTCAATATTAAAATTGCTGAA
TCAGCATTTGAACATAAAGATTACACATACGCTGGTATCGTTTGTGTACA
ATTGGTGGATGATAATTATTCTAATGCTTGGTATATTTGCAGGAAACTTG
GTGAATGTGCTAAATATACCAACTTCACAATCAGGCAAAAGTTGTTGAGT
TTTGCGTTAACTTATTGTCCAGTACATCACATTGAAGAAGTTTTACAAGA
GAAAACTCAACTGGAAACCCAGGTTTTGTACGAGAGGTTGGGTGTATTTA
CGAAAGAAGGCAAGAAAGACAAAATTGTGACCTCATCTAAGAAAGAAACT
GAGGAAGAAAACGACGAAGACAATGTTGATGGGAATAACATATCAATCCT
CAACAAGACCAAAACTACAACAAAGAAATTGATTTCAAGCGTCGCCAGCG
TGGCTGATAACCGCTGGGTTGGATCCGCAATGAATTGGGTCAAACCGTCG
TCGGAAGGGTCTGGTAACGAAGTTGATGTTGTTGAGCGGGAAATTGAAAG
CGTTCGGCATAACCCATTTTATAGTTCGCTGGATTCGAAAAAGATTGACG
AAGATGTTCAAAGATTTAATTATAACGAGTTCAGCGACCATTTGAGGTGC
GTCACAACCGAAGAAAAAGTATTCAATCAGCTGGTGTTAAGAAGTCAAAA
ATTGAACGAGCAAAGAACCCTGGGTAAAGAGCTCGAAAACACTGACCAAG
CAATGCTATCGTTGAGTGATATAGCTTATACTGAAGAAAGTTGTTTGTGT
CTGGCTTACATGATGGCTATTTCTCAGCCAAAAGAAATCCATTCCCTATC
GACCAAGCATCGGAAAAACACTTTCACTTTCCTTTTCACTGCTTATTACT
ATGCATTACAAGAATAtgttaaaaacaacaaaatcgAATTCGATAAACAA
GCACAGATTTACAGCGCGCCTCCGATTGATGTGATTACATGGATGCTAAA
AGTGTTAGGTAAGAAGCAAGgagaaaaggaagaaaaagaaaaaggagagA
CTTACTTTCTGTCTAACATGAACAAGTTGCAAGACTTGATGCAAGCAAAG
ATGCTACAAGCTCTTGACAAAGgaGTGGACATCGAAAGATTTTCAGTTGA
TAATGAATATAAACGTGAAACTATACTCGGATTAGCTATGAGTGTCGAAG
ACGAGTTGATTAACACAAGTTTGCTGCTAGCAGAGAAATATGATATCCCC
GCATGGGAAGTGTTGTTATCACACGTGGAATTTTTATTCACTGATAGTGG
TCTAAAAGCCAAAGCTATCCGCGAATCACTAAACAAATGGAAAGTTGATT
CCCATTTGAAACCGAACGGTGATAAAGTCTTTGAGCGGATGAAGAAATAT
GTTTACCCAGAAATCAATGGTAAAGACCACAATGCATTGCTGTTGTTCTA
CGTTTTCCTAATGAATTGCAGCTCGCCCACTAAAATATTGGAGGGTACGC
TTACATTAGATGCTCATTCcaaacttttgaagaaaatcaaGGCTGCTGCA
TCATCCATCAATTACAAACTTCTCGTGCATGGAGATTCACCTTTGGAGGT
GATTAGAGACTGTGTTGATGATAACAATGTACATTTGTTGGCTAAAATTG
CATCCAAAATCCCCCAGGCGGATGGTAGTTACCTGTCATCAAACAAGATC
TTCTTAGCAAACGCCATTCGGatgttttggaagaaaaaagaGAACAAGGA
TTGGTTGAATACATTCGAAAACTGTAAACAACACTTCACCAAACTCCTGA
TAGAAGACGTTGTCACTTTTGCTGACCATGCAATTTTTGGCGAGGAAGCT
TTAGACTCGCTGACCCAAGACACCAGACTGGAGATTGGTAAAAGAGtaat
aaaatatttgagacaacaACGTGGTCAAGACGAGACCAAACAAAGAGGAG
CTGACGATTATGATTCGCTTATGGAGCGCTACGATTCATCTATCAATGAT
TTGGAACTTTCCATCGAACATCTCAAAACGCTGACTGATCCAATTTTCAA
AGCAGTCTTTGGTGACGATAACGAACTGAGCAAAACCTTTGGACGAGTAT
ACGACTTATCACGTGGTCGAAAACAACCACTCGAAAAACTATTCCGTGAT
TTGTTCATATCGNTACAACCATTAGACAAAATTTCGAAACTGCGGAGTCT
TTGTCGCAATGCATCTATTGACGTCCGCACGTGTTTCCAAGATGCTTTGC
GCGGGATCCTGAGTGACATCCAAAGCGATAGAGATTACACAAAACTACAG
ACTTTAACGGAGAACATCAAAGCGCATCAAGAACATCAAACAGACCCTCT
TGTTACCCATAGCGACGTCTTAGATGTGGTGCGGCCATTTTGTTCTGATG
TTACAGCTAGCACGGATGTGAAGAGTCACGTGTTACATNTTTTGTTCTGA
atggaaGAAAATGAGCAAATATTGTATGATTTGATTGTTCACGAAGAATG
GAAACAAGAACCACAGTTGTTGGACCAAGTTGAAAGTTATTTTTGGCAAT
ATCGTGGTTCACTTCTAAAGAAGCTATGGAAAGTTTCACAAAGTTCTGCA
ATTTATATGTGGGACAACTTGAAGACACAATTCAGATATCAAGCTACCTT
TGGTTGCCCACCATTGAATTTTATCAATCTGATGAACAATTGCTTGCCAT
GGCTTATGGCTTTGTCACCGGATGGAAATTTTATTGCCATCCTTCAAGAT
TCTGTTATTGAAATAAGGACTGCTGGAAATTTTGAGCAAGTCATTACAAA
ATATAAGATTGAAAAAGATATGTTTCCAAGATGGCGTAAATTGATTTGGA
ATCATGACAACACCTTACTTTGTTATTCAAACAGTTTTGGAGATTTGACC
ATTTTGGATATTACCGGCactaaaaaacattttattccaTCATCAAATAA
TGTCAAGTTAAAAGTGCCTGGAACGCTGAGTTTGGCATTGTGTCATGTTG
AATTTGTAGCCAAAGGAAATagCTTCTTGTTATATACCTGCACCTATCAA
GGATTTTTTACAGTTTATGAAGTGAATGAATCCTCCTGCACAATAAAATG
GGACTACTCTTTCATAACATTCCATCCATATGGATTAGCTGGTTTGGTTA
TTGATCATAAAAATGGGTTATTGGTTGCAGCTGGGAATTATGGGAAGGAA
CCATTTCCTAATGTCATGGGAGATGCATGTTATGGATCATATTCTGGTAT
CAGTCTCTGGAGATTTTTGAATGACACACCTCATCTAACTCTGGTTGAAG
ACCAGGGAAAAGCTTTGAAGAAGGTATCCAGAGGTGAATGGTTAAAGAGT
GTTGTTTTAAGACGTGGCGATGAAAAAAACGAAATGTTGAAGCATGGTAT
TTACAAGTTGAAATTGTCAGAAGATGGTACACAAATTGTCACACTGCATC
TTGATGGTCGCATATCTTTTTGGAGTATCCCGTCAATGAGGCTAATCAAA
ACTTGGAGTAAATCTGAACAACCTGATGCAAGTGGCGGCTCAAGTGAAGG
GTTCTCCTTTGACTCGCAGAAAAAAGAAGaTCTCACCAAAACAAGGAATT
CAATAGATGTCAGCTGGTGGTCTGAAAAGGAGATTGCTTTGGCATCTGGG
AGGGGTGATGTAACGATTGCTTCGACTGACAGCTTGAAGAATTTACTTGG
AGAGTCGAGTGAGAAATTTGATCCATGGCCGTCACTCAGCCAAGTGGTGG
ATGGAAGCATTCTTGTGCTCGAGTGTGAGAAACGAGTGAACGATCCAAAC
AACAAAACGAAGACATCTTGGAAATGGACTTCAGAAGAAGATGAAAGCCA
AGATGAAGTGAACTCGATTCGTTATCGATTCAAAGAACTCACTAAACAGA
TGTTATATTTCATCACTGAGGCTGAAAGGTTTTTACCAGCTGTCAAGCCT
CCAAGAATTTTAACCAACGTTTATCGTTTACTATGCTTGAAATCTACAAC
ACCCGAAGAATTATACACGCGGAAAATCAATCTTGAACATTACGGAGAGG
CCTTGGACCTAGCTAAACGTTTTGGTTTGAATACTGATTTAGTTTATCAG
CGACAGTGGAAAAAGAAAAGAGTTTCGAAGATTACCATTCATGATTATCt
gtcCAAGATTAAAGATCGATATTGGGTTTTGGACGAGTGCCTTTTACGAG
TTGCCGATGACTTTGACTCGACAGAAGAGTTACTGAAATACGGTTTACTC
GGTACAAGTTGGGAAATCTTGCAAAGGATTGATGAAGAGGGTAAAGGTGa
tgcaaaggatgatgggaAGTTATTACCTTTTAAATTTGACGCCGCCCCAC
ATGACGAGGATGACGAAAACTCAAGTAGAGAATTCCAAgggagTCTAACG
AAGAAGCAATTGAAAATCTGCCAATATCGACGGCAATTATTACATTATCT
TGATCGGCTTTCCACTTATGAGGTTGTTTTGGGAGGCTCATTCAAAGCAC
GAGATAAATTCTCAAAAGAGTATTTTACCAAATTTCGATCGTGCAATATG
GTACACCAAGCGGTCGAGTGTGCCCGCGACGAGGACGCTTATACTCTGGA
GCATTTGTTTTCGTACCATGGGAAGCAGTTACTACCTTATTGGCTGCCGA
TATTATCAAACTTCCCGGAAACAACCGATATCCGATATTTTGAGCCGGTC
ATCCCTGAGATTGGAGAGCCACCAGAAGATCCAGAGATTTTACCTTGGTT
AGAGAAACACCATCGTGAAGAGGATTGGGTCGAGCAATCGAATATTGTCC
AACAAATCAAGTCTAATGAAGAAGGTGACGCAAACGAAGATATAGGCTCA
TTCATTTTCGAATCCGATCCAGAGATacgaaaattttacaaatgtGAAAC
AAAAGCTCAACTGAGAGAATGGTTTTTACATCGTGTACACTTGATTGATG
AATATTCCGGTCAGATTGATAAATGTTGCGAGCTGTTAGATGTGGGAATC
AAAAGAGGCTTGGAAGGGCTCACTAAGGTTCACCAAGAAATGGAAGCATG
GAGACTCTTAGTTTACGACGTTGGAATTGACAGTAAAATGACTGCAAAGA
GTTTCGTGGAATTATCTGAATCATCGAAAATCAAATTGCTAATGTTCAAA
ACCTCAGATGTGACATTCGTTAACGATTTCAAGCTATATCTAATGCCGTA
TTTAAGAAATATTGGAAAGAAGGATTTTAAGAAACGCCAAGATTTACTTC
ATGAGTTTTTGGTGGAAATCGCTAAAACTGATTTGACATGCTGCTTGAAG
TTATTGGAAAAGTGTTCGCCAGAGCTGCCAGAACCACTGCTTCCTGATAT
GGCGGAGATAATGAAGATTGGGATTGATTGCGTTTACGCGTGCAAGAGAA
CGGATCAATTGAATCATTGTTTCAGCATTGTCGAATGTTTGCCTTCGAGA
GAAGAGGGAGTCATTAGCCGTCCCGTGGAAGAGCTTCACATACAACTGGA
TCAATTGGAACATTTGCTGACAGGAGCGGAAATTTTACAGTATTACAACA
ACCCTCAGACCATCTCTTACATTTCTGAAATTAAAGATGACTCTACTATT
TGTAAACAACTCATTCAGCAATTGGTGAAAAACGCTGTTTGTAAAGGACG
TTGTGTTCCAAAGGAATTGAACAAATTACTCGGACATTTGATCAAGCTTT
CCAAAGAAGTTTTCCGGTGCTGTGATATCAAGATCGTTCACCAGATTTTC
GTTGAAGAATTACTACGGTCCGGTTCACGTGAGAACATAACAGTAGCTGA
AGAGTTGATCACGCCTTCCAAACTTGCCGGGAATTCACCTCAAAGTAAGA
AACCAGAACAACATTTGACGTCTGCACTCTACCTCCTCAAATATGATGTT
TCGGTTACCGTTGTGTTGGAAGCGAGTCGTGAATATTTCAATGCAGCAAT
GTCGGGTAATGACTCTTCAATGGAACTGGCTAGATTGTGTCTAACATTGG
TCAAAGATTGTCCAGAGAGTGTTCAAGATGAATTGGATTTGATCAACTCG
TTGGGTTTATTGTATGAATTCAATGTATCCATGCTACCCTTACAAGTTCG
CCTTTGCGCTGATAAATTGGAAATTATCGATCTTTGTTTGAAGGAGAAGA
AGAATGGGTACAAGAAAAAAGACAAGCTCATCCAATTGAGTAATCTTTTG
CAAATCTGTGGCCATGACAACAAAGAACGGATTGGACAAGTCAATATTAA
AATTGCTGAATCAGCATTTGAACATAAAGATTACACATACGCTGGTATCG
TTTGTGTACAATTGGTGGATGATAATTATTCTAATGCTTGGTATATTTGC
AGGAAACTTGGTGAATGTGCTAAATATACCAACTTCACAATCAGGCAAAA
GTTGTTGAGTTTTGCGTTAACTTATTGTCCAGTACATCACATTGAAGAAG
TTTTACAAGAGAAAACTCAACTGGAAACCCAGGTTTTGTACGAGAGGTTG
GGTGTATTTACGAAAGAAGGCAAGAAAGACAAAATTGTGACCTCATCTAA
GAAAGAAACTGAGGAAGAAAACGACGAAGACAATGTTGATGGGAATAACA
TATCAATCCTCAACAAGACCAAAACTACAACAAAGAAATTGATTTCAAGC
GTCGCCAGCGTGGCTGATAACCGCTGGGTTGGATCCGCAATGAATTGGGT
CAAACCGTCGTCGGAAGGGTCTGGTAACGAAGTTGATGTTGTTGAGCGGG
AAATTGAAAGCGTTCGGCATAACCCATTTTATAGTTCGCTGGATTCGAAA
AAGATTGACGAAGATGTTCAAAGATTTAATTATAACGAGTTCAGCGACCA
TTTGAGGTGCGTCACAACCGAAGAAAAAGTATTCAATCAGCTGGTGTTAA
GAAGTCAAAAATTGAACGAGCAAAGAACCCTGGGTAAAGAGCTCGAAAAC
ACTGACCAAGCAATGCTATCGTTGAGTGATATAGCTTATACTGAAGAAAG
TTGTTTGTGTCTGGCTTACATGATGGCTATTTCTCAGCCAAAAGAAATCC
ATTCCCTATCGACCAAGCATCGGAAAAACACTTTCACTTTCCTTTTCACT
GCTTATTACTATGCATTACAAGAATAtgttaaaaacaacaaaatcgAATT
CGATAAACAAGCACAGATTTACAGCGCGCCTCCGATTGATGTGATTACAT
GGATGCTAAAAGTGTTAGGTAAGAAGCAAGgagaaaaggaagaaaaagaa
aaaggagagACTTACTTTCTGTCTAACATGAACAAGTTGCAAGACTTGAT
GCAAGCAAAGATGCTACAAGCTCTTGACAAAGgaGTGGACATCGAAAGAT
TTTCAGTTGATAATGAATATAAACGTGAAACTATACTCGGATTAGCTATG
AGTGTCGAAGACGAGTTGATTAACACAAGTTTGCTGCTAGCAGAGAAATA
TGATATCCCCGCATGGGAAGTGTTGTTATCACACGTGGAATTTTTATTCA
CTGATAGTGGTCTAAAAGCCAAAGCTATCCGCGAATCACTAAACAAATGG
AAAGTTGATTCCCATTTGAAACCGAACGGTGATAAAGTCTTTGAGCGGAT
GAAGAAATATGTTTACCCAGAAATCAATGGTAAAGACCACAATGCATTGC
TGTTGTTCTACGTTTTCCTAATGAATTGCAGCTCGCCCACTAAAATATTG
GAGGGTACGCTTACATTAGATGCTCATTCcaaacttttgaagaaaatcaa
GGCTGCTGCATCATCCATCAATTACAAACTTCTCGTGCATGGAGATTCAC
CTTTGGAGGTGATTAGAGACTGTGTTGATGATAACAATGTACATTTGTTG
GCTAAAATTGCATCCAAAATCCCCCAGGCGGATGGTAGTTACCTGTCATC
AAACAAGATCTTCTTAGCAAACGCCATTCGGatgttttggaagaaaaaag
aGAACAAGGATTGGTTGAATACATTCGAAAACTGTAAACAACACTTCACC
AAACTCCTGATAGAAGACGTTGTCACTTTTGCTGACCATGCAATTTTTGG
CGAGGAAGCTTTAGACTCGCTGACCCAAGACACCAGACTGGAGATTGGTA
AAAGAGtaataaaatatttgagacaacaACGTGGTCAAGACGAGACCAAA
CAAAGAGGAGCTGACGATTATGATTCGCTTATGGAGCGCTACGATTCATC
TATCAATGATTTGGAACTTTCCATCGAACATCTCAAAACGCTGACTGATC
CAATTTTCAAAGCAGTCTTTGGTGACGATAACGAACTGAGCAAAACCTTT
GGACGAGTATACGACTTATCACGTGGTCGAAAACAACCACTCGAAAAACT
ATTCCGTGATTTGTTCATATCGNTACAACCATTAGACAAAATTTCGAAAC
TGCGGAGTCTTTGTCGCAATGCATCTATTGACGTCCGCACGTGTTTCCAA
GATGCTTTGCGCGGGATCCTGAGTGACATCCAAAGCGATAGAGATTACAC
AAAACTACAGACTTTAACGGAGAACATCAAAGCGCATCAAGAACATCAAA
CAGACCCTCTTGTTACCCATAGCGACGTCTTAGATGTGGTGCGGCCATTT
TGTTCTGATGTTACAGCTAGCACGGATGTGAAGAGTCACGTGTTACATNT
TTTGTTCTGAatggaaGAAAATGAGCAAATATTGTATGATTTGATTGTTC
ACGAAGAATGGAAACAAGAACCACAGTTGTTGGACCAAGTTGAAAGTTAT
TTTTGGCAATATCGTGGTTCACTTCTAAAGAAGCTATGGAAAGTTTCACA
AAGTTCTGCAATTTATATGTGGGACAACTTGAAGACACAATTCAGATATC
AAGCTACCTTTGGTTGCCCACCATTGAATTTTATCAATCTGATGAACAAT
TGCTTGCCATGGCTTATGGCTTTGTCACCGGATGGAAATTTTATTGCCAT
CCTTCAAGATTCTGTTATTGAAATAAGGACTGCTGGAAATTTTGAGCAAG
TCATTACAAAATATAAGATTGAAAAAGATATGTTTCCAAGATGGCGTAAA
TTGATTTGGAATCATGACAACACCTTACTTTGTTATTCAAACAGTTTTGG
AGATTTGACCATTTTGGATATTACCGGCactaaaaaacattttattccaT
CATCAAATAATGTCAAGTTAAAAGTGCCTGGAACGCTGAGTTTGGCATTG
TGTCATGTTGAATTTGTAGCCAAAGGAAATagCTTCTTGTTATATACCTG
CACCTATCAAGGATTTTTTACAGTTTATGAAGTGAATGAATCCTCCTGCA
CAATAAAATGGGACTACTCTTTCATAACATTCCATCCATATGGATTAGCT
GGTTTGGTTATTGATCATAAAAATGGGTTATTGGTTGCAGCTGGGAATTA
TGGGAAGGAACCATTTCCTAATGTCATGGGAGATGCATGTTATGGATCAT
ATTCTGGTATCAGTCTCTGGAGATTTTTGAATGACACACCTCATCTAACT
CTGGTTGAAGACCAGGGAAAAGCTTTGAAGAAGGTATCCAGAGGTGAATG
GTTAAAGAGTGTTGTTTTAAGACGTGGCGATGAAAAAAACGAAATGTTGA
AGCATGGTATTTACAAGTTGAAATTGTCAGAAGATGGTACACAAATTGTC
ACACTGCATCTTGATGGTCGCATATCTTTTTGGAGTATCCCGTCAATGAG
GCTAATCAAAACTTGGAGTAAATCTGAACAACCTGATGCAAGTGGCGGCT
CAAGTGAAGGGTTCTCCTTTGACTCGCAGAAAAAAGAAGaTCTCACCAAA
ACAAGGAATTCAATAGATGTCAGCTGGTGGTCTGAAAAGGAGATTGCTTT
GGCATCTGGGAGGGGTGATGTAACGATTGCTTCGACTGACAGCTTGAAGA
ATTTACTTGGAGAGTCGAGTGAGAAATTTGATCCATGGCCGTCACTCAGC
CAAGTGGTGGATGGAAGCATTCTTGTGCTCGAGTGTGAGAAACGAGTGAA
CGATCCAAACAACAAAACGAAGACATCTTGGAAATGGACTTCAGAAGAAG
ATGAAAGCCAAGATGAAGTGAACTCGATTCGTTATCGATTCAAAGAACTC
ACTAAACAGATGTTATATTTCATCACTGAGGCTGAAAGGTTTTTACCAGC
TGTCAAGCCTCCAAGAATTTTAACCAACGTTTATCGTTTACTATGCTTGA
AATCTACAACACCCGAAGAATTATACACGCGGAAAATCAATCTTGAACAT
TACGGAGAGGCCTTGGACCTAGCTAAACGTTTTGGTTTGAATACTGATTT
AGTTTATCAGCGACAGTGGAAAAAGAAAAGAGTTTCGAAGATTACCATTC
ATGATTATCtgtcCAAGATTAAAGATCGATATTGGGTTTTGGACGAGTGC
CTTTTACGAGTTGCCGATGACTTTGACTCGACAGAAGAGTTACTGAAATA
CGGTTTACTCGGTACAAGTTGGGAAATCTTGCAAAGGATTGATGAAGAGG
GTAAAGGTGatgcaaaggatgatgggaAGTTATTACCTTTTAAATTTGAC
GCCGCCCCACATGACGAGGATGACGAAAACTCAAGTAGAGAATTCCAAgg
gagTCTAACGAAGAAGCAATTGAAAATCTGCCAATATCGACGGCAATTAT
TACATTATCTTGATCGGCTTTCCACTTATGAGGTTGTTTTGGGAGGCTCA
TTCAAAGCACGAGATAAATTCTCAAAAGAGTATTTTACCAAATTTCGATC
GTGCAATATGGTACACCAAGCGGTCGAGTGTGCCCGCGACGAGGACGCTT
ATACTCTGGAGCATTTGTTTTCGTACCATGGGAAGCAGTTACTACCTTAT
TGGCTGCCGATATTATCAAACTTCCCGGAAACAACCGATATCCGATATTT
TGAGCCGGTCATCCCTGAGATTGGAGAGCCACCAGAAGATCCAGAGATTT
TACCTTGGTTAGAGAAACACCATCGTGAAGAGGATTGGGTCGAGCAATCG
AATATTGTCCAACAAATCAAGTCTAATGAAGAAGGTGACGCAAACGAAGA
TATAGGCTCATTCATTTTCGAATCCGATCCAGAGATacgaaaattttaca
aatgtGAAACAAAAGCTCAACTGAGAGAATGGTTTTTACATCGTGTACAC
TTGATTGATGAATATTCCGGTCAGATTGATAAATGTTGCGAGCTGTTAGA
TGTGGGAATCAAAAGAGGCTTGGAAGGGCTCACTAAGGTTCACCAAGAAA
TGGAAGCATGGAGACTCTTAGTTTACGACGTTGGAATTGACAGTAAAATG
ACTGCAAAGAGTTTCGTGGAATTATCTGAATCATCGAAAATCAAATTGCT
AATGTTCAAAACCTCAGATGTGACATTCGTTAACGATTTCAAGCTATATC
TAATGCCGTATTTAAGAAATATTGGAAAGAAGGATTTTAAGAAACGCCAA
GATTTACTTCATGAGTTTTTGGTGGAAATCGCTAAAACTGATTTGACATG
CTGCTTGAAGTTATTGGAAAAGTGTTCGCCAGAGCTGCCAGAACCACTGC
TTCCTGATATGGCGGAGATAATGAAGATTGGGATTGATTGCGTTTACGCG
TGCAAGAGAACGGATCAATTGAATCATTGTTTCAGCATTGTCGAATGTTT
GCCTTCGAGAGAAGAGGGAGTCATTAGCCGTCCCGTGGAAGAGCTTCACA
TACAACTGGATCAATTGGAACATTTGCTGACAGGAGCGGAAATTTTACAG
TATTACAACAACCCTCAGACCATCTCTTACATTTCTGAAATTAAAGATGA
CTCTACTATTTGTAAACAACTCATTCAGCAATTGGTGAAAAACGCTGTTT
GTAAAGGACGTTGTGTTCCAAAGGAATTGAACAAATTACTCGGACATTTG
ATCAAGCTTTCCAAAGAAGTTTTCCGGTGCTGTGATATCAAGATCGTTCA
CCAGATTTTCGTTGAAGAATTACTACGGTCCGGTTCACGTGAGAACATAA
CAGTAGCTGAAGAGTTGATCACGCCTTCCAAACTTGCCGGGAATTCACCT
CAAAGTAAGAAACCAGAACAACATTTGACGTCTGCACTCTACCTCCTCAA
ATATGATGTTTCGGTTACCGTTGTGTTGGAAGCGAGTCGTGAATATTTCA
ATGCAGCAATGTCGGGTAATGACTCTTCAATGGAACTGGCTAGATTGTGT
CTAACATTGGTCAAAGATTGTCCAGAGAGTGTTCAAGATGAATTGGATTT
GATCAACTCGTTGGGTTTATTGTATGAATTCAATGTATCCATGCTACCCT
TACAAGTTCGCCTTTGCGCTGATAAATTGGAAATTATCGATCTTTGTTTG
AAGGAGAAGAAGAATGGGTACAAGAAAAAAGACAAGCTCATCCAATTGAG
TAATCTTTTGCAAATCTGTGGCCATGACAACAAAGAACGGATTGGACAAG
TCAATATTAAAATTGCTGAATCAGCATTTGAACATAAAGATTACACATAC
GCTGGTATCGTTTGTGTACAATTGGTGGATGATAATTATTCTAATGCTTG
GTATATTTGCAGGAAACTTGGTGAATGTGCTAAATATACCAACTTCACAA
TCAGGCAAAAGTTGTTGAGTTTTGCGTTAACTTATTGTCCAGTACATCAC
ATTGAAGAAGTTTTACAAGAGAAAACTCAACTGGAAACCCAGGTTTTGTA
CGAGAGGTTGGGTGTATTTACGAAAGAAGGCAAGAAAGACAAAATTGTGA
CCTCATCTAAGAAAGAAACTGAGGAAGAAAACGACGAAGACAATGTTGAT
GGGAATAACATATCAATCCTCAACAAGACCAAAACTACAACAAAGAAATT
GATTTCAAGCGTCGCCAGCGTGGCTGATAACCGCTGGGTTGGATCCGCAA
TGAATTGGGTCAAACCGTCGTCGGAAGGGTCTGGTAACGAAGTTGATGTT
GTTGAGCGGGAAATTGAAAGCGTTCGGCATAACCCATTTTATAGTTCGCT
GGATTCGAAAAAGATTGACGAAGATGTTCAAAGATTTAATTATAACGAGT
TCAGCGACCATTTGAGGTGCGTCACAACCGAAGAAAAAGTATTCAATCAG
CTGGTGTTAAGAAGTCAAAAATTGAACGAGCAAAGAACCCTGGGTAAAGA
GCTCGAAAACACTGACCAAGCAATGCTATCGTTGAGTGATATAGCTTATA
CTGAAGAAAGTTGTTTGTGTCTGGCTTACATGATGGCTATTTCTCAGCCA
AAAGAAATCCATTCCCTATCGACCAAGCATCGGAAAAACACTTTCACTTT
CCTTTTCACTGCTTATTACTATGCATTACAAGAATAtgttaaaaacaaca
aaatcgAATTCGATAAACAAGCACAGATTTACAGCGCGCCTCCGATTGAT
GTGATTACATGGATGCTAAAAGTGTTAGGTAAGAAGCAAGgagaaaagga
agaaaaagaaaaaggagagACTTACTTTCTGTCTAACATGAACAAGTTGC
AAGACTTGATGCAAGCAAAGATGCTACAAGCTCTTGACAAAGgaGTGGAC
ATCGAAAGATTTTCAGTTGATAATGAATATAAACGTGAAACTATACTCGG
ATTAGCTATGAGTGTCGAAGACGAGTTGATTAACACAAGTTTGCTGCTAG
CAGAGAAATATGATATCCCCGCATGGGAAGTGTTGTTATCACACGTGGAA
TTTTTATTCACTGATAGTGGTCTAAAAGCCAAAGCTATCCGCGAATCACT
AAACAAATGGAAAGTTGATTCCCATTTGAAACCGAACGGTGATAAAGTCT
TTGAGCGGATGAAGAAATATGTTTACCCAGAAATCAATGGTAAAGACCAC
AATGCATTGCTGTTGTTCTACGTTTTCCTAATGAATTGCAGCTCGCCCAC
TAAAATATTGGAGGGTACGCTTACATTAGATGCTCATTCcaaacttttga
agaaaatcaaGGCTGCTGCATCATCCATCAATTACAAACTTCTCGTGCAT
GGAGATTCACCTTTGGAGGTGATTAGAGACTGTGTTGATGATAACAATGT
ACATTTGTTGGCTAAAATTGCATCCAAAATCCCCCAGGCGGATGGTAGTT
ACCTGTCATCAAACAAGATCTTCTTAGCAAACGCCATTCGGatgttttgg
aagaaaaaagaGAACAAGGATTGGTTGAATACATTCGAAAACTGTAAACA
ACACTTCACCAAACTCCTGATAGAAGACGTTGTCACTTTTGCTGACCATG
CAATTTTTGGCGAGGAAGCTTTAGACTCGCTGACCCAAGACACCAGACTG
GAGATTGGTAAAAGAGtaataaaatatttgagacaacaACGTGGTCAAGA
CGAGACCAAACAAAGAGGAGCTGACGATTATGATTCGCTTATGGAGCGCT
ACGATTCATCTATCAATGATTTGGAACTTTCCATCGAACATCTCAAAACG
CTGACTGATCCAATTTTCAAAGCAGTCTTTGGTGACGATAACGAACTGAG
CAAAACCTTTGGACGAGTATACGACTTATCACGTGGTCGAAAACAACCAC
TCGAAAAACTATTCCGTGATTTGTTCATATCGNTACAACCATTAGACAAA
ATTTCGAAACTGCGGAGTCTTTGTCGCAATGCATCTATTGACGTCCGCAC
GTGTTTCCAAGATGCTTTGCGCGGGATCCTGAGTGACATCCAAAGCGATA
GAGATTACACAAAACTACAGACTTTAACGGAGAACATCAAAGCGCATCAA
GAACATCAAACAGACCCTCTTGTTACCCATAGCGACGTCTTAGATGTGGT
GCGGCCATTTTGTTCTGATGTTACAGCTAGCACGGATGTGAAGAGTCACG
TGTTACATNTTTTGTTCTGAatggaaGAAAATGAGCAAATATTGTATGAT
TTGATTGTTCACGAAGAATGGAAACAAGAACCACAGTTGTTGGACCAAGT
TGAAAGTTATTTTTGGCAATATCGTGGTTCACTTCTAAAGAAGCTATGGA
AAGTTTCACAAAGTTCTGCAATTTATATGTGGGACAACTTGAAGACACAA
TTCAGATATCAAGCTACCTTTGGTTGCCCACCATTGAATTTTATCAATCT
GATGAACAATTGCTTGCCATGGCTTATGGCTTTGTCACCGGATGGAAATT
TTATTGCCATCCTTCAAGATTCTGTTATTGAAATAAGGACTGCTGGAAAT
TTTGAGCAAGTCATTACAAAATATAAGATTGAAAAAGATATGTTTCCAAG
ATGGCGTAAATTGATTTGGAATCATGACAACACCTTACTTTGTTATTCAA
ACAGTTTTGGAGATTTGACCATTTTGGATATTACCGGCactaaaaaacat
tttattccaTCATCAAATAATGTCAAGTTAAAAGTGCCTGGAACGCTGAG
TTTGGCATTGTGTCATGTTGAATTTGTAGCCAAAGGAAATagCTTCTTGT
TATATACCTGCACCTATCAAGGATTTTTTACAGTTTATGAAGTGAATGAA
TCCTCCTGCACAATAAAATGGGACTACTCTTTCATAACATTCCATCCATA
TGGATTAGCTGGTTTGGTTATTGATCATAAAAATGGGTTATTGGTTGCAG
CTGGGAATTATGGGAAGGAACCATTTCCTAATGTCATGGGAGATGCATGT
TATGGATCATATTCTGGTATCAGTCTCTGGAGATTTTTGAATGACACACC
TCATCTAACTCTGGTTGAAGACCAGGGAAAAGCTTTGAAGAAGGTATCCA
GAGGTGAATGGTTAAAGAGTGTTGTTTTAAGACGTGGCGATGAAAAAAAC
GAAATGTTGAAGCATGGTATTTACAAGTTGAAATTGTCAGAAGATGGTAC
ACAAATTGTCACACTGCATCTTGATGGTCGCATATCTTTTTGGAGTATCC
CGTCAATGAGGCTAATCAAAACTTGGAGTAAATCTGAACAACCTGATGCA
AGTGGCGGCTCAAGTGAAGGGTTCTCCTTTGACTCGCAGAAAAAAGAAGa
TCTCACCAAAACAAGGAATTCAATAGATGTCAGCTGGTGGTCTGAAAAGG
AGATTGCTTTGGCATCTGGGAGGGGTGATGTAACGATTGCTTCGACTGAC
AGCTTGAAGAATTTACTTGGAGAGTCGAGTGAGAAATTTGATCCATGGCC
GTCACTCAGCCAAGTGGTGGATGGAAGCATTCTTGTGCTCGAGTGTGAGA
AACGAGTGAACGATCCAAACAACAAAACGAAGACATCTTGGAAATGGACT
TCAGAAGAAGATGAAAGCCAAGATGAAGTGAACTCGATTCGTTATCGATT
CAAAGAACTCACTAAACAGATGTTATATTTCATCACTGAGGCTGAAAGGT
TTTTACCAGCTGTCAAGCCTCCAAGAATTTTAACCAACGTTTATCGTTTA
CTATGCTTGAAATCTACAACACCCGAAGAATTATACACGCGGAAAATCAA
TCTTGAACATTACGGAGAGGCCTTGGACCTAGCTAAACGTTTTGGTTTGA
ATACTGATTTAGTTTATCAGCGACAGTGGAAAAAGAAAAGAGTTTCGAAG
ATTACCATTCATGATTATCtgtcCAAGATTAAAGATCGATATTGGGTTTT
GGACGAGTGCCTTTTACGAGTTGCCGATGACTTTGACTCGACAGAAGAGT
TACTGAAATACGGTTTACTCGGTACAAGTTGGGAAATCTTGCAAAGGATT
GATGAAGAGGGTAAAGGTGatgcaaaggatgatgggaAGTTATTACCTTT
TAAATTTGACGCCGCCCCACATGACGAGGATGACGAAAACTCAAGTAGAG
AATTCCAAgggagTCTAACGAAGAAGCAATTGAAAATCTGCCAATATCGA
CGGCAATTATTACATTATCTTGATCGGCTTTCCACTTATGAGGTTGTTTT
GGGAGGCTCATTCAAAGCACGAGATAAATTCTCAAAAGAGTATTTTACCA
AATTTCGATCGTGCAATATGGTACACCAAGCGGTCGAGTGTGCCCGCGAC
GAGGACGCTTATACTCTGGAGCATTTGTTTTCGTACCATGGGAAGCAGTT
ACTACCTTATTGGCTGCCGATATTATCAAACTTCCCGGAAACAACCGATA
TCCGATATTTTGAGCCGGTCATCCCTGAGATTGGAGAGCCACCAGAAGAT
CCAGAGATTTTACCTTGGTTAGAGAAACACCATCGTGAAGAGGATTGGGT
CGAGCAATCGAATATTGTCCAACAAATCAAGTCTAATGAAGAAGGTGACG
CAAACGAAGATATAGGCTCATTCATTTTCGAATCCGATCCAGAGATacga
aaattttacaaatgtGAAACAAAAGCTCAACTGAGAGAATGGTTTTTACA
TCGTGTACACTTGATTGATGAATATTCCGGTCAGATTGATAAATGTTGCG
AGCTGTTAGATGTGGGAATCAAAAGAGGCTTGGAAGGGCTCACTAAGGTT
CACCAAGAAATGGAAGCATGGAGACTCTTAGTTTACGACGTTGGAATTGA
CAGTAAAATGACTGCAAAGAGTTTCGTGGAATTATCTGAATCATCGAAAA
TCAAATTGCTAATGTTCAAAACCTCAGATGTGACATTCGTTAACGATTTC
AAGCTATATCTAATGCCGTATTTAAGAAATATTGGAAAGAAGGATTTTAA
GAAACGCCAAGATTTACTTCATGAGTTTTTGGTGGAAATCGCTAAAACTG
ATTTGACATGCTGCTTGAAGTTATTGGAAAAGTGTTCGCCAGAGCTGCCA
GAACCACTGCTTCCTGATATGGCGGAGATAATGAAGATTGGGATTGATTG
CGTTTACGCGTGCAAGAGAACGGATCAATTGAATCATTGTTTCAGCATTG
TCGAATGTTTGCCTTCGAGAGAAGAGGGAGTCATTAGCCGTCCCGTGGAA
GAGCTTCACATACAACTGGATCAATTGGAACATTTGCTGACAGGAGCGGA
AATTTTACAGTATTACAACAACCCTCAGACCATCTCTTACATTTCTGAAA
TTAAAGATGACTCTACTATTTGTAAACAACTCATTCAGCAATTGGTGAAA
AACGCTGTTTGTAAAGGACGTTGTGTTCCAAAGGAATTGAACAAATTACT
CGGACATTTGATCAAGCTTTCCAAAGAAGTTTTCCGGTGCTGTGATATCA
AGATCGTTCACCAGATTTTCGTTGAAGAATTACTACGGTCCGGTTCACGT
GAGAACATAACAGTAGCTGAAGAGTTGATCACGCCTTCCAAACTTGCCGG
GAATTCACCTCAAAGTAAGAAACCAGAACAACATTTGACGTCTGCACTCT
ACCTCCTCAAATATGATGTTTCGGTTACCGTTGTGTTGGAAGCGAGTCGT
GAATATTTCAATGCAGCAATGTCGGGTAATGACTCTTCAATGGAACTGGC
TAGATTGTGTCTAACATTGGTCAAAGATTGTCCAGAGAGTGTTCAAGATG
AATTGGATTTGATCAACTCGTTGGGTTTATTGTATGAATTCAATGTATCC
ATGCTACCCTTACAAGTTCGCCTTTGCGCTGATAAATTGGAAATTATCGA
TCTTTGTTTGAAGGAGAAGAAGAATGGGTACAAGAAAAAAGACAAGCTCA
TCCAATTGAGTAATCTTTTGCAAATCTGTGGCCATGACAACAAAGAACGG
ATTGGACAAGTCAATATTAAAATTGCTGAATCAGCATTTGAACATAAAGA
TTACACATACGCTGGTATCGTTTGTGTACAATTGGTGGATGATAATTATT
CTAATGCTTGGTATATTTGCAGGAAACTTGGTGAATGTGCTAAATATACC
AACTTCACAATCAGGCAAAAGTTGTTGAGTTTTGCGTTAACTTATTGTCC
AGTACATCACATTGAAGAAGTTTTACAAGAGAAAACTCAACTGGAAACCC
AGGTTTTGTACGAGAGGTTGGGTGTATTTACGAAAGAAGGCAAGAAAGAC
AAAATTGTGACCTCATCTAAGAAAGAAACTGAGGAAGAAAACGACGAAGA
CAATGTTGATGGGAATAACATATCAATCCTCAACAAGACCAAAACTACAA
CAAAGAAATTGATTTCAAGCGTCGCCAGCGTGGCTGATAACCGCTGGGTT
GGATCCGCAATGAATTGGGTCAAACCGTCGTCGGAAGGGTCTGGTAACGA
AGTTGATGTTGTTGAGCGGGAAATTGAAAGCGTTCGGCATAACCCATTTT
ATAGTTCGCTGGATTCGAAAAAGATTGACGAAGATGTTCAAAGATTTAAT
TATAACGAGTTCAGCGACCATTTGAGGTGCGTCACAACCGAAGAAAAAGT
ATTCAATCAGCTGGTGTTAAGAAGTCAAAAATTGAACGAGCAAAGAACCC
TGGGTAAAGAGCTCGAAAACACTGACCAAGCAATGCTATCGTTGAGTGAT
ATAGCTTATACTGAAGAAAGTTGTTTGTGTCTGGCTTACATGATGGCTAT
TTCTCAGCCAAAAGAAATCCATTCCCTATCGACCAAGCATCGGAAAAACA
CTTTCACTTTCCTTTTCACTGCTTATTACTATGCATTACAAGAATAtgtt
aaaaacaacaaaatcgAATTCGATAAACAAGCACAGATTTACAGCGCGCC
TCCGATTGATGTGATTACATGGATGCTAAAAGTGTTAGGTAAGAAGCAAG
gagaaaaggaagaaaaagaaaaaggagagACTTACTTTCTGTCTAACATG
AACAAGTTGCAAGACTTGATGCAAGCAAAGATGCTACAAGCTCTTGACAA
AGgaGTGGACATCGAAAGATTTTCAGTTGATAATGAATATAAACGTGAAA
CTATACTCGGATTAGCTATGAGTGTCGAAGACGAGTTGATTAACACAAGT
TTGCTGCTAGCAGAGAAATATGATATCCCCGCATGGGAAGTGTTGTTATC
ACACGTGGAATTTTTATTCACTGATAGTGGTCTAAAAGCCAAAGCTATCC
GCGAATCACTAAACAAATGGAAAGTTGATTCCCATTTGAAACCGAACGGT
GATAAAGTCTTTGAGCGGATGAAGAAATATGTTTACCCAGAAATCAATGG
TAAAGACCACAATGCATTGCTGTTGTTCTACGTTTTCCTAATGAATTGCA
GCTCGCCCACTAAAATATTGGAGGGTACGCTTACATTAGATGCTCATTCc
aaacttttgaagaaaatcaaGGCTGCTGCATCATCCATCAATTACAAACT
TCTCGTGCATGGAGATTCACCTTTGGAGGTGATTAGAGACTGTGTTGATG
ATAACAATGTACATTTGTTGGCTAAAATTGCATCCAAAATCCCCCAGGCG
GATGGTAGTTACCTGTCATCAAACAAGATCTTCTTAGCAAACGCCATTCG
GatgttttggaagaaaaaagaGAACAAGGATTGGTTGAATACATTCGAAA
ACTGTAAACAACACTTCACCAAACTCCTGATAGAAGACGTTGTCACTTTT
GCTGACCATGCAATTTTTGGCGAGGAAGCTTTAGACTCGCTGACCCAAGA
CACCAGACTGGAGATTGGTAAAAGAGtaataaaatatttgagacaacaAC
GTGGTCAAGACGAGACCAAACAAAGAGGAGCTGACGATTATGATTCGCTT
ATGGAGCGCTACGATTCATCTATCAATGATTTGGAACTTTCCATCGAACA
TCTCAAAACGCTGACTGATCCAATTTTCAAAGCAGTCTTTGGTGACGATA
ACGAACTGAGCAAAACCTTTGGACGAGTATACGACTTATCACGTGGTCGA
AAACAACCACTCGAAAAACTATTCCGTGATTTGTTCATATCGNTACAACC
ATTAGACAAAATTTCGAAACTGCGGAGTCTTTGTCGCAATGCATCTATTG
ACGTCCGCACGTGTTTCCAAGATGCTTTGCGCGGGATCCTGAGTGACATC
CAAAGCGATAGAGATTACACAAAACTACAGACTTTAACGGAGAACATCAA
AGCGCATCAAGAACATCAAACAGACCCTCTTGTTACCCATAGCGACGTCT
TAGATGTGGTGCGGCCATTTTGTTCTGATGTTACAGCTAGCACGGATGTG
AAGAGTCACGTGTTACATNTTTTGTTCTGAatggaaGAAAATGAGCAAAT
ATTGTATGATTTGATTGTTCACGAAGAATGGAAACAAGAACCACAGTTGT
TGGACCAAGTTGAAAGTTATTTTTGGCAATATCGTGGTTCACTTCTAAAG
AAGCTATGGAAAGTTTCACAAAGTTCTGCAATTTATATGTGGGACAACTT
GAAGACACAATTCAGATATCAAGCTACCTTTGGTTGCCCACCATTGAATT
TTATCAATCTGATGAACAATTGCTTGCCATGGCTTATGGCTTTGTCACCG
GATGGAAATTTTATTGCCATCCTTCAAGATTCTGTTATTGAAATAAGGAC
TGCTGGAAATTTTGAGCAAGTCATTACAAAATATAAGATTGAAAAAGATA
TGTTTCCAAGATGGCGTAAATTGATTTGGAATCATGACAACACCTTACTT
TGTTATTCAAACAGTTTTGGAGATTTGACCATTTTGGATATTACCGGCac
taaaaaacattttattccaTCATCAAATAATGTCAAGTTAAAAGTGCCTG
GAACGCTGAGTTTGGCATTGTGTCATGTTGAATTTGTAGCCAAAGGAAAT
agCTTCTTGTTATATACCTGCACCTATCAAGGATTTTTTACAGTTTATGA
AGTGAATGAATCCTCCTGCACAATAAAATGGGACTACTCTTTCATAACAT
TCCATCCATATGGATTAGCTGGTTTGGTTATTGATCATAAAAATGGGTTA
TTGGTTGCAGCTGGGAATTATGGGAAGGAACCATTTCCTAATGTCATGGG
AGATGCATGTTATGGATCATATTCTGGTATCAGTCTCTGGAGATTTTTGA
ATGACACACCTCATCTAACTCTGGTTGAAGACCAGGGAAAAGCTTTGAAG
AAGGTATCCAGAGGTGAATGGTTAAAGAGTGTTGTTTTAAGACGTGGCGA
TGAAAAAAACGAAATGTTGAAGCATGGTATTTACAAGTTGAAATTGTCAG
AAGATGGTACACAAATTGTCACACTGCATCTTGATGGTCGCATATCTTTT
TGGAGTATCCCGTCAATGAGGCTAATCAAAACTTGGAGTAAATCTGAACA
ACCTGATGCAAGTGGCGGCTCAAGTGAAGGGTTCTCCTTTGACTCGCAGA
AAAAAGAAGaTCTCACCAAAACAAGGAATTCAATAGATGTCAGCTGGTGG
TCTGAAAAGGAGATTGCTTTGGCATCTGGGAGGGGTGATGTAACGATTGC
TTCGACTGACAGCTTGAAGAATTTACTTGGAGAGTCGAGTGAGAAATTTG
ATCCATGGCCGTCACTCAGCCAAGTGGTGGATGGAAGCATTCTTGTGCTC
GAGTGTGAGAAACGAGTGAACGATCCAAACAACAAAACGAAGACATCTTG
GAAATGGACTTCAGAAGAAGATGAAAGCCAAGATGAAGTGAACTCGATTC
GTTATCGATTCAAAGAACTCACTAAACAGATGTTATATTTCATCACTGAG
GCTGAAAGGTTTTTACCAGCTGTCAAGCCTCCAAGAATTTTAACCAACGT
TTATCGTTTACTATGCTTGAAATCTACAACACCCGAAGAATTATACACGC
GGAAAATCAATCTTGAACATTACGGAGAGGCCTTGGACCTAGCTAAACGT
TTTGGTTTGAATACTGATTTAGTTTATCAGCGACAGTGGAAAAAGAAAAG
AGTTTCGAAGATTACCATTCATGATTATCtgtcCAAGATTAAAGATCGAT
ATTGGGTTTTGGACGAGTGCCTTTTACGAGTTGCCGATGACTTTGACTCG
ACAGAAGAGTTACTGAAATACGGTTTACTCGGTACAAGTTGGGAAATCTT
GCAAAGGATTGATGAAGAGGGTAAAGGTGatgcaaaggatgatgggaAGT
TATTACCTTTTAAATTTGACGCCGCCCCACATGACGAGGATGACGAAAAC
TCAAGTAGAGAATTCCAAgggagTCTAACGAAGAAGCAATTGAAAATCTG
CCAATATCGACGGCAATTATTACATTATCTTGATCGGCTTTCCACTTATG
AGGTTGTTTTGGGAGGCTCATTCAAAGCACGAGATAAATTCTCAAAAGAG
TATTTTACCAAATTTCGATCGTGCAATATGGTACACCAAGCGGTCGAGTG
TGCCCGCGACGAGGACGCTTATACTCTGGAGCATTTGTTTTCGTACCATG
GGAAGCAGTTACTACCTTATTGGCTGCCGATATTATCAAACTTCCCGGAA
ACAACCGATATCCGATATTTTGAGCCGGTCATCCCTGAGATTGGAGAGCC
ACCAGAAGATCCAGAGATTTTACCTTGGTTAGAGAAACACCATCGTGAAG
AGGATTGGGTCGAGCAATCGAATATTGTCCAACAAATCAAGTCTAATGAA
GAAGGTGACGCAAACGAAGATATAGGCTCATTCATTTTCGAATCCGATCC
AGAGATacgaaaattttacaaatgtGAAACAAAAGCTCAACTGAGAGAAT
GGTTTTTACATCGTGTACACTTGATTGATGAATATTCCGGTCAGATTGAT
AAATGTTGCGAGCTGTTAGATGTGGGAATCAAAAGAGGCTTGGAAGGGCT
CACTAAGGTTCACCAAGAAATGGAAGCATGGAGACTCTTAGTTTACGACG
TTGGAATTGACAGTAAAATGACTGCAAAGAGTTTCGTGGAATTATCTGAA
TCATCGAAAATCAAATTGCTAATGTTCAAAACCTCAGATGTGACATTCGT
TAACGATTTCAAGCTATATCTAATGCCGTATTTAAGAAATATTGGAAAGA
AGGATTTTAAGAAACGCCAAGATTTACTTCATGAGTTTTTGGTGGAAATC
GCTAAAACTGATTTGACATGCTGCTTGAAGTTATTGGAAAAGTGTTCGCC
AGAGCTGCCAGAACCACTGCTTCCTGATATGGCGGAGATAATGAAGATTG
GGATTGATTGCGTTTACGCGTGCAAGAGAACGGATCAATTGAATCATTGT
TTCAGCATTGTCGAATGTTTGCCTTCGAGAGAAGAGGGAGTCATTAGCCG
TCCCGTGGAAGAGCTTCACATACAACTGGATCAATTGGAACATTTGCTGA
CAGGAGCGGAAATTTTACAGTATTACAACAACCCTCAGACCATCTCTTAC
ATTTCTGAAATTAAAGATGACTCTACTATTTGTAAACAACTCATTCAGCA
ATTGGTGAAAAACGCTGTTTGTAAAGGACGTTGTGTTCCAAAGGAATTGA
ACAAATTACTCGGACATTTGATCAAGCTTTCCAAAGAAGTTTTCCGGTGC
TGTGATATCAAGATCGTTCACCAGATTTTCGTTGAAGAATTACTACGGTC
CGGTTCACGTGAGAACATAACAGTAGCTGAAGAGTTGATCACGCCTTCCA
AACTTGCCGGGAATTCACCTCAAAGTAAGAAACCAGAACAACATTTGACG
TCTGCACTCTACCTCCTCAAATATGATGTTTCGGTTACCGTTGTGTTGGA
AGCGAGTCGTGAATATTTCAATGCAGCAATGTCGGGTAATGACTCTTCAA
TGGAACTGGCTAGATTGTGTCTAACATTGGTCAAAGATTGTCCAGAGAGT
GTTCAAGATGAATTGGATTTGATCAACTCGTTGGGTTTATTGTATGAATT
CAATGTATCCATGCTACCCTTACAAGTTCGCCTTTGCGCTGATAAATTGG
AAATTATCGATCTTTGTTTGAAGGAGAAGAAGAATGGGTACAAGAAAAAA
GACAAGCTCATCCAATTGAGTAATCTTTTGCAAATCTGTGGCCATGACAA
CAAAGAACGGATTGGACAAGTCAATATTAAAATTGCTGAATCAGCATTTG
AACATAAAGATTACACATACGCTGGTATCGTTTGTGTACAATTGGTGGAT
GATAATTATTCTAATGCTTGGTATATTTGCAGGAAACTTGGTGAATGTGC
TAAATATACCAACTTCACAATCAGGCAAAAGTTGTTGAGTTTTGCGTTAA
CTTATTGTCCAGTACATCACATTGAAGAAGTTTTACAAGAGAAAACTCAA
CTGGAAACCCAGGTTTTGTACGAGAGGTTGGGTGTATTTACGAAAGAAGG
CAAGAAAGACAAAATTGTGACCTCATCTAAGAAAGAAACTGAGGAAGAAA
ACGACGAAGACAATGTTGATGGGAATAACATATCAATCCTCAACAAGACC
AAAACTACAACAAAGAAATTGATTTCAAGCGTCGCCAGCGTGGCTGATAA
CCGCTGGGTTGGATCCGCAATGAATTGGGTCAAACCGTCGTCGGAAGGGT
CTGGTAACGAAGTTGATGTTGTTGAGCGGGAAATTGAAAGCGTTCGGCAT
AACCCATTTTATAGTTCGCTGGATTCGAAAAAGATTGACGAAGATGTTCA
AAGATTTAATTATAACGAGTTCAGCGACCATTTGAGGTGCGTCACAACCG
AAGAAAAAGTATTCAATCAGCTGGTGTTAAGAAGTCAAAAATTGAACGAG
CAAAGAACCCTGGGTAAAGAGCTCGAAAACACTGACCAAGCAATGCTATC
GTTGAGTGATATAGCTTATACTGAAGAAAGTTGTTTGTGTCTGGCTTACA
TGATGGCTATTTCTCAGCCAAAAGAAATCCATTCCCTATCGACCAAGCAT
CGGAAAAACACTTTCACTTTCCTTTTCACTGCTTATTACTATGCATTACA
AGAATAtgttaaaaacaacaaaatcgAATTCGATAAACAAGCACAGATTT
ACAGCGCGCCTCCGATTGATGTGATTACATGGATGCTAAAAGTGTTAGGT
AAGAAGCAAGgagaaaaggaagaaaaagaaaaaggagagACTTACTTTCT
GTCTAACATGAACAAGTTGCAAGACTTGATGCAAGCAAAGATGCTACAAG
CTCTTGACAAAGgaGTGGACATCGAAAGATTTTCAGTTGATAATGAATAT
AAACGTGAAACTATACTCGGATTAGCTATGAGTGTCGAAGACGAGTTGAT
TAACACAAGTTTGCTGCTAGCAGAGAAATATGATATCCCCGCATGGGAAG
TGTTGTTATCACACGTGGAATTTTTATTCACTGATAGTGGTCTAAAAGCC
AAAGCTATCCGCGAATCACTAAACAAATGGAAAGTTGATTCCCATTTGAA
ACCGAACGGTGATAAAGTCTTTGAGCGGATGAAGAAATATGTTTACCCAG
AAATCAATGGTAAAGACCACAATGCATTGCTGTTGTTCTACGTTTTCCTA
ATGAATTGCAGCTCGCCCACTAAAATATTGGAGGGTACGCTTACATTAGA
TGCTCATTCcaaacttttgaagaaaatcaaGGCTGCTGCATCATCCATCA
ATTACAAACTTCTCGTGCATGGAGATTCACCTTTGGAGGTGATTAGAGAC
TGTGTTGATGATAACAATGTACATTTGTTGGCTAAAATTGCATCCAAAAT
CCCCCAGGCGGATGGTAGTTACCTGTCATCAAACAAGATCTTCTTAGCAA
ACGCCATTCGGatgttttggaagaaaaaagaGAACAAGGATTGGTTGAAT
ACATTCGAAAACTGTAAACAACACTTCACCAAACTCCTGATAGAAGACGT
TGTCACTTTTGCTGACCATGCAATTTTTGGCGAGGAAGCTTTAGACTCGC
TGACCCAAGACACCAGACTGGAGATTGGTAAAAGAGtaataaaatatttg
agacaacaACGTGGTCAAGACGAGACCAAACAAAGAGGAGCTGACGATTA
TGATTCGCTTATGGAGCGCTACGATTCATCTATCAATGATTTGGAACTTT
CCATCGAACATCTCAAAACGCTGACTGATCCAATTTTCAAAGCAGTCTTT
GGTGACGATAACGAACTGAGCAAAACCTTTGGACGAGTATACGACTTATC
ACGTGGTCGAAAACAACCACTCGAAAAACTATTCCGTGATTTGTTCATAT
CGNTACAACCATTAGACAAAATTTCGAAACTGCGGAGTCTTTGTCGCAAT
GCATCTATTGACGTCCGCACGTGTTTCCAAGATGCTTTGCGCGGGATCCT
GAGTGACATCCAAAGCGATAGAGATTACACAAAACTACAGACTTTAACGG
AGAACATCAAAGCGCATCAAGAACATCAAACAGACCCTCTTGTTACCCAT
AGCGACGTCTTAGATGTGGTGCGGCCATTTTGTTCTGATGTTACAGCTAG
CACGGATGTGAAGAGTCACGTGTTACATNTTTTGTTCTGAatggaaGAAA
ATGAGCAAATATTGTATGATTTGATTGTTCACGAAGAATGGAAACAAGAA
CCACAGTTGTTGGACCAAGTTGAAAGTTATTTTTGGCAATATCGTGGTTC
ACTTCTAAAGAAGCTATGGAAAGTTTCACAAAGTTCTGCAATTTATATGT
GGGACAACTTGAAGACACAATTCAGATATCAAGCTACCTTTGGTTGCCCA
CCATTGAATTTTATCAATCTGATGAACAATTGCTTGCCATGGCTTATGGC
TTTGTCACCGGATGGAAATTTTATTGCCATCCTTCAAGATTCTGTTATTG
AAATAAGGACTGCTGGAAATTTTGAGCAAGTCATTACAAAATATAAGATT
GAAAAAGATATGTTTCCAAGATGGCGTAAATTGATTTGGAATCATGACAA
CACCTTACTTTGTTATTCAAACAGTTTTGGAGATTTGACCATTTTGGATA
TTACCGGCactaaaaaacattttattccaTCATCAAATAATGTCAAGTTA
AAAGTGCCTGGAACGCTGAGTTTGGCATTGTGTCATGTTGAATTTGTAGC
CAAAGGAAATagCTTCTTGTTATATACCTGCACCTATCAAGGATTTTTTA
CAGTTTATGAAGTGAATGAATCCTCCTGCACAATAAAATGGGACTACTCT
TTCATAACATTCCATCCATATGGATTAGCTGGTTTGGTTATTGATCATAA
AAATGGGTTATTGGTTGCAGCTGGGAATTATGGGAAGGAACCATTTCCTA
ATGTCATGGGAGATGCATGTTATGGATCATATTCTGGTATCAGTCTCTGG
AGATTTTTGAATGACACACCTCATCTAACTCTGGTTGAAGACCAGGGAAA
AGCTTTGAAGAAGGTATCCAGAGGTGAATGGTTAAAGAGTGTTGTTTTAA
GACGTGGCGATGAAAAAAACGAAATGTTGAAGCATGGTATTTACAAGTTG
AAATTGTCAGAAGATGGTACACAAATTGTCACACTGCATCTTGATGGTCG
CATATCTTTTTGGAGTATCCCGTCAATGAGGCTAATCAAAACTTGGAGTA
AATCTGAACAACCTGATGCAAGTGGCGGCTCAAGTGAAGGGTTCTCCTTT
GACTCGCAGAAAAAAGAAGaTCTCACCAAAACAAGGAATTCAATAGATGT
CAGCTGGTGGTCTGAAAAGGAGATTGCTTTGGCATCTGGGAGGGGTGATG
TAACGATTGCTTCGACTGACAGCTTGAAGAATTTACTTGGAGAGTCGAGT
GAGAAATTTGATCCATGGCCGTCACTCAGCCAAGTGGTGGATGGAAGCAT
TCTTGTGCTCGAGTGTGAGAAACGAGTGAACGATCCAAACAACAAAACGA
AGACATCTTGGAAATGGACTTCAGAAGAAGATGAAAGCCAAGATGAAGTG
AACTCGATTCGTTATCGATTCAAAGAACTCACTAAACAGATGTTATATTT
CATCACTGAGGCTGAAAGGTTTTTACCAGCTGTCAAGCCTCCAAGAATTT
TAACCAACGTTTATCGTTTACTATGCTTGAAATCTACAACACCCGAAGAA
TTATACACGCGGAAAATCAATCTTGAACATTACGGAGAGGCCTTGGACCT
AGCTAAACGTTTTGGTTTGAATACTGATTTAGTTTATCAGCGACAGTGGA
AAAAGAAAAGAGTTTCGAAGATTACCATTCATGATTATCtgtcCAAGATT
AAAGATCGATATTGGGTTTTGGACGAGTGCCTTTTACGAGTTGCCGATGA
CTTTGACTCGACAGAAGAGTTACTGAAATACGGTTTACTCGGTACAAGTT
GGGAAATCTTGCAAAGGATTGATGAAGAGGGTAAAGGTGatgcaaaggat
gatgggaAGTTATTACCTTTTAAATTTGACGCCGCCCCACATGACGAGGA
TGACGAAAACTCAAGTAGAGAATTCCAAgggagTCTAACGAAGAAGCAAT
TGAAAATCTGCCAATATCGACGGCAATTATTACATTATCTTGATCGGCTT
TCCACTTATGAGGTTGTTTTGGGAGGCTCATTCAAAGCACGAGATAAATT
CTCAAAAGAGTATTTTACCAAATTTCGATCGTGCAATATGGTACACCAAG
CGGTCGAGTGTGCCCGCGACGAGGACGCTTATACTCTGGAGCATTTGTTT
TCGTACCATGGGAAGCAGTTACTACCTTATTGGCTGCCGATATTATCAAA
CTTCCCGGAAACAACCGATATCCGATATTTTGAGCCGGTCATCCCTGAGA
TTGGAGAGCCACCAGAAGATCCAGAGATTTTACCTTGGTTAGAGAAACAC
CATCGTGAAGAGGATTGGGTCGAGCAATCGAATATTGTCCAACAAATCAA
GTCTAATGAAGAAGGTGACGCAAACGAAGATATAGGCTCATTCATTTTCG
AATCCGATCCAGAGATacgaaaattttacaaatgtGAAACAAAAGCTCAA
CTGAGAGAATGGTTTTTACATCGTGTACACTTGATTGATGAATATTCCGG
TCAGATTGATAAATGTTGCGAGCTGTTAGATGTGGGAATCAAAAGAGGCT
TGGAAGGGCTCACTAAGGTTCACCAAGAAATGGAAGCATGGAGACTCTTA
GTTTACGACGTTGGAATTGACAGTAAAATGACTGCAAAGAGTTTCGTGGA
ATTATCTGAATCATCGAAAATCAAATTGCTAATGTTCAAAACCTCAGATG
TGACATTCGTTAACGATTTCAAGCTATATCTAATGCCGTATTTAAGAAAT
ATTGGAAAGAAGGATTTTAAGAAACGCCAAGATTTACTTCATGAGTTTTT
GGTGGAAATCGCTAAAACTGATTTGACATGCTGCTTGAAGTTATTGGAAA
AGTGTTCGCCAGAGCTGCCAGAACCACTGCTTCCTGATATGGCGGAGATA
ATGAAGATTGGGATTGATTGCGTTTACGCGTGCAAGAGAACGGATCAATT
GAATCATTGTTTCAGCATTGTCGAATGTTTGCCTTCGAGAGAAGAGGGAG
TCATTAGCCGTCCCGTGGAAGAGCTTCACATACAACTGGATCAATTGGAA
CATTTGCTGACAGGAGCGGAAATTTTACAGTATTACAACAACCCTCAGAC
CATCTCTTACATTTCTGAAATTAAAGATGACTCTACTATTTGTAAACAAC
TCATTCAGCAATTGGTGAAAAACGCTGTTTGTAAAGGACGTTGTGTTCCA
AAGGAATTGAACAAATTACTCGGACATTTGATCAAGCTTTCCAAAGAAGT
TTTCCGGTGCTGTGATATCAAGATCGTTCACCAGATTTTCGTTGAAGAAT
TACTACGGTCCGGTTCACGTGAGAACATAACAGTAGCTGAAGAGTTGATC
ACGCCTTCCAAACTTGCCGGGAATTCACCTCAAAGTAAGAAACCAGAACA
ACATTTGACGTCTGCACTCTACCTCCTCAAATATGATGTTTCGGTTACCG
TTGTGTTGGAAGCGAGTCGTGAATATTTCAATGCAGCAATGTCGGGTAAT
GACTCTTCAATGGAACTGGCTAGATTGTGTCTAACATTGGTCAAAGATTG
TCCAGAGAGTGTTCAAGATGAATTGGATTTGATCAACTCGTTGGGTTTAT
TGTATGAATTCAATGTATCCATGCTACCCTTACAAGTTCGCCTTTGCGCT
GATAAATTGGAAATTATCGATCTTTGTTTGAAGGAGAAGAAGAATGGGTA
CAAGAAAAAAGACAAGCTCATCCAATTGAGTAATCTTTTGCAAATCTGTG
GCCATGACAACAAAGAACGGATTGGACAAGTCAATATTAAAATTGCTGAA
TCAGCATTTGAACATAAAGATTACACATACGCTGGTATCGTTTGTGTACA
ATTGGTGGATGATAATTATTCTAATGCTTGGTATATTTGCAGGAAACTTG
GTGAATGTGCTAAATATACCAACTTCACAATCAGGCAAAAGTTGTTGAGT
TTTGCGTTAACTTATTGTCCAGTACATCACATTGAAGAAGTTTTACAAGA
GAAAACTCAACTGGAAACCCAGGTTTTGTACGAGAGGTTGGGTGTATTTA
CGAAAGAAGGCAAGAAAGACAAAATTGTGACCTCATCTAAGAAAGAAACT
GAGGAAGAAAACGACGAAGACAATGTTGATGGGAATAACATATCAATCCT
CAACAAGACCAAAACTACAACAAAGAAATTGATTTCAAGCGTCGCCAGCG
TGGCTGATAACCGCTGGGTTGGATCCGCAATGAATTGGGTCAAACCGTCG
TCGGAAGGGTCTGGTAACGAAGTTGATGTTGTTGAGCGGGAAATTGAAAG
CGTTCGGCATAACCCATTTTATAGTTCGCTGGATTCGAAAAAGATTGACG
AAGATGTTCAAAGATTTAATTATAACGAGTTCAGCGACCATTTGAGGTGC
GTCACAACCGAAGAAAAAGTATTCAATCAGCTGGTGTTAAGAAGTCAAAA
ATTGAACGAGCAAAGAACCCTGGGTAAAGAGCTCGAAAACACTGACCAAG
CAATGCTATCGTTGAGTGATATAGCTTATACTGAAGAAAGTTGTTTGTGT
CTGGCTTACATGATGGCTATTTCTCAGCCAAAAGAAATCCATTCCCTATC
GACCAAGCATCGGAAAAACACTTTCACTTTCCTTTTCACTGCTTATTACT
ATGCATTACAAGAATAtgttaaaaacaacaaaatcgAATTCGATAAACAA
GCACAGATTTACAGCGCGCCTCCGATTGATGTGATTACATGGATGCTAAA
AGTGTTAGGTAAGAAGCAAGgagaaaaggaagaaaaagaaaaaggagagA
CTTACTTTCTGTCTAACATGAACAAGTTGCAAGACTTGATGCAAGCAAAG
ATGCTACAAGCTCTTGACAAAGgaGTGGACATCGAAAGATTTTCAGTTGA
TAATGAATATAAACGTGAAACTATACTCGGATTAGCTATGAGTGTCGAAG
ACGAGTTGATTAACACAAGTTTGCTGCTAGCAGAGAAATATGATATCCCC
GCATGGGAAGTGTTGTTATCACACGTGGAATTTTTATTCACTGATAGTGG
TCTAAAAGCCAAAGCTATCCGCGAATCACTAAACAAATGGAAAGTTGATT
CCCATTTGAAACCGAACGGTGATAAAGTCTTTGAGCGGATGAAGAAATAT
GTTTACCCAGAAATCAATGGTAAAGACCACAATGCATTGCTGTTGTTCTA
CGTTTTCCTAATGAATTGCAGCTCGCCCACTAAAATATTGGAGGGTACGC
TTACATTAGATGCTCATTCcaaacttttgaagaaaatcaaGGCTGCTGCA
TCATCCATCAATTACAAACTTCTCGTGCATGGAGATTCACCTTTGGAGGT
GATTAGAGACTGTGTTGATGATAACAATGTACATTTGTTGGCTAAAATTG
CATCCAAAATCCCCCAGGCGGATGGTAGTTACCTGTCATCAAACAAGATC
TTCTTAGCAAACGCCATTCGGatgttttggaagaaaaaagaGAACAAGGA
TTGGTTGAATACATTCGAAAACTGTAAACAACACTTCACCAAACTCCTGA
TAGAAGACGTTGTCACTTTTGCTGACCATGCAATTTTTGGCGAGGAAGCT
TTAGACTCGCTGACCCAAGACACCAGACTGGAGATTGGTAAAAGAGtaat
aaaatatttgagacaacaACGTGGTCAAGACGAGACCAAACAAAGAGGAG
CTGACGATTATGATTCGCTTATGGAGCGCTACGATTCATCTATCAATGAT
TTGGAACTTTCCATCGAACATCTCAAAACGCTGACTGATCCAATTTTCAA
AGCAGTCTTTGGTGACGATAACGAACTGAGCAAAACCTTTGGACGAGTAT
ACGACTTATCACGTGGTCGAAAACAACCACTCGAAAAACTATTCCGTGAT
TTGTTCATATCGNTACAACCATTAGACAAAATTTCGAAACTGCGGAGTCT
TTGTCGCAATGCATCTATTGACGTCCGCACGTGTTTCCAAGATGCTTTGC
GCGGGATCCTGAGTGACATCCAAAGCGATAGAGATTACACAAAACTACAG
ACTTTAACGGAGAACATCAAAGCGCATCAAGAACATCAAACAGACCCTCT
TGTTACCCATAGCGACGTCTTAGATGTGGTGCGGCCATTTTGTTCTGATG
TTACAGCTAGCACGGATGTGAAGAGTCACGTGTTACATNTTTTGTTCTGA
atggaaGAAAATGAGCAAATATTGTATGATTTGATTGTTCACGAAGAATG
GAAACAAGAACCACAGTTGTTGGACCAAGTTGAAAGTTATTTTTGGCAAT
ATCGTGGTTCACTTCTAAAGAAGCTATGGAAAGTTTCACAAAGTTCTGCA
ATTTATATGTGGGACAACTTGAAGACACAATTCAGATATCAAGCTACCTT
TGGTTGCCCACCATTGAATTTTATCAATCTGATGAACAATTGCTTGCCAT
GGCTTATGGCTTTGTCACCGGATGGAAATTTTATTGCCATCCTTCAAGAT
TCTGTTATTGAAATAAGGACTGCTGGAAATTTTGAGCAAGTCATTACAAA
ATATAAGATTGAAAAAGATATGTTTCCAAGATGGCGTAAATTGATTTGGA
ATCATGACAACACCTTACTTTGTTATTCAAACAGTTTTGGAGATTTGACC
ATTTTGGATATTACCGGCactaaaaaacattttattccaTCATCAAATAA
TGTCAAGTTAAAAGTGCCTGGAACGCTGAGTTTGGCATTGTGTCATGTTG
AATTTGTAGCCAAAGGAAATagCTTCTTGTTATATACCTGCACCTATCAA
GGATTTTTTACAGTTTATGAAGTGAATGAATCCTCCTGCACAATAAAATG
GGACTACTCTTTCATAACATTCCATCCATATGGATTAGCTGGTTTGGTTA
TTGATCATAAAAATGGGTTATTGGTTGCAGCTGGGAATTATGGGAAGGAA
CCATTTCCTAATGTCATGGGAGATGCATGTTATGGATCATATTCTGGTAT
CAGTCTCTGGAGATTTTTGAATGACACACCTCATCTAACTCTGGTTGAAG
ACCAGGGAAAAGCTTTGAAGAAGGTATCCAGAGGTGAATGGTTAAAGAGT
GTTGTTTTAAGACGTGGCGATGAAAAAAACGAAATGTTGAAGCATGGTAT
TTACAAGTTGAAATTGTCAGAAGATGGTACACAAATTGTCACACTGCATC
TTGATGGTCGCATATCTTTTTGGAGTATCCCGTCAATGAGGCTAATCAAA
ACTTGGAGTAAATCTGAACAACCTGATGCAAGTGGCGGCTCAAGTGAAGG
GTTCTCCTTTGACTCGCAGAAAAAAGAAGaTCTCACCAAAACAAGGAATT
CAATAGATGTCAGCTGGTGGTCTGAAAAGGAGATTGCTTTGGCATCTGGG
AGGGGTGATGTAACGATTGCTTCGACTGACAGCTTGAAGAATTTACTTGG
AGAGTCGAGTGAGAAATTTGATCCATGGCCGTCACTCAGCCAAGTGGTGG
ATGGAAGCATTCTTGTGCTCGAGTGTGAGAAACGAGTGAACGATCCAAAC
AACAAAACGAAGACATCTTGGAAATGGACTTCAGAAGAAGATGAAAGCCA
AGATGAAGTGAACTCGATTCGTTATCGATTCAAAGAACTCACTAAACAGA
TGTTATATTTCATCACTGAGGCTGAAAGGTTTTTACCAGCTGTCAAGCCT
CCAAGAATTTTAACCAACGTTTATCGTTTACTATGCTTGAAATCTACAAC
ACCCGAAGAATTATACACGCGGAAAATCAATCTTGAACATTACGGAGAGG
CCTTGGACCTAGCTAAACGTTTTGGTTTGAATACTGATTTAGTTTATCAG
CGACAGTGGAAAAAGAAAAGAGTTTCGAAGATTACCATTCATGATTATCt
gtcCAAGATTAAAGATCGATATTGGGTTTTGGACGAGTGCCTTTTACGAG
TTGCCGATGACTTTGACTCGACAGAAGAGTTACTGAAATACGGTTTACTC
GGTACAAGTTGGGAAATCTTGCAAAGGATTGATGAAGAGGGTAAAGGTGa
tgcaaaggatgatgggaAGTTATTACCTTTTAAATTTGACGCCGCCCCAC
ATGACGAGGATGACGAAAACTCAAGTAGAGAATTCCAAgggagTCTAACG
AAGAAGCAATTGAAAATCTGCCAATATCGACGGCAATTATTACATTATCT
TGATCGGCTTTCCACTTATGAGGTTGTTTTGGGAGGCTCATTCAAAGCAC
GAGATAAATTCTCAAAAGAGTATTTTACCAAATTTCGATCGTGCAATATG
GTACACCAAGCGGTCGAGTGTGCCCGCGACGAGGACGCTTATACTCTGGA
GCATTTGTTTTCGTACCATGGGAAGCAGTTACTACCTTATTGGCTGCCGA
TATTATCAAACTTCCCGGAAACAACCGATATCCGATATTTTGAGCCGGTC
ATCCCTGAGATTGGAGAGCCACCAGAAGATCCAGAGATTTTACCTTGGTT
AGAGAAACACCATCGTGAAGAGGATTGGGTCGAGCAATCGAATATTGTCC
AACAAATCAAGTCTAATGAAGAAGGTGACGCAAACGAAGATATAGGCTCA
TTCATTTTCGAATCCGATCCAGAGATacgaaaattttacaaatgtGAAAC
AAAAGCTCAACTGAGAGAATGGTTTTTACATCGTGTACACTTGATTGATG
AATATTCCGGTCAGATTGATAAATGTTGCGAGCTGTTAGATGTGGGAATC
AAAAGAGGCTTGGAAGGGCTCACTAAGGTTCACCAAGAAATGGAAGCATG
GAGACTCTTAGTTTACGACGTTGGAATTGACAGTAAAATGACTGCAAAGA
GTTTCGTGGAATTATCTGAATCATCGAAAATCAAATTGCTAATGTTCAAA
ACCTCAGATGTGACATTCGTTAACGATTTCAAGCTATATCTAATGCCGTA
TTTAAGAAATATTGGAAAGAAGGATTTTAAGAAACGCCAAGATTTACTTC
ATGAGTTTTTGGTGGAAATCGCTAAAACTGATTTGACATGCTGCTTGAAG
TTATTGGAAAAGTGTTCGCCAGAGCTGCCAGAACCACTGCTTCCTGATAT
GGCGGAGATAATGAAGATTGGGATTGATTGCGTTTACGCGTGCAAGAGAA
CGGATCAATTGAATCATTGTTTCAGCATTGTCGAATGTTTGCCTTCGAGA
GAAGAGGGAGTCATTAGCCGTCCCGTGGAAGAGCTTCACATACAACTGGA
TCAATTGGAACATTTGCTGACAGGAGCGGAAATTTTACAGTATTACAACA
ACCCTCAGACCATCTCTTACATTTCTGAAATTAAAGATGACTCTACTATT
TGTAAACAACTCATTCAGCAATTGGTGAAAAACGCTGTTTGTAAAGGACG
TTGTGTTCCAAAGGAATTGAACAAATTACTCGGACATTTGATCAAGCTTT
CCAAAGAAGTTTTCCGGTGCTGTGATATCAAGATCGTTCACCAGATTTTC
GTTGAAGAATTACTACGGTCCGGTTCACGTGAGAACATAACAGTAGCTGA
AGAGTTGATCACGCCTTCCAAACTTGCCGGGAATTCACCTCAAAGTAAGA
AACCAGAACAACATTTGACGTCTGCACTCTACCTCCTCAAATATGATGTT
TCGGTTACCGTTGTGTTGGAAGCGAGTCGTGAATATTTCAATGCAGCAAT
GTCGGGTAATGACTCTTCAATGGAACTGGCTAGATTGTGTCTAACATTGG
TCAAAGATTGTCCAGAGAGTGTTCAAGATGAATTGGATTTGATCAACTCG
TTGGGTTTATTGTATGAATTCAATGTATCCATGCTACCCTTACAAGTTCG
CCTTTGCGCTGATAAATTGGAAATTATCGATCTTTGTTTGAAGGAGAAGA
AGAATGGGTACAAGAAAAAAGACAAGCTCATCCAATTGAGTAATCTTTTG
CAAATCTGTGGCCATGACAACAAAGAACGGATTGGACAAGTCAATATTAA
AATTGCTGAATCAGCATTTGAACATAAAGATTACACATACGCTGGTATCG
TTTGTGTACAATTGGTGGATGATAATTATTCTAATGCTTGGTATATTTGC
AGGAAACTTGGTGAATGTGCTAAATATACCAACTTCACAATCAGGCAAAA
GTTGTTGAGTTTTGCGTTAACTTATTGTCCAGTACATCACATTGAAGAAG
TTTTACAAGAGAAAACTCAACTGGAAACCCAGGTTTTGTACGAGAGGTTG
GGTGTATTTACGAAAGAAGGCAAGAAAGACAAAATTGTGACCTCATCTAA
GAAAGAAACTGAGGAAGAAAACGACGAAGACAATGTTGATGGGAATAACA
TATCAATCCTCAACAAGACCAAAACTACAACAAAGAAATTGATTTCAAGC
GTCGCCAGCGTGGCTGATAACCGCTGGGTTGGATCCGCAATGAATTGGGT
CAAACCGTCGTCGGAAGGGTCTGGTAACGAAGTTGATGTTGTTGAGCGGG
AAATTGAAAGCGTTCGGCATAACCCATTTTATAGTTCGCTGGATTCGAAA
AAGATTGACGAAGATGTTCAAAGATTTAATTATAACGAGTTCAGCGACCA
TTTGAGGTGCGTCACAACCGAAGAAAAAGTATTCAATCAGCTGGTGTTAA
GAAGTCAAAAATTGAACGAGCAAAGAACCCTGGGTAAAGAGCTCGAAAAC
ACTGACCAAGCAATGCTATCGTTGAGTGATATAGCTTATACTGAAGAAAG
TTGTTTGTGTCTGGCTTACATGATGGCTATTTCTCAGCCAAAAGAAATCC
ATTCCCTATCGACCAAGCATCGGAAAAACACTTTCACTTTCCTTTTCACT
GCTTATTACTATGCATTACAAGAATAtgttaaaaacaacaaaatcgAATT
CGATAAACAAGCACAGATTTACAGCGCGCCTCCGATTGATGTGATTACAT
GGATGCTAAAAGTGTTAGGTAAGAAGCAAGgagaaaaggaagaaaaagaa
aaaggagagACTTACTTTCTGTCTAACATGAACAAGTTGCAAGACTTGAT
GCAAGCAAAGATGCTACAAGCTCTTGACAAAGgaGTGGACATCGAAAGAT
TTTCAGTTGATAATGAATATAAACGTGAAACTATACTCGGATTAGCTATG
AGTGTCGAAGACGAGTTGATTAACACAAGTTTGCTGCTAGCAGAGAAATA
TGATATCCCCGCATGGGAAGTGTTGTTATCACACGTGGAATTTTTATTCA
CTGATAGTGGTCTAAAAGCCAAAGCTATCCGCGAATCACTAAACAAATGG
AAAGTTGATTCCCATTTGAAACCGAACGGTGATAAAGTCTTTGAGCGGAT
GAAGAAATATGTTTACCCAGAAATCAATGGTAAAGACCACAATGCATTGC
TGTTGTTCTACGTTTTCCTAATGAATTGCAGCTCGCCCACTAAAATATTG
GAGGGTACGCTTACATTAGATGCTCATTCcaaacttttgaagaaaatcaa
GGCTGCTGCATCATCCATCAATTACAAACTTCTCGTGCATGGAGATTCAC
CTTTGGAGGTGATTAGAGACTGTGTTGATGATAACAATGTACATTTGTTG
GCTAAAATTGCATCCAAAATCCCCCAGGCGGATGGTAGTTACCTGTCATC
AAACAAGATCTTCTTAGCAAACGCCATTCGGatgttttggaagaaaaaag
aGAACAAGGATTGGTTGAATACATTCGAAAACTGTAAACAACACTTCACC
AAACTCCTGATAGAAGACGTTGTCACTTTTGCTGACCATGCAATTTTTGG
CGAGGAAGCTTTAGACTCGCTGACCCAAGACACCAGACTGGAGATTGGTA
AAAGAGtaataaaatatttgagacaacaACGTGGTCAAGACGAGACCAAA
CAAAGAGGAGCTGACGATTATGATTCGCTTATGGAGCGCTACGATTCATC
TATCAATGATTTGGAACTTTCCATCGAACATCTCAAAACGCTGACTGATC
CAATTTTCAAAGCAGTCTTTGGTGACGATAACGAACTGAGCAAAACCTTT
GGACGAGTATACGACTTATCACGTGGTCGAAAACAACCACTCGAAAAACT
ATTCCGTGATTTGTTCATATCGNTACAACCATTAGACAAAATTTCGAAAC
TGCGGAGTCTTTGTCGCAATGCATCTATTGACGTCCGCACGTGTTTCCAA
GATGCTTTGCGCGGGATCCTGAGTGACATCCAAAGCGATAGAGATTACAC
AAAACTACAGACTTTAACGGAGAACATCAAAGCGCATCAAGAACATCAAA
CAGACCCTCTTGTTACCCATAGCGACGTCTTAGATGTGGTGCGGCCATTT
TGTTCTGATGTTACAGCTAGCACGGATGTGAAGAGTCACGTGTTACATNT
TTTGTTCTGAatggaaGAAAATGAGCAAATATTGTATGATTTGATTGTTC
ACGAAGAATGGAAACAAGAACCACAGTTGTTGGACCAAGTTGAAAGTTAT
TTTTGGCAATATCGTGGTTCACTTCTAAAGAAGCTATGGAAAGTTTCACA
AAGTTCTGCAATTTATATGTGGGACAACTTGAAGACACAATTCAGATATC
AAGCTACCTTTGGTTGCCCACCATTGAATTTTATCAATCTGATGAACAAT
TGCTTGCCATGGCTTATGGCTTTGTCACCGGATGGAAATTTTATTGCCAT
CCTTCAAGATTCTGTTATTGAAATAAGGACTGCTGGAAATTTTGAGCAAG
TCATTACAAAATATAAGATTGAAAAAGATATGTTTCCAAGATGGCGTAAA
TTGATTTGGAATCATGACAACACCTTACTTTGTTATTCAAACAGTTTTGG
AGATTTGACCATTTTGGATATTACCGGCactaaaaaacattttattccaT
CATCAAATAATGTCAAGTTAAAAGTGCCTGGAACGCTGAGTTTGGCATTG
TGTCATGTTGAATTTGTAGCCAAAGGAAATagCTTCTTGTTATATACCTG
CACCTATCAAGGATTTTTTACAGTTTATGAAGTGAATGAATCCTCCTGCA
CAATAAAATGGGACTACTCTTTCATAACATTCCATCCATATGGATTAGCT
GGTTTGGTTATTGATCATAAAAATGGGTTATTGGTTGCAGCTGGGAATTA
TGGGAAGGAACCATTTCCTAATGTCATGGGAGATGCATGTTATGGATCAT
ATTCTGGTATCAGTCTCTGGAGATTTTTGAATGACACACCTCATCTAACT
CTGGTTGAAGACCAGGGAAAAGCTTTGAAGAAGGTATCCAGAGGTGAATG
GTTAAAGAGTGTTGTTTTAAGACGTGGCGATGAAAAAAACGAAATGTTGA
AGCATGGTATTTACAAGTTGAAATTGTCAGAAGATGGTACACAAATTGTC
ACACTGCATCTTGATGGTCGCATATCTTTTTGGAGTATCCCGTCAATGAG
GCTAATCAAAACTTGGAGTAAATCTGAACAACCTGATGCAAGTGGCGGCT
CAAGTGAAGGGTTCTCCTTTGACTCGCAGAAAAAAGAAGaTCTCACCAAA
ACAAGGAATTCAATAGATGTCAGCTGGTGGTCTGAAAAGGAGATTGCTTT
GGCATCTGGGAGGGGTGATGTAACGATTGCTTCGACTGACAGCTTGAAGA
ATTTACTTGGAGAGTCGAGTGAGAAATTTGATCCATGGCCGTCACTCAGC
CAAGTGGTGGATGGAAGCATTCTTGTGCTCGAGTGTGAGAAACGAGTGAA
CGATCCAAACAACAAAACGAAGACATCTTGGAAATGGACTTCAGAAGAAG
ATGAAAGCCAAGATGAAGTGAACTCGATTCGTTATCGATTCAAAGAACTC
ACTAAACAGATGTTATATTTCATCACTGAGGCTGAAAGGTTTTTACCAGC
TGTCAAGCCTCCAAGAATTTTAACCAACGTTTATCGTTTACTATGCTTGA
AATCTACAACACCCGAAGAATTATACACGCGGAAAATCAATCTTGAACAT
TACGGAGAGGCCTTGGACCTAGCTAAACGTTTTGGTTTGAATACTGATTT
AGTTTATCAGCGACAGTGGAAAAAGAAAAGAGTTTCGAAGATTACCATTC
ATGATTATCtgtcCAAGATTAAAGATCGATATTGGGTTTTGGACGAGTGC
CTTTTACGAGTTGCCGATGACTTTGACTCGACAGAAGAGTTACTGAAATA
CGGTTTACTCGGTACAAGTTGGGAAATCTTGCAAAGGATTGATGAAGAGG
GTAAAGGTGatgcaaaggatgatgggaAGTTATTACCTTTTAAATTTGAC
GCCGCCCCACATGACGAGGATGACGAAAACTCAAGTAGAGAATTCCAAgg
gagTCTAACGAAGAAGCAATTGAAAATCTGCCAATATCGACGGCAATTAT
TACATTATCTTGATCGGCTTTCCACTTATGAGGTTGTTTTGGGAGGCTCA
TTCAAAGCACGAGATAAATTCTCAAAAGAGTATTTTACCAAATTTCGATC
GTGCAATATGGTACACCAAGCGGTCGAGTGTGCCCGCGACGAGGACGCTT
ATACTCTGGAGCATTTGTTTTCGTACCATGGGAAGCAGTTACTACCTTAT
TGGCTGCCGATATTATCAAACTTCCCGGAAACAACCGATATCCGATATTT
TGAGCCGGTCATCCCTGAGATTGGAGAGCCACCAGAAGATCCAGAGATTT
TACCTTGGTTAGAGAAACACCATCGTGAAGAGGATTGGGTCGAGCAATCG
AATATTGTCCAACAAATCAAGTCTAATGAAGAAGGTGACGCAAACGAAGA
TATAGGCTCATTCATTTTCGAATCCGATCCAGAGATacgaaaattttaca
aatgtGAAACAAAAGCTCAACTGAGAGAATGGTTTTTACATCGTGTACAC
TTGATTGATGAATATTCCGGTCAGATTGATAAATGTTGCGAGCTGTTAGA
TGTGGGAATCAAAAGAGGCTTGGAAGGGCTCACTAAGGTTCACCAAGAAA
TGGAAGCATGGAGACTCTTAGTTTACGACGTTGGAATTGACAGTAAAATG
ACTGCAAAGAGTTTCGTGGAATTATCTGAATCATCGAAAATCAAATTGCT
AATGTTCAAAACCTCAGATGTGACATTCGTTAACGATTTCAAGCTATATC
TAATGCCGTATTTAAGAAATATTGGAAAGAAGGATTTTAAGAAACGCCAA
GATTTACTTCATGAGTTTTTGGTGGAAATCGCTAAAACTGATTTGACATG
CTGCTTGAAGTTATTGGAAAAGTGTTCGCCAGAGCTGCCAGAACCACTGC
TTCCTGATATGGCGGAGATAATGAAGATTGGGATTGATTGCGTTTACGCG
TGCAAGAGAACGGATCAATTGAATCATTGTTTCAGCATTGTCGAATGTTT
GCCTTCGAGAGAAGAGGGAGTCATTAGCCGTCCCGTGGAAGAGCTTCACA
TACAACTGGATCAATTGGAACATTTGCTGACAGGAGCGGAAATTTTACAG
TATTACAACAACCCTCAGACCATCTCTTACATTTCTGAAATTAAAGATGA
CTCTACTATTTGTAAACAACTCATTCAGCAATTGGTGAAAAACGCTGTTT
GTAAAGGACGTTGTGTTCCAAAGGAATTGAACAAATTACTCGGACATTTG
ATCAAGCTTTCCAAAGAAGTTTTCCGGTGCTGTGATATCAAGATCGTTCA
CCAGATTTTCGTTGAAGAATTACTACGGTCCGGTTCACGTGAGAACATAA
CAGTAGCTGAAGAGTTGATCACGCCTTCCAAACTTGCCGGGAATTCACCT
CAAAGTAAGAAACCAGAACAACATTTGACGTCTGCACTCTACCTCCTCAA
ATATGATGTTTCGGTTACCGTTGTGTTGGAAGCGAGTCGTGAATATTTCA
ATGCAGCAATGTCGGGTAATGACTCTTCAATGGAACTGGCTAGATTGTGT
CTAACATTGGTCAAAGATTGTCCAGAGAGTGTTCAAGATGAATTGGATTT
GATCAACTCGTTGGGTTTATTGTATGAATTCAATGTATCCATGCTACCCT
TACAAGTTCGCCTTTGCGCTGATAAATTGGAAATTATCGATCTTTGTTTG
AAGGAGAAGAAGAATGGGTACAAGAAAAAAGACAAGCTCATCCAATTGAG
TAATCTTTTGCAAATCTGTGGCCATGACAACAAAGAACGGATTGGACAAG
TCAATATTAAAATTGCTGAATCAGCATTTGAACATAAAGATTACACATAC
GCTGGTATCGTTTGTGTACAATTGGTGGATGATAATTATTCTAATGCTTG
GTATATTTGCAGGAAACTTGGTGAATGTGCTAAATATACCAACTTCACAA
TCAGGCAAAAGTTGTTGAGTTTTGCGTTAACTTATTGTCCAGTACATCAC
ATTGAAGAAGTTTTACAAGAGAAAACTCAACTGGAAACCCAGGTTTTGTA
CGAGAGGTTGGGTGTATTTACGAAAGAAGGCAAGAAAGACAAAATTGTGA
CCTCATCTAAGAAAGAAACTGAGGAAGAAAACGACGAAGACAATGTTGAT
GGGAATAACATATCAATCCTCAACAAGACCAAAACTACAACAAAGAAATT
GATTTCAAGCGTCGCCAGCGTGGCTGATAACCGCTGGGTTGGATCCGCAA
TGAATTGGGTCAAACCGTCGTCGGAAGGGTCTGGTAACGAAGTTGATGTT
GTTGAGCGGGAAATTGAAAGCGTTCGGCATAACCCATTTTATAGTTCGCT
GGATTCGAAAAAGATTGACGAAGATGTTCAAAGATTTAATTATAACGAGT
TCAGCGACCATTTGAGGTGCGTCACAACCGAAGAAAAAGTATTCAATCAG
CTGGTGTTAAGAAGTCAAAAATTGAACGAGCAAAGAACCCTGGGTAAAGA
GCTCGAAAACACTGACCAAGCAATGCTATCGTTGAGTGATATAGCTTATA
CTGAAGAAAGTTGTTTGTGTCTGGCTTACATGATGGCTATTTCTCAGCCA
AAAGAAATCCATTCCCTATCGACCAAGCATCGGAAAAACACTTTCACTTT
CCTTTTCACTGCTTATTACTATGCATTACAAGAATAtgttaaaaacaaca
aaatcgAATTCGATAAACAAGCACAGATTTACAGCGCGCCTCCGATTGAT
GTGATTACATGGATGCTAAAAGTGTTAGGTAAGAAGCAAGgagaaaagga
agaaaaagaaaaaggagagACTTACTTTCTGTCTAACATGAACAAGTTGC
AAGACTTGATGCAAGCAAAGATGCTACAAGCTCTTGACAAAGgaGTGGAC
ATCGAAAGATTTTCAGTTGATAATGAATATAAACGTGAAACTATACTCGG
ATTAGCTATGAGTGTCGAAGACGAGTTGATTAACACAAGTTTGCTGCTAG
CAGAGAAATATGATATCCCCGCATGGGAAGTGTTGTTATCACACGTGGAA
TTTTTATTCACTGATAGTGGTCTAAAAGCCAAAGCTATCCGCGAATCACT
AAACAAATGGAAAGTTGATTCCCATTTGAAACCGAACGGTGATAAAGTCT
TTGAGCGGATGAAGAAATATGTTTACCCAGAAATCAATGGTAAAGACCAC
AATGCATTGCTGTTGTTCTACGTTTTCCTAATGAATTGCAGCTCGCCCAC
TAAAATATTGGAGGGTACGCTTACATTAGATGCTCATTCcaaacttttga
agaaaatcaaGGCTGCTGCATCATCCATCAATTACAAACTTCTCGTGCAT
GGAGATTCACCTTTGGAGGTGATTAGAGACTGTGTTGATGATAACAATGT
ACATTTGTTGGCTAAAATTGCATCCAAAATCCCCCAGGCGGATGGTAGTT
ACCTGTCATCAAACAAGATCTTCTTAGCAAACGCCATTCGGatgttttgg
aagaaaaaagaGAACAAGGATTGGTTGAATACATTCGAAAACTGTAAACA
ACACTTCACCAAACTCCTGATAGAAGACGTTGTCACTTTTGCTGACCATG
CAATTTTTGGCGAGGAAGCTTTAGACTCGCTGACCCAAGACACCAGACTG
GAGATTGGTAAAAGAGtaataaaatatttgagacaacaACGTGGTCAAGA
CGAGACCAAACAAAGAGGAGCTGACGATTATGATTCGCTTATGGAGCGCT
ACGATTCATCTATCAATGATTTGGAACTTTCCATCGAACATCTCAAAACG
CTGACTGATCCAATTTTCAAAGCAGTCTTTGGTGACGATAACGAACTGAG
CAAAACCTTTGGACGAGTATACGACTTATCACGTGGTCGAAAACAACCAC
TCGAAAAACTATTCCGTGATTTGTTCATATCGNTACAACCATTAGACAAA
ATTTCGAAACTGCGGAGTCTTTGTCGCAATGCATCTATTGACGTCCGCAC
GTGTTTCCAAGATGCTTTGCGCGGGATCCTGAGTGACATCCAAAGCGATA
GAGATTACACAAAACTACAGACTTTAACGGAGAACATCAAAGCGCATCAA
GAACATCAAACAGACCCTCTTGTTACCCATAGCGACGTCTTAGATGTGGT
GCGGCCATTTTGTTCTGATGTTACAGCTAGCACGGATGTGAAGAGTCACG
TGTTACATNTTTTGTTCTGAatggaaGAAAATGAGCAAATATTGTATGAT
TTGATTGTTCACGAAGAATGGAAACAAGAACCACAGTTGTTGGACCAAGT
TGAAAGTTATTTTTGGCAATATCGTGGTTCACTTCTAAAGAAGCTATGGA
AAGTTTCACAAAGTTCTGCAATTTATATGTGGGACAACTTGAAGACACAA
TTCAGATATCAAGCTACCTTTGGTTGCCCACCATTGAATTTTATCAATCT
GATGAACAATTGCTTGCCATGGCTTATGGCTTTGTCACCGGATGGAAATT
TTATTGCCATCCTTCAAGATTCTGTTATTGAAATAAGGACTGCTGGAAAT
TTTGAGCAAGTCATTACAAAATATAAGATTGAAAAAGATATGTTTCCAAG
ATGGCGTAAATTGATTTGGAATCATGACAACACCTTACTTTGTTATTCAA
ACAGTTTTGGAGATTTGACCATTTTGGATATTACCGGCactaaaaaacat
tttattccaTCATCAAATAATGTCAAGTTAAAAGTGCCTGGAACGCTGAG
TTTGGCATTGTGTCATGTTGAATTTGTAGCCAAAGGAAATagCTTCTTGT
TATATACCTGCACCTATCAAGGATTTTTTACAGTTTATGAAGTGAATGAA
TCCTCCTGCACAATAAAATGGGACTACTCTTTCATAACATTCCATCCATA
TGGATTAGCTGGTTTGGTTATTGATCATAAAAATGGGTTATTGGTTGCAG
CTGGGAATTATGGGAAGGAACCATTTCCTAATGTCATGGGAGATGCATGT
TATGGATCATATTCTGGTATCAGTCTCTGGAGATTTTTGAATGACACACC
TCATCTAACTCTGGTTGAAGACCAGGGAAAAGCTTTGAAGAAGGTATCCA
GAGGTGAATGGTTAAAGAGTGTTGTTTTAAGACGTGGCGATGAAAAAAAC
GAAATGTTGAAGCATGGTATTTACAAGTTGAAATTGTCAGAAGATGGTAC
ACAAATTGTCACACTGCATCTTGATGGTCGCATATCTTTTTGGAGTATCC
CGTCAATGAGGCTAATCAAAACTTGGAGTAAATCTGAACAACCTGATGCA
AGTGGCGGCTCAAGTGAAGGGTTCTCCTTTGACTCGCAGAAAAAAGAAGa
TCTCACCAAAACAAGGAATTCAATAGATGTCAGCTGGTGGTCTGAAAAGG
AGATTGCTTTGGCATCTGGGAGGGGTGATGTAACGATTGCTTCGACTGAC
AGCTTGAAGAATTTACTTGGAGAGTCGAGTGAGAAATTTGATCCATGGCC
GTCACTCAGCCAAGTGGTGGATGGAAGCATTCTTGTGCTCGAGTGTGAGA
AACGAGTGAACGATCCAAACAACAAAACGAAGACATCTTGGAAATGGACT
TCAGAAGAAGATGAAAGCCAAGATGAAGTGAACTCGATTCGTTATCGATT
CAAAGAACTCACTAAACAGATGTTATATTTCATCACTGAGGCTGAAAGGT
TTTTACCAGCTGTCAAGCCTCCAAGAATTTTAACCAACGTTTATCGTTTA
CTATGCTTGAAATCTACAACACCCGAAGAATTATACACGCGGAAAATCAA
TCTTGAACATTACGGAGAGGCCTTGGACCTAGCTAAACGTTTTGGTTTGA
ATACTGATTTAGTTTATCAGCGACAGTGGAAAAAGAAAAGAGTTTCGAAG
ATTACCATTCATGATTATCtgtcCAAGATTAAAGATCGATATTGGGTTTT
GGACGAGTGCCTTTTACGAGTTGCCGATGACTTTGACTCGACAGAAGAGT
TACTGAAATACGGTTTACTCGGTACAAGTTGGGAAATCTTGCAAAGGATT
GATGAAGAGGGTAAAGGTGatgcaaaggatgatgggaAGTTATTACCTTT
TAAATTTGACGCCGCCCCACATGACGAGGATGACGAAAACTCAAGTAGAG
AATTCCAAgggagTCTAACGAAGAAGCAATTGAAAATCTGCCAATATCGA
CGGCAATTATTACATTATCTTGATCGGCTTTCCACTTATGAGGTTGTTTT
GGGAGGCTCATTCAAAGCACGAGATAAATTCTCAAAAGAGTATTTTACCA
AATTTCGATCGTGCAATATGGTACACCAAGCGGTCGAGTGTGCCCGCGAC
GAGGACGCTTATACTCTGGAGCATTTGTTTTCGTACCATGGGAAGCAGTT
ACTACCTTATTGGCTGCCGATATTATCAAACTTCCCGGAAACAACCGATA
TCCGATATTTTGAGCCGGTCATCCCTGAGATTGGAGAGCCACCAGAAGAT
CCAGAGATTTTACCTTGGTTAGAGAAACACCATCGTGAAGAGGATTGGGT
CGAGCAATCGAATATTGTCCAACAAATCAAGTCTAATGAAGAAGGTGACG
CAAACGAAGATATAGGCTCATTCATTTTCGAATCCGATCCAGAGATacga
aaattttacaaatgtGAAACAAAAGCTCAACTGAGAGAATGGTTTTTACA
TCGTGTACACTTGATTGATGAATATTCCGGTCAGATTGATAAATGTTGCG
AGCTGTTAGATGTGGGAATCAAAAGAGGCTTGGAAGGGCTCACTAAGGTT
CACCAAGAAATGGAAGCATGGAGACTCTTAGTTTACGACGTTGGAATTGA
CAGTAAAATGACTGCAAAGAGTTTCGTGGAATTATCTGAATCATCGAAAA
TCAAATTGCTAATGTTCAAAACCTCAGATGTGACATTCGTTAACGATTTC
AAGCTATATCTAATGCCGTATTTAAGAAATATTGGAAAGAAGGATTTTAA
GAAACGCCAAGATTTACTTCATGAGTTTTTGGTGGAAATCGCTAAAACTG
ATTTGACATGCTGCTTGAAGTTATTGGAAAAGTGTTCGCCAGAGCTGCCA
GAACCACTGCTTCCTGATATGGCGGAGATAATGAAGATTGGGATTGATTG
CGTTTACGCGTGCAAGAGAACGGATCAATTGAATCATTGTTTCAGCATTG
TCGAATGTTTGCCTTCGAGAGAAGAGGGAGTCATTAGCCGTCCCGTGGAA
GAGCTTCACATACAACTGGATCAATTGGAACATTTGCTGACAGGAGCGGA
AATTTTACAGTATTACAACAACCCTCAGACCATCTCTTACATTTCTGAAA
TTAAAGATGACTCTACTATTTGTAAACAACTCATTCAGCAATTGGTGAAA
AACGCTGTTTGTAAAGGACGTTGTGTTCCAAAGGAATTGAACAAATTACT
CGGACATTTGATCAAGCTTTCCAAAGAAGTTTTCCGGTGCTGTGATATCA
AGATCGTTCACCAGATTTTCGTTGAAGAATTACTACGGTCCGGTTCACGT
GAGAACATAACAGTAGCTGAAGAGTTGATCACGCCTTCCAAACTTGCCGG
GAATTCACCTCAAAGTAAGAAACCAGAACAACATTTGACGTCTGCACTCT
ACCTCCTCAAATATGATGTTTCGGTTACCGTTGTGTTGGAAGCGAGTCGT
GAATATTTCAATGCAGCAATGTCGGGTAATGACTCTTCAATGGAACTGGC
TAGATTGTGTCTAACATTGGTCAAAGATTGTCCAGAGAGTGTTCAAGATG
AATTGGATTTGATCAACTCGTTGGGTTTATTGTATGAATTCAATGTATCC
ATGCTACCCTTACAAGTTCGCCTTTGCGCTGATAAATTGGAAATTATCGA
TCTTTGTTTGAAGGAGAAGAAGAATGGGTACAAGAAAAAAGACAAGCTCA
TCCAATTGAGTAATCTTTTGCAAATCTGTGGCCATGACAACAAAGAACGG
ATTGGACAAGTCAATATTAAAATTGCTGAATCAGCATTTGAACATAAAGA
TTACACATACGCTGGTATCGTTTGTGTACAATTGGTGGATGATAATTATT
CTAATGCTTGGTATATTTGCAGGAAACTTGGTGAATGTGCTAAATATACC
AACTTCACAATCAGGCAAAAGTTGTTGAGTTTTGCGTTAACTTATTGTCC
AGTACATCACATTGAAGAAGTTTTACAAGAGAAAACTCAACTGGAAACCC
AGGTTTTGTACGAGAGGTTGGGTGTATTTACGAAAGAAGGCAAGAAAGAC
AAAATTGTGACCTCATCTAAGAAAGAAACTGAGGAAGAAAACGACGAAGA
CAATGTTGATGGGAATAACATATCAATCCTCAACAAGACCAAAACTACAA
CAAAGAAATTGATTTCAAGCGTCGCCAGCGTGGCTGATAACCGCTGGGTT
GGATCCGCAATGAATTGGGTCAAACCGTCGTCGGAAGGGTCTGGTAACGA
AGTTGATGTTGTTGAGCGGGAAATTGAAAGCGTTCGGCATAACCCATTTT
ATAGTTCGCTGGATTCGAAAAAGATTGACGAAGATGTTCAAAGATTTAAT
TATAACGAGTTCAGCGACCATTTGAGGTGCGTCACAACCGAAGAAAAAGT
ATTCAATCAGCTGGTGTTAAGAAGTCAAAAATTGAACGAGCAAAGAACCC
TGGGTAAAGAGCTCGAAAACACTGACCAAGCAATGCTATCGTTGAGTGAT
ATAGCTTATACTGAAGAAAGTTGTTTGTGTCTGGCTTACATGATGGCTAT
TTCTCAGCCAAAAGAAATCCATTCCCTATCGACCAAGCATCGGAAAAACA
CTTTCACTTTCCTTTTCACTGCTTATTACTATGCATTACAAGAATAtgtt
aaaaacaacaaaatcgAATTCGATAAACAAGCACAGATTTACAGCGCGCC
TCCGATTGATGTGATTACATGGATGCTAAAAGTGTTAGGTAAGAAGCAAG
gagaaaaggaagaaaaagaaaaaggagagACTTACTTTCTGTCTAACATG
AACAAGTTGCAAGACTTGATGCAAGCAAAGATGCTACAAGCTCTTGACAA
AGgaGTGGACATCGAAAGATTTTCAGTTGATAATGAATATAAACGTGAAA
CTATACTCGGATTAGCTATGAGTGTCGAAGACGAGTTGATTAACACAAGT
TTGCTGCTAGCAGAGAAATATGATATCCCCGCATGGGAAGTGTTGTTATC
ACACGTGGAATTTTTATTCACTGATAGTGGTCTAAAAGCCAAAGCTATCC
GCGAATCACTAAACAAATGGAAAGTTGATTCCCATTTGAAACCGAACGGT
GATAAAGTCTTTGAGCGGATGAAGAAATATGTTTACCCAGAAATCAATGG
TAAAGACCACAATGCATTGCTGTTGTTCTACGTTTTCCTAATGAATTGCA
GCTCGCCCACTAAAATATTGGAGGGTACGCTTACATTAGATGCTCATTCc
aaacttttgaagaaaatcaaGGCTGCTGCATCATCCATCAATTACAAACT
TCTCGTGCATGGAGATTCACCTTTGGAGGTGATTAGAGACTGTGTTGATG
ATAACAATGTACATTTGTTGGCTAAAATTGCATCCAAAATCCCCCAGGCG
GATGGTAGTTACCTGTCATCAAACAAGATCTTCTTAGCAAACGCCATTCG
GatgttttggaagaaaaaagaGAACAAGGATTGGTTGAATACATTCGAAA
ACTGTAAACAACACTTCACCAAACTCCTGATAGAAGACGTTGTCACTTTT
GCTGACCATGCAATTTTTGGCGAGGAAGCTTTAGACTCGCTGACCCAAGA
CACCAGACTGGAGATTGGTAAAAGAGtaataaaatatttgagacaacaAC
GTGGTCAAGACGAGACCAAACAAAGAGGAGCTGACGATTATGATTCGCTT
ATGGAGCGCTACGATTCATCTATCAATGATTTGGAACTTTCCATCGAACA
TCTCAAAACGCTGACTGATCCAATTTTCAAAGCAGTCTTTGGTGACGATA
ACGAACTGAGCAAAACCTTTGGACGAGTATACGACTTATCACGTGGTCGA
AAACAACCACTCGAAAAACTATTCCGTGATTTGTTCATATCGNTACAACC
ATTAGACAAAATTTCGAAACTGCGGAGTCTTTGTCGCAATGCATCTATTG
ACGTCCGCACGTGTTTCCAAGATGCTTTGCGCGGGATCCTGAGTGACATC
CAAAGCGATAGAGATTACACAAAACTACAGACTTTAACGGAGAACATCAA
AGCGCATCAAGAACATCAAACAGACCCTCTTGTTACCCATAGCGACGTCT
TAGATGTGGTGCGGCCATTTTGTTCTGATGTTACAGCTAGCACGGATGTG
AAGAGTCACGTGTTACATNTTTTGTTCTGAatggaaGAAAATGAGCAAAT
ATTGTATGATTTGATTGTTCACGAAGAATGGAAACAAGAACCACAGTTGT
TGGACCAAGTTGAAAGTTATTTTTGGCAATATCGTGGTTCACTTCTAAAG
AAGCTATGGAAAGTTTCACAAAGTTCTGCAATTTATATGTGGGACAACTT
GAAGACACAATTCAGATATCAAGCTACCTTTGGTTGCCCACCATTGAATT
TTATCAATCTGATGAACAATTGCTTGCCATGGCTTATGGCTTTGTCACCG
GATGGAAATTTTATTGCCATCCTTCAAGATTCTGTTATTGAAATAAGGAC
TGCTGGAAATTTTGAGCAAGTCATTACAAAATATAAGATTGAAAAAGATA
TGTTTCCAAGATGGCGTAAATTGATTTGGAATCATGACAACACCTTACTT
TGTTATTCAAACAGTTTTGGAGATTTGACCATTTTGGATATTACCGGCac
taaaaaacattttattccaTCATCAAATAATGTCAAGTTAAAAGTGCCTG
GAACGCTGAGTTTGGCATTGTGTCATGTTGAATTTGTAGCCAAAGGAAAT
agCTTCTTGTTATATACCTGCACCTATCAAGGATTTTTTACAGTTTATGA
AGTGAATGAATCCTCCTGCACAATAAAATGGGACTACTCTTTCATAACAT
TCCATCCATATGGATTAGCTGGTTTGGTTATTGATCATAAAAATGGGTTA
TTGGTTGCAGCTGGGAATTATGGGAAGGAACCATTTCCTAATGTCATGGG
AGATGCATGTTATGGATCATATTCTGGTATCAGTCTCTGGAGATTTTTGA
ATGACACACCTCATCTAACTCTGGTTGAAGACCAGGGAAAAGCTTTGAAG
AAGGTATCCAGAGGTGAATGGTTAAAGAGTGTTGTTTTAAGACGTGGCGA
TGAAAAAAACGAAATGTTGAAGCATGGTATTTACAAGTTGAAATTGTCAG
AAGATGGTACACAAATTGTCACACTGCATCTTGATGGTCGCATATCTTTT
TGGAGTATCCCGTCAATGAGGCTAATCAAAACTTGGAGTAAATCTGAACA
ACCTGATGCAAGTGGCGGCTCAAGTGAAGGGTTCTCCTTTGACTCGCAGA
AAAAAGAAGaTCTCACCAAAACAAGGAATTCAATAGATGTCAGCTGGTGG
TCTGAAAAGGAGATTGCTTTGGCATCTGGGAGGGGTGATGTAACGATTGC
TTCGACTGACAGCTTGAAGAATTTACTTGGAGAGTCGAGTGAGAAATTTG
ATCCATGGCCGTCACTCAGCCAAGTGGTGGATGGAAGCATTCTTGTGCTC
GAGTGTGAGAAACGAGTGAACGATCCAAACAACAAAACGAAGACATCTTG
GAAATGGACTTCAGAAGAAGATGAAAGCCAAGATGAAGTGAACTCGATTC
GTTATCGATTCAAAGAACTCACTAAACAGATGTTATATTTCATCACTGAG
GCTGAAAGGTTTTTACCAGCTGTCAAGCCTCCAAGAATTTTAACCAACGT
TTATCGTTTACTATGCTTGAAATCTACAACACCCGAAGAATTATACACGC
GGAAAATCAATCTTGAACATTACGGAGAGGCCTTGGACCTAGCTAAACGT
TTTGGTTTGAATACTGATTTAGTTTATCAGCGACAGTGGAAAAAGAAAAG
AGTTTCGAAGATTACCATTCATGATTATCtgtcCAAGATTAAAGATCGAT
ATTGGGTTTTGGACGAGTGCCTTTTACGAGTTGCCGATGACTTTGACTCG
ACAGAAGAGTTACTGAAATACGGTTTACTCGGTACAAGTTGGGAAATCTT
GCAAAGGATTGATGAAGAGGGTAAAGGTGatgcaaaggatgatgggaAGT
TATTACCTTTTAAATTTGACGCCGCCCCACATGACGAGGATGACGAAAAC
TCAAGTAGAGAATTCCAAgggagTCTAACGAAGAAGCAATTGAAAATCTG
CCAATATCGACGGCAATTATTACATTATCTTGATCGGCTTTCCACTTATG
AGGTTGTTTTGGGAGGCTCATTCAAAGCACGAGATAAATTCTCAAAAGAG
TATTTTACCAAATTTCGATCGTGCAATATGGTACACCAAGCGGTCGAGTG
TGCCCGCGACGAGGACGCTTATACTCTGGAGCATTTGTTTTCGTACCATG
GGAAGCAGTTACTACCTTATTGGCTGCCGATATTATCAAACTTCCCGGAA
ACAACCGATATCCGATATTTTGAGCCGGTCATCCCTGAGATTGGAGAGCC
ACCAGAAGATCCAGAGATTTTACCTTGGTTAGAGAAACACCATCGTGAAG
AGGATTGGGTCGAGCAATCGAATATTGTCCAACAAATCAAGTCTAATGAA
GAAGGTGACGCAAACGAAGATATAGGCTCATTCATTTTCGAATCCGATCC
AGAGATacgaaaattttacaaatgtGAAACAAAAGCTCAACTGAGAGAAT
GGTTTTTACATCGTGTACACTTGATTGATGAATATTCCGGTCAGATTGAT
AAATGTTGCGAGCTGTTAGATGTGGGAATCAAAAGAGGCTTGGAAGGGCT
CACTAAGGTTCACCAAGAAATGGAAGCATGGAGACTCTTAGTTTACGACG
TTGGAATTGACAGTAAAATGACTGCAAAGAGTTTCGTGGAATTATCTGAA
TCATCGAAAATCAAATTGCTAATGTTCAAAACCTCAGATGTGACATTCGT
TAACGATTTCAAGCTATATCTAATGCCGTATTTAAGAAATATTGGAAAGA
AGGATTTTAAGAAACGCCAAGATTTACTTCATGAGTTTTTGGTGGAAATC
GCTAAAACTGATTTGACATGCTGCTTGAAGTTATTGGAAAAGTGTTCGCC
AGAGCTGCCAGAACCACTGCTTCCTGATATGGCGGAGATAATGAAGATTG
GGATTGATTGCGTTTACGCGTGCAAGAGAACGGATCAATTGAATCATTGT
TTCAGCATTGTCGAATGTTTGCCTTCGAGAGAAGAGGGAGTCATTAGCCG
TCCCGTGGAAGAGCTTCACATACAACTGGATCAATTGGAACATTTGCTGA
CAGGAGCGGAAATTTTACAGTATTACAACAACCCTCAGACCATCTCTTAC
ATTTCTGAAATTAAAGATGACTCTACTATTTGTAAACAACTCATTCAGCA
ATTGGTGAAAAACGCTGTTTGTAAAGGACGTTGTGTTCCAAAGGAATTGA
ACAAATTACTCGGACATTTGATCAAGCTTTCCAAAGAAGTTTTCCGGTGC
TGTGATATCAAGATCGTTCACCAGATTTTCGTTGAAGAATTACTACGGTC
CGGTTCACGTGAGAACATAACAGTAGCTGAAGAGTTGATCACGCCTTCCA
AACTTGCCGGGAATTCACCTCAAAGTAAGAAACCAGAACAACATTTGACG
TCTGCACTCTACCTCCTCAAATATGATGTTTCGGTTACCGTTGTGTTGGA
AGCGAGTCGTGAATATTTCAATGCAGCAATGTCGGGTAATGACTCTTCAA
TGGAACTGGCTAGATTGTGTCTAACATTGGTCAAAGATTGTCCAGAGAGT
GTTCAAGATGAATTGGATTTGATCAACTCGTTGGGTTTATTGTATGAATT
CAATGTATCCATGCTACCCTTACAAGTTCGCCTTTGCGCTGATAAATTGG
AAATTATCGATCTTTGTTTGAAGGAGAAGAAGAATGGGTACAAGAAAAAA
GACAAGCTCATCCAATTGAGTAATCTTTTGCAAATCTGTGGCCATGACAA
CAAAGAACGGATTGGACAAGTCAATATTAAAATTGCTGAATCAGCATTTG
AACATAAAGATTACACATACGCTGGTATCGTTTGTGTACAATTGGTGGAT
GATAATTATTCTAATGCTTGGTATATTTGCAGGAAACTTGGTGAATGTGC
TAAATATACCAACTTCACAATCAGGCAAAAGTTGTTGAGTTTTGCGTTAA
CTTATTGTCCAGTACATCACATTGAAGAAGTTTTACAAGAGAAAACTCAA
CTGGAAACCCAGGTTTTGTACGAGAGGTTGGGTGTATTTACGAAAGAAGG
CAAGAAAGACAAAATTGTGACCTCATCTAAGAAAGAAACTGAGGAAGAAA
ACGACGAAGACAATGTTGATGGGAATAACATATCAATCCTCAACAAGACC
AAAACTACAACAAAGAAATTGATTTCAAGCGTCGCCAGCGTGGCTGATAA
CCGCTGGGTTGGATCCGCAATGAATTGGGTCAAACCGTCGTCGGAAGGGT
CTGGTAACGAAGTTGATGTTGTTGAGCGGGAAATTGAAAGCGTTCGGCAT
AACCCATTTTATAGTTCGCTGGATTCGAAAAAGATTGACGAAGATGTTCA
AAGATTTAATTATAACGAGTTCAGCGACCATTTGAGGTGCGTCACAACCG
AAGAAAAAGTATTCAATCAGCTGGTGTTAAGAAGTCAAAAATTGAACGAG
CAAAGAACCCTGGGTAAAGAGCTCGAAAACACTGACCAAGCAATGCTATC
GTTGAGTGATATAGCTTATACTGAAGAAAGTTGTTTGTGTCTGGCTTACA
TGATGGCTATTTCTCAGCCAAAAGAAATCCATTCCCTATCGACCAAGCAT
CGGAAAAACACTTTCACTTTCCTTTTCACTGCTTATTACTATGCATTACA
AGAATAtgttaaaaacaacaaaatcgAATTCGATAAACAAGCACAGATTT
ACAGCGCGCCTCCGATTGATGTGATTACATGGATGCTAAAAGTGTTAGGT
AAGAAGCAAGgagaaaaggaagaaaaagaaaaaggagagACTTACTTTCT
GTCTAACATGAACAAGTTGCAAGACTTGATGCAAGCAAAGATGCTACAAG
CTCTTGACAAAGgaGTGGACATCGAAAGATTTTCAGTTGATAATGAATAT
AAACGTGAAACTATACTCGGATTAGCTATGAGTGTCGAAGACGAGTTGAT
TAACACAAGTTTGCTGCTAGCAGAGAAATATGATATCCCCGCATGGGAAG
TGTTGTTATCACACGTGGAATTTTTATTCACTGATAGTGGTCTAAAAGCC
AAAGCTATCCGCGAATCACTAAACAAATGGAAAGTTGATTCCCATTTGAA
ACCGAACGGTGATAAAGTCTTTGAGCGGATGAAGAAATATGTTTACCCAG
AAATCAATGGTAAAGACCACAATGCATTGCTGTTGTTCTACGTTTTCCTA
ATGAATTGCAGCTCGCCCACTAAAATATTGGAGGGTACGCTTACATTAGA
TGCTCATTCcaaacttttgaagaaaatcaaGGCTGCTGCATCATCCATCA
ATTACAAACTTCTCGTGCATGGAGATTCACCTTTGGAGGTGATTAGAGAC
TGTGTTGATGATAACAATGTACATTTGTTGGCTAAAATTGCATCCAAAAT
CCCCCAGGCGGATGGTAGTTACCTGTCATCAAACAAGATCTTCTTAGCAA
ACGCCATTCGGatgttttggaagaaaaaagaGAACAAGGATTGGTTGAAT
ACATTCGAAAACTGTAAACAACACTTCACCAAACTCCTGATAGAAGACGT
TGTCACTTTTGCTGACCATGCAATTTTTGGCGAGGAAGCTTTAGACTCGC
TGACCCAAGACACCAGACTGGAGATTGGTAAAAGAGtaataaaatatttg
agacaacaACGTGGTCAAGACGAGACCAAACAAAGAGGAGCTGACGATTA
TGATTCGCTTATGGAGCGCTACGATTCATCTATCAATGATTTGGAACTTT
CCATCGAACATCTCAAAACGCTGACTGATCCAATTTTCAAAGCAGTCTTT
GGTGACGATAACGAACTGAGCAAAACCTTTGGACGAGTATACGACTTATC
ACGTGGTCGAAAACAACCACTCGAAAAACTATTCCGTGATTTGTTCATAT
CGNTACAACCATTAGACAAAATTTCGAAACTGCGGAGTCTTTGTCGCAAT
GCATCTATTGACGTCCGCACGTGTTTCCAAGATGCTTTGCGCGGGATCCT
GAGTGACATCCAAAGCGATAGAGATTACACAAAACTACAGACTTTAACGG
AGAACATCAAAGCGCATCAAGAACATCAAACAGACCCTCTTGTTACCCAT
AGCGACGTCTTAGATGTGGTGCGGCCATTTTGTTCTGATGTTACAGCTAG
CACGGATGTGAAGAGTCACGTGTTACATNTTTTGTTCTGAatggaaGAAA
ATGAGCAAATATTGTATGATTTGATTGTTCACGAAGAATGGAAACAAGAA
CCACAGTTGTTGGACCAAGTTGAAAGTTATTTTTGGCAATATCGTGGTTC
ACTTCTAAAGAAGCTATGGAAAGTTTCACAAAGTTCTGCAATTTATATGT
GGGACAACTTGAAGACACAATTCAGATATCAAGCTACCTTTGGTTGCCCA
CCATTGAATTTTATCAATCTGATGAACAATTGCTTGCCATGGCTTATGGC
TTTGTCACCGGATGGAAATTTTATTGCCATCCTTCAAGATTCTGTTATTG
AAATAAGGACTGCTGGAAATTTTGAGCAAGTCATTACAAAATATAAGATT
GAAAAAGATATGTTTCCAAGATGGCGTAAATTGATTTGGAATCATGACAA
CACCTTACTTTGTTATTCAAACAGTTTTGGAGATTTGACCATTTTGGATA
TTACCGGCactaaaaaacattttattccaTCATCAAATAATGTCAAGTTA
AAAGTGCCTGGAACGCTGAGTTTGGCATTGTGTCATGTTGAATTTGTAGC
CAAAGGAAATagCTTCTTGTTATATACCTGCACCTATCAAGGATTTTTTA
CAGTTTATGAAGTGAATGAATCCTCCTGCACAATAAAATGGGACTACTCT
TTCATAACATTCCATCCATATGGATTAGCTGGTTTGGTTATTGATCATAA
AAATGGGTTATTGGTTGCAGCTGGGAATTATGGGAAGGAACCATTTCCTA
ATGTCATGGGAGATGCATGTTATGGATCATATTCTGGTATCAGTCTCTGG
AGATTTTTGAATGACACACCTCATCTAACTCTGGTTGAAGACCAGGGAAA
AGCTTTGAAGAAGGTATCCAGAGGTGAATGGTTAAAGAGTGTTGTTTTAA
GACGTGGCGATGAAAAAAACGAAATGTTGAAGCATGGTATTTACAAGTTG
AAATTGTCAGAAGATGGTACACAAATTGTCACACTGCATCTTGATGGTCG
CATATCTTTTTGGAGTATCCCGTCAATGAGGCTAATCAAAACTTGGAGTA
AATCTGAACAACCTGATGCAAGTGGCGGCTCAAGTGAAGGGTTCTCCTTT
GACTCGCAGAAAAAAGAAGaTCTCACCAAAACAAGGAATTCAATAGATGT
CAGCTGGTGGTCTGAAAAGGAGATTGCTTTGGCATCTGGGAGGGGTGATG
TAACGATTGCTTCGACTGACAGCTTGAAGAATTTACTTGGAGAGTCGAGT
GAGAAATTTGATCCATGGCCGTCACTCAGCCAAGTGGTGGATGGAAGCAT
TCTTGTGCTCGAGTGTGAGAAACGAGTGAACGATCCAAACAACAAAACGA
AGACATCTTGGAAATGGACTTCAGAAGAAGATGAAAGCCAAGATGAAGTG
AACTCGATTCGTTATCGATTCAAAGAACTCACTAAACAGATGTTATATTT
CATCACTGAGGCTGAAAGGTTTTTACCAGCTGTCAAGCCTCCAAGAATTT
TAACCAACGTTTATCGTTTACTATGCTTGAAATCTACAACACCCGAAGAA
TTATACACGCGGAAAATCAATCTTGAACATTACGGAGAGGCCTTGGACCT
AGCTAAACGTTTTGGTTTGAATACTGATTTAGTTTATCAGCGACAGTGGA
AAAAGAAAAGAGTTTCGAAGATTACCATTCATGATTATCtgtcCAAGATT
AAAGATCGATATTGGGTTTTGGACGAGTGCCTTTTACGAGTTGCCGATGA
CTTTGACTCGACAGAAGAGTTACTGAAATACGGTTTACTCGGTACAAGTT
GGGAAATCTTGCAAAGGATTGATGAAGAGGGTAAAGGTGatgcaaaggat
gatgggaAGTTATTACCTTTTAAATTTGACGCCGCCCCACATGACGAGGA
TGACGAAAACTCAAGTAGAGAATTCCAAgggagTCTAACGAAGAAGCAAT
TGAAAATCTGCCAATATCGACGGCAATTATTACATTATCTTGATCGGCTT
TCCACTTATGAGGTTGTTTTGGGAGGCTCATTCAAAGCACGAGATAAATT
CTCAAAAGAGTATTTTACCAAATTTCGATCGTGCAATATGGTACACCAAG
CGGTCGAGTGTGCCCGCGACGAGGACGCTTATACTCTGGAGCATTTGTTT
TCGTACCATGGGAAGCAGTTACTACCTTATTGGCTGCCGATATTATCAAA
CTTCCCGGAAACAACCGATATCCGATATTTTGAGCCGGTCATCCCTGAGA
TTGGAGAGCCACCAGAAGATCCAGAGATTTTACCTTGGTTAGAGAAACAC
CATCGTGAAGAGGATTGGGTCGAGCAATCGAATATTGTCCAACAAATCAA
GTCTAATGAAGAAGGTGACGCAAACGAAGATATAGGCTCATTCATTTTCG
AATCCGATCCAGAGATacgaaaattttacaaatgtGAAACAAAAGCTCAA
CTGAGAGAATGGTTTTTACATCGTGTACACTTGATTGATGAATATTCCGG
TCAGATTGATAAATGTTGCGAGCTGTTAGATGTGGGAATCAAAAGAGGCT
TGGAAGGGCTCACTAAGGTTCACCAAGAAATGGAAGCATGGAGACTCTTA
GTTTACGACGTTGGAATTGACAGTAAAATGACTGCAAAGAGTTTCGTGGA
ATTATCTGAATCATCGAAAATCAAATTGCTAATGTTCAAAACCTCAGATG
TGACATTCGTTAACGATTTCAAGCTATATCTAATGCCGTATTTAAGAAAT
ATTGGAAAGAAGGATTTTAAGAAACGCCAAGATTTACTTCATGAGTTTTT
GGTGGAAATCGCTAAAACTGATTTGACATGCTGCTTGAAGTTATTGGAAA
AGTGTTCGCCAGAGCTGCCAGAACCACTGCTTCCTGATATGGCGGAGATA
ATGAAGATTGGGATTGATTGCGTTTACGCGTGCAAGAGAACGGATCAATT
GAATCATTGTTTCAGCATTGTCGAATGTTTGCCTTCGAGAGAAGAGGGAG
TCATTAGCCGTCCCGTGGAAGAGCTTCACATACAACTGGATCAATTGGAA
CATTTGCTGACAGGAGCGGAAATTTTACAGTATTACAACAACCCTCAGAC
CATCTCTTACATTTCTGAAATTAAAGATGACTCTACTATTTGTAAACAAC
TCATTCAGCAATTGGTGAAAAACGCTGTTTGTAAAGGACGTTGTGTTCCA
AAGGAATTGAACAAATTACTCGGACATTTGATCAAGCTTTCCAAAGAAGT
TTTCCGGTGCTGTGATATCAAGATCGTTCACCAGATTTTCGTTGAAGAAT
TACTACGGTCCGGTTCACGTGAGAACATAACAGTAGCTGAAGAGTTGATC
ACGCCTTCCAAACTTGCCGGGAATTCACCTCAAAGTAAGAAACCAGAACA
ACATTTGACGTCTGCACTCTACCTCCTCAAATATGATGTTTCGGTTACCG
TTGTGTTGGAAGCGAGTCGTGAATATTTCAATGCAGCAATGTCGGGTAAT
GACTCTTCAATGGAACTGGCTAGATTGTGTCTAACATTGGTCAAAGATTG
TCCAGAGAGTGTTCAAGATGAATTGGATTTGATCAACTCGTTGGGTTTAT
TGTATGAATTCAATGTATCCATGCTACCCTTACAAGTTCGCCTTTGCGCT
GATAAATTGGAAATTATCGATCTTTGTTTGAAGGAGAAGAAGAATGGGTA
CAAGAAAAAAGACAAGCTCATCCAATTGAGTAATCTTTTGCAAATCTGTG
GCCATGACAACAAAGAACGGATTGGACAAGTCAATATTAAAATTGCTGAA
TCAGCATTTGAACATAAAGATTACACATACGCTGGTATCGTTTGTGTACA
ATTGGTGGATGATAATTATTCTAATGCTTGGTATATTTGCAGGAAACTTG
GTGAATGTGCTAAATATACCAACTTCACAATCAGGCAAAAGTTGTTGAGT
TTTGCGTTAACTTATTGTCCAGTACATCACATTGAAGAAGTTTTACAAGA
GAAAACTCAACTGGAAACCCAGGTTTTGTACGAGAGGTTGGGTGTATTTA
CGAAAGAAGGCAAGAAAGACAAAATTGTGACCTCATCTAAGAAAGAAACT
GAGGAAGAAAACGACGAAGACAATGTTGATGGGAATAACATATCAATCCT
CAACAAGACCAAAACTACAACAAAGAAATTGATTTCAAGCGTCGCCAGCG
TGGCTGATAACCGCTGGGTTGGATCCGCAATGAATTGGGTCAAACCGTCG
TCGGAAGGGTCTGGTAACGAAGTTGATGTTGTTGAGCGGGAAATTGAAAG
CGTTCGGCATAACCCATTTTATAGTTCGCTGGATTCGAAAAAGATTGACG
AAGATGTTCAAAGATTTAATTATAACGAGTTCAGCGACCATTTGAGGTGC
GTCACAACCGAAGAAAAAGTATTCAATCAGCTGGTGTTAAGAAGTCAAAA
ATTGAACGAGCAAAGAACCCTGGGTAAAGAGCTCGAAAACACTGACCAAG
CAATGCTATCGTTGAGTGATATAGCTTATACTGAAGAAAGTTGTTTGTGT
CTGGCTTACATGATGGCTATTTCTCAGCCAAAAGAAATCCATTCCCTATC
GACCAAGCATCGGAAAAACACTTTCACTTTCCTTTTCACTGCTTATTACT
ATGCATTACAAGAATAtgttaaaaacaacaaaatcgAATTCGATAAACAA
GCACAGATTTACAGCGCGCCTCCGATTGATGTGATTACATGGATGCTAAA
AGTGTTAGGTAAGAAGCAAGgagaaaaggaagaaaaagaaaaaggagagA
CTTACTTTCTGTCTAACATGAACAAGTTGCAAGACTTGATGCAAGCAAAG
ATGCTACAAGCTCTTGACAAAGgaGTGGACATCGAAAGATTTTCAGTTGA
TAATGAATATAAACGTGAAACTATACTCGGATTAGCTATGAGTGTCGAAG
ACGAGTTGATTAACACAAGTTTGCTGCTAGCAGAGAAATATGATATCCCC
GCATGGGAAGTGTTGTTATCACACGTGGAATTTTTATTCACTGATAGTGG
TCTAAAAGCCAAAGCTATCCGCGAATCACTAAACAAATGGAAAGTTGATT
CCCATTTGAAACCGAACGGTGATAAAGTCTTTGAGCGGATGAAGAAATAT
GTTTACCCAGAAATCAATGGTAAAGACCACAATGCATTGCTGTTGTTCTA
CGTTTTCCTAATGAATTGCAGCTCGCCCACTAAAATATTGGAGGGTACGC
TTACATTAGATGCTCATTCcaaacttttgaagaaaatcaaGGCTGCTGCA
TCATCCATCAATTACAAACTTCTCGTGCATGGAGATTCACCTTTGGAGGT
GATTAGAGACTGTGTTGATGATAACAATGTACATTTGTTGGCTAAAATTG
CATCCAAAATCCCCCAGGCGGATGGTAGTTACCTGTCATCAAACAAGATC
TTCTTAGCAAACGCCATTCGGatgttttggaagaaaaaagaGAACAAGGA
TTGGTTGAATACATTCGAAAACTGTAAACAACACTTCACCAAACTCCTGA
TAGAAGACGTTGTCACTTTTGCTGACCATGCAATTTTTGGCGAGGAAGCT
TTAGACTCGCTGACCCAAGACACCAGACTGGAGATTGGTAAAAGAGtaat
aaaatatttgagacaacaACGTGGTCAAGACGAGACCAAACAAAGAGGAG
CTGACGATTATGATTCGCTTATGGAGCGCTACGATTCATCTATCAATGAT
TTGGAACTTTCCATCGAACATCTCAAAACGCTGACTGATCCAATTTTCAA
AGCAGTCTTTGGTGACGATAACGAACTGAGCAAAACCTTTGGACGAGTAT
ACGACTTATCACGTGGTCGAAAACAACCACTCGAAAAACTATTCCGTGAT
TTGTTCATATCGNTACAACCATTAGACAAAATTTCGAAACTGCGGAGTCT
TTGTCGCAATGCATCTATTGACGTCCGCACGTGTTTCCAAGATGCTTTGC
GCGGGATCCTGAGTGACATCCAAAGCGATAGAGATTACACAAAACTACAG
ACTTTAACGGAGAACATCAAAGCGCATCAAGAACATCAAACAGACCCTCT
TGTTACCCATAGCGACGTCTTAGATGTGGTGCGGCCATTTTGTTCTGATG
TTACAGCTAGCACGGATGTGAAGAGTCACGTGTTACATNTTTTGTTCTGA
atggaaGAAAATGAGCAAATATTGTATGATTTGATTGTTCACGAAGAATG
GAAACAAGAACCACAGTTGTTGGACCAAGTTGAAAGTTATTTTTGGCAAT
ATCGTGGTTCACTTCTAAAGAAGCTATGGAAAGTTTCACAAAGTTCTGCA
ATTTATATGTGGGACAACTTGAAGACACAATTCAGATATCAAGCTACCTT
TGGTTGCCCACCATTGAATTTTATCAATCTGATGAACAATTGCTTGCCAT
GGCTTATGGCTTTGTCACCGGATGGAAATTTTATTGCCATCCTTCAAGAT
TCTGTTATTGAAATAAGGACTGCTGGAAATTTTGAGCAAGTCATTACAAA
ATATAAGATTGAAAAAGATATGTTTCCAAGATGGCGTAAATTGATTTGGA
ATCATGACAACACCTTACTTTGTTATTCAAACAGTTTTGGAGATTTGACC
ATTTTGGATATTACCGGCactaaaaaacattttattccaTCATCAAATAA
TGTCAAGTTAAAAGTGCCTGGAACGCTGAGTTTGGCATTGTGTCATGTTG
AATTTGTAGCCAAAGGAAATagCTTCTTGTTATATACCTGCACCTATCAA
GGATTTTTTACAGTTTATGAAGTGAATGAATCCTCCTGCACAATAAAATG
GGACTACTCTTTCATAACATTCCATCCATATGGATTAGCTGGTTTGGTTA
TTGATCATAAAAATGGGTTATTGGTTGCAGCTGGGAATTATGGGAAGGAA
CCATTTCCTAATGTCATGGGAGATGCATGTTATGGATCATATTCTGGTAT
CAGTCTCTGGAGATTTTTGAATGACACACCTCATCTAACTCTGGTTGAAG
ACCAGGGAAAAGCTTTGAAGAAGGTATCCAGAGGTGAATGGTTAAAGAGT
GTTGTTTTAAGACGTGGCGATGAAAAAAACGAAATGTTGAAGCATGGTAT
TTACAAGTTGAAATTGTCAGAAGATGGTACACAAATTGTCACACTGCATC
TTGATGGTCGCATATCTTTTTGGAGTATCCCGTCAATGAGGCTAATCAAA
ACTTGGAGTAAATCTGAACAACCTGATGCAAGTGGCGGCTCAAGTGAAGG
GTTCTCCTTTGACTCGCAGAAAAAAGAAGaTCTCACCAAAACAAGGAATT
CAATAGATGTCAGCTGGTGGTCTGAAAAGGAGATTGCTTTGGCATCTGGG
AGGGGTGATGTAACGATTGCTTCGACTGACAGCTTGAAGAATTTACTTGG
AGAGTCGAGTGAGAAATTTGATCCATGGCCGTCACTCAGCCAAGTGGTGG
ATGGAAGCATTCTTGTGCTCGAGTGTGAGAAACGAGTGAACGATCCAAAC
AACAAAACGAAGACATCTTGGAAATGGACTTCAGAAGAAGATGAAAGCCA
AGATGAAGTGAACTCGATTCGTTATCGATTCAAAGAACTCACTAAACAGA
TGTTATATTTCATCACTGAGGCTGAAAGGTTTTTACCAGCTGTCAAGCCT
CCAAGAATTTTAACCAACGTTTATCGTTTACTATGCTTGAAATCTACAAC
ACCCGAAGAATTATACACGCGGAAAATCAATCTTGAACATTACGGAGAGG
CCTTGGACCTAGCTAAACGTTTTGGTTTGAATACTGATTTAGTTTATCAG
CGACAGTGGAAAAAGAAAAGAGTTTCGAAGATTACCATTCATGATTATCt
gtcCAAGATTAAAGATCGATATTGGGTTTTGGACGAGTGCCTTTTACGAG
TTGCCGATGACTTTGACTCGACAGAAGAGTTACTGAAATACGGTTTACTC
GGTACAAGTTGGGAAATCTTGCAAAGGATTGATGAAGAGGGTAAAGGTGa
tgcaaaggatgatgggaAGTTATTACCTTTTAAATTTGACGCCGCCCCAC
ATGACGAGGATGACGAAAACTCAAGTAGAGAATTCCAAgggagTCTAACG
AAGAAGCAATTGAAAATCTGCCAATATCGACGGCAATTATTACATTATCT
TGATCGGCTTTCCACTTATGAGGTTGTTTTGGGAGGCTCATTCAAAGCAC
GAGATAAATTCTCAAAAGAGTATTTTACCAAATTTCGATCGTGCAATATG
GTACACCAAGCGGTCGAGTGTGCCCGCGACGAGGACGCTTATACTCTGGA
GCATTTGTTTTCGTACCATGGGAAGCAGTTACTACCTTATTGGCTGCCGA
TATTATCAAACTTCCCGGAAACAACCGATATCCGATATTTTGAGCCGGTC
ATCCCTGAGATTGGAGAGCCACCAGAAGATCCAGAGATTTTACCTTGGTT
AGAGAAACACCATCGTGAAGAGGATTGGGTCGAGCAATCGAATATTGTCC
AACAAATCAAGTCTAATGAAGAAGGTGACGCAAACGAAGATATAGGCTCA
TTCATTTTCGAATCCGATCCAGAGATacgaaaattttacaaatgtGAAAC
AAAAGCTCAACTGAGAGAATGGTTTTTACATCGTGTACACTTGATTGATG
AATATTCCGGTCAGATTGATAAATGTTGCGAGCTGTTAGATGTGGGAATC
AAAAGAGGCTTGGAAGGGCTCACTAAGGTTCACCAAGAAATGGAAGCATG
GAGACTCTTAGTTTACGACGTTGGAATTGACAGTAAAATGACTGCAAAGA
GTTTCGTGGAATTATCTGAATCATCGAAAATCAAATTGCTAATGTTCAAA
ACCTCAGATGTGACATTCGTTAACGATTTCAAGCTATATCTAATGCCGTA
TTTAAGAAATATTGGAAAGAAGGATTTTAAGAAACGCCAAGATTTACTTC
ATGAGTTTTTGGTGGAAATCGCTAAAACTGATTTGACATGCTGCTTGAAG
TTATTGGAAAAGTGTTCGCCAGAGCTGCCAGAACCACTGCTTCCTGATAT
GGCGGAGATAATGAAGATTGGGATTGATTGCGTTTACGCGTGCAAGAGAA
CGGATCAATTGAATCATTGTTTCAGCATTGTCGAATGTTTGCCTTCGAGA
GAAGAGGGAGTCATTAGCCGTCCCGTGGAAGAGCTTCACATACAACTGGA
TCAATTGGAACATTTGCTGACAGGAGCGGAAATTTTACAGTATTACAACA
ACCCTCAGACCATCTCTTACATTTCTGAAATTAAAGATGACTCTACTATT
TGTAAACAACTCATTCAGCAATTGGTGAAAAACGCTGTTTGTAAAGGACG
TTGTGTTCCAAAGGAATTGAACAAATTACTCGGACATTTGATCAAGCTTT
CCAAAGAAGTTTTCCGGTGCTGTGATATCAAGATCGTTCACCAGATTTTC
GTTGAAGAATTACTACGGTCCGGTTCACGTGAGAACATAACAGTAGCTGA
AGAGTTGATCACGCCTTCCAAACTTGCCGGGAATTCACCTCAAAGTAAGA
AACCAGAACAACATTTGACGTCTGCACTCTACCTCCTCAAATATGATGTT
TCGGTTACCGTTGTGTTGGAAGCGAGTCGTGAATATTTCAATGCAGCAAT
GTCGGGTAATGACTCTTCAATGGAACTGGCTAGATTGTGTCTAACATTGG
TCAAAGATTGTCCAGAGAGTGTTCAAGATGAATTGGATTTGATCAACTCG
TTGGGTTTATTGTATGAATTCAATGTATCCATGCTACCCTTACAAGTTCG
CCTTTGCGCTGATAAATTGGAAATTATCGATCTTTGTTTGAAGGAGAAGA
AGAATGGGTACAAGAAAAAAGACAAGCTCATCCAATTGAGTAATCTTTTG
CAAATCTGTGGCCATGACAACAAAGAACGGATTGGACAAGTCAATATTAA
AATTGCTGAATCAGCATTTGAACATAAAGATTACACATACGCTGGTATCG
TTTGTGTACAATTGGTGGATGATAATTATTCTAATGCTTGGTATATTTGC
AGGAAACTTGGTGAATGTGCTAAATATACCAACTTCACAATCAGGCAAAA
GTTGTTGAGTTTTGCGTTAACTTATTGTCCAGTACATCACATTGAAGAAG
TTTTACAAGAGAAAACTCAACTGGAAACCCAGGTTTTGTACGAGAGGTTG
GGTGTATTTACGAAAGAAGGCAAGAAAGACAAAATTGTGACCTCATCTAA
GAAAGAAACTGAGGAAGAAAACGACGAAGACAATGTTGATGGGAATAACA
TATCAATCCTCAACAAGACCAAAACTACAACAAAGAAATTGATTTCAAGC
GTCGCCAGCGTGGCTGATAACCGCTGGGTTGGATCCGCAATGAATTGGGT
CAAACCGTCGTCGGAAGGGTCTGGTAACGAAGTTGATGTTGTTGAGCGGG
AAATTGAAAGCGTTCGGCATAACCCATTTTATAGTTCGCTGGATTCGAAA
AAGATTGACGAAGATGTTCAAAGATTTAATTATAACGAGTTCAGCGACCA
TTTGAGGTGCGTCACAACCGAAGAAAAAGTATTCAATCAGCTGGTGTTAA
GAAGTCAAAAATTGAACGAGCAAAGAACCCTGGGTAAAGAGCTCGAAAAC
ACTGACCAAGCAATGCTATCGTTGAGTGATATAGCTTATACTGAAGAAAG
TTGTTTGTGTCTGGCTTACATGATGGCTATTTCTCAGCCAAAAGAAATCC
ATTCCCTATCGACCAAGCATCGGAAAAACACTTTCACTTTCCTTTTCACT
GCTTATTACTATGCATTACAAGAATAtgttaaaaacaacaaaatcgAATT
CGATAAACAAGCACAGATTTACAGCGCGCCTCCGATTGATGTGATTACAT
GGATGCTAAAAGTGTTAGGTAAGAAGCAAGgagaaaaggaagaaaaagaa
aaaggagagACTTACTTTCTGTCTAACATGAACAAGTTGCAAGACTTGAT
GCAAGCAAAGATGCTACAAGCTCTTGACAAAGgaGTGGACATCGAAAGAT
TTTCAGTTGATAATGAATATAAACGTGAAACTATACTCGGATTAGCTATG
AGTGTCGAAGACGAGTTGATTAACACAAGTTTGCTGCTAGCAGAGAAATA
TGATATCCCCGCATGGGAAGTGTTGTTATCACACGTGGAATTTTTATTCA
CTGATAGTGGTCTAAAAGCCAAAGCTATCCGCGAATCACTAAACAAATGG
AAAGTTGATTCCCATTTGAAACCGAACGGTGATAAAGTCTTTGAGCGGAT
GAAGAAATATGTTTACCCAGAAATCAATGGTAAAGACCACAATGCATTGC
TGTTGTTCTACGTTTTCCTAATGAATTGCAGCTCGCCCACTAAAATATTG
GAGGGTACGCTTACATTAGATGCTCATTCcaaacttttgaagaaaatcaa
GGCTGCTGCATCATCCATCAATTACAAACTTCTCGTGCATGGAGATTCAC
CTTTGGAGGTGATTAGAGACTGTGTTGATGATAACAATGTACATTTGTTG
GCTAAAATTGCATCCAAAATCCCCCAGGCGGATGGTAGTTACCTGTCATC
AAACAAGATCTTCTTAGCAAACGCCATTCGGatgttttggaagaaaaaag
aGAACAAGGATTGGTTGAATACATTCGAAAACTGTAAACAACACTTCACC
AAACTCCTGATAGAAGACGTTGTCACTTTTGCTGACCATGCAATTTTTGG
CGAGGAAGCTTTAGACTCGCTGACCCAAGACACCAGACTGGAGATTGGTA
AAAGAGtaataaaatatttgagacaacaACGTGGTCAAGACGAGACCAAA
CAAAGAGGAGCTGACGATTATGATTCGCTTATGGAGCGCTACGATTCATC
TATCAATGATTTGGAACTTTCCATCGAACATCTCAAAACGCTGACTGATC
CAATTTTCAAAGCAGTCTTTGGTGACGATAACGAACTGAGCAAAACCTTT
GGACGAGTATACGACTTATCACGTGGTCGAAAACAACCACTCGAAAAACT
ATTCCGTGATTTGTTCATATCGNTACAACCATTAGACAAAATTTCGAAAC
TGCGGAGTCTTTGTCGCAATGCATCTATTGACGTCCGCACGTGTTTCCAA
GATGCTTTGCGCGGGATCCTGAGTGACATCCAAAGCGATAGAGATTACAC
AAAACTACAGACTTTAACGGAGAACATCAAAGCGCATCAAGAACATCAAA
CAGACCCTCTTGTTACCCATAGCGACGTCTTAGATGTGGTGCGGCCATTT
TGTTCTGATGTTACAGCTAGCACGGATGTGAAGAGTCACGTGTTACATNT
TTTGTTCTGAatggaaGAAAATGAGCAAATATTGTATGATTTGATTGTTC
ACGAAGAATGGAAACAAGAACCACAGTTGTTGGACCAAGTTGAAAGTTAT
TTTTGGCAATATCGTGGTTCACTTCTAAAGAAGCTATGGAAAGTTTCACA
AAGTTCTGCAATTTATATGTGGGACAACTTGAAGACACAATTCAGATATC
AAGCTACCTTTGGTTGCCCACCATTGAATTTTATCAATCTGATGAACAAT
TGCTTGCCATGGCTTATGGCTTTGTCACCGGATGGAAATTTTATTGCCAT
CCTTCAAGATTCTGTTATTGAAATAAGGACTGCTGGAAATTTTGAGCAAG
TCATTACAAAATATAAGATTGAAAAAGATATGTTTCCAAGATGGCGTAAA
TTGATTTGGAATCATGACAACACCTTACTTTGTTATTCAAACAGTTTTGG
AGATTTGACCATTTTGGATATTACCGGCactaaaaaacattttattccaT
CATCAAATAATGTCAAGTTAAAAGTGCCTGGAACGCTGAGTTTGGCATTG
TGTCATGTTGAATTTGTAGCCAAAGGAAATagCTTCTTGTTATATACCTG
CACCTATCAAGGATTTTTTACAGTTTATGAAGTGAATGAATCCTCCTGCA
CAATAAAATGGGACTACTCTTTCATAACATTCCATCCATATGGATTAGCT
GGTTTGGTTATTGATCATAAAAATGGGTTATTGGTTGCAGCTGGGAATTA
TGGGAAGGAACCATTTCCTAATGTCATGGGAGATGCATGTTATGGATCAT
ATTCTGGTATCAGTCTCTGGAGATTTTTGAATGACACACCTCATCTAACT
CTGGTTGAAGACCAGGGAAAAGCTTTGAAGAAGGTATCCAGAGGTGAATG
GTTAAAGAGTGTTGTTTTAAGACGTGGCGATGAAAAAAACGAAATGTTGA
AGCATGGTATTTACAAGTTGAAATTGTCAGAAGATGGTACACAAATTGTC
ACACTGCATCTTGATGGTCGCATATCTTTTTGGAGTATCCCGTCAATGAG
GCTAATCAAAACTTGGAGTAAATCTGAACAACCTGATGCAAGTGGCGGCT
CAAGTGAAGGGTTCTCCTTTGACTCGCAGAAAAAAGAAGaTCTCACCAAA
ACAAGGAATTCAATAGATGTCAGCTGGTGGTCTGAAAAGGAGATTGCTTT
GGCATCTGGGAGGGGTGATGTAACGATTGCTTCGACTGACAGCTTGAAGA
ATTTACTTGGAGAGTCGAGTGAGAAATTTGATCCATGGCCGTCACTCAGC
CAAGTGGTGGATGGAAGCATTCTTGTGCTCGAGTGTGAGAAACGAGTGAA
CGATCCAAACAACAAAACGAAGACATCTTGGAAATGGACTTCAGAAGAAG
ATGAAAGCCAAGATGAAGTGAACTCGATTCGTTATCGATTCAAAGAACTC
ACTAAACAGATGTTATATTTCATCACTGAGGCTGAAAGGTTTTTACCAGC
TGTCAAGCCTCCAAGAATTTTAACCAACGTTTATCGTTTACTATGCTTGA
AATCTACAACACCCGAAGAATTATACACGCGGAAAATCAATCTTGAACAT
TACGGAGAGGCCTTGGACCTAGCTAAACGTTTTGGTTTGAATACTGATTT
AGTTTATCAGCGACAGTGGAAAAAGAAAAGAGTTTCGAAGATTACCATTC
ATGATTATCtgtcCAAGATTAAAGATCGATATTGGGTTTTGGACGAGTGC
CTTTTACGAGTTGCCGATGACTTTGACTCGACAGAAGAGTTACTGAAATA
CGGTTTACTCGGTACAAGTTGGGAAATCTTGCAAAGGATTGATGAAGAGG
GTAAAGGTGatgcaaaggatgatgggaAGTTATTACCTTTTAAATTTGAC
GCCGCCCCACATGACGAGGATGACGAAAACTCAAGTAGAGAATTCCAAgg
gagTCTAACGAAGAAGCAATTGAAAATCTGCCAATATCGACGGCAATTAT
TACATTATCTTGATCGGCTTTCCACTTATGAGGTTGTTTTGGGAGGCTCA
TTCAAAGCACGAGATAAATTCTCAAAAGAGTATTTTACCAAATTTCGATC
GTGCAATATGGTACACCAAGCGGTCGAGTGTGCCCGCGACGAGGACGCTT
ATACTCTGGAGCATTTGTTTTCGTACCATGGGAAGCAGTTACTACCTTAT
TGGCTGCCGATATTATCAAACTTCCCGGAAACAACCGATATCCGATATTT
TGAGCCGGTCATCCCTGAGATTGGAGAGCCACCAGAAGATCCAGAGATTT
TACCTTGGTTAGAGAAACACCATCGTGAAGAGGATTGGGTCGAGCAATCG
AATATTGTCCAACAAATCAAGTCTAATGAAGAAGGTGACGCAAACGAAGA
TATAGGCTCATTCATTTTCGAATCCGATCCAGAGATacgaaaattttaca
aatgtGAAACAAAAGCTCAACTGAGAGAATGGTTTTTACATCGTGTACAC
TTGATTGATGAATATTCCGGTCAGATTGATAAATGTTGCGAGCTGTTAGA
TGTGGGAATCAAAAGAGGCTTGGAAGGGCTCACTAAGGTTCACCAAGAAA
TGGAAGCATGGAGACTCTTAGTTTACGACGTTGGAATTGACAGTAAAATG
ACTGCAAAGAGTTTCGTGGAATTATCTGAATCATCGAAAATCAAATTGCT
AATGTTCAAAACCTCAGATGTGACATTCGTTAACGATTTCAAGCTATATC
TAATGCCGTATTTAAGAAATATTGGAAAGAAGGATTTTAAGAAACGCCAA
GATTTACTTCATGAGTTTTTGGTGGAAATCGCTAAAACTGATTTGACATG
CTGCTTGAAGTTATTGGAAAAGTGTTCGCCAGAGCTGCCAGAACCACTGC
TTCCTGATATGGCGGAGATAATGAAGATTGGGATTGATTGCGTTTACGCG
TGCAAGAGAACGGATCAATTGAATCATTGTTTCAGCATTGTCGAATGTTT
GCCTTCGAGAGAAGAGGGAGTCATTAGCCGTCCCGTGGAAGAGCTTCACA
TACAACTGGATCAATTGGAACATTTGCTGACAGGAGCGGAAATTTTACAG
TATTACAACAACCCTCAGACCATCTCTTACATTTCTGAAATTAAAGATGA
CTCTACTATTTGTAAACAACTCATTCAGCAATTGGTGAAAAACGCTGTTT
GTAAAGGACGTTGTGTTCCAAAGGAATTGAACAAATTACTCGGACATTTG
ATCAAGCTTTCCAAAGAAGTTTTCCGGTGCTGTGATATCAAGATCGTTCA
CCAGATTTTCGTTGAAGAATTACTACGGTCCGGTTCACGTGAGAACATAA
CAGTAGCTGAAGAGTTGATCACGCCTTCCAAACTTGCCGGGAATTCACCT
CAAAGTAAGAAACCAGAACAACATTTGACGTCTGCACTCTACCTCCTCAA
ATATGATGTTTCGGTTACCGTTGTGTTGGAAGCGAGTCGTGAATATTTCA
ATGCAGCAATGTCGGGTAATGACTCTTCAATGGAACTGGCTAGATTGTGT
CTAACATTGGTCAAAGATTGTCCAGAGAGTGTTCAAGATGAATTGGATTT
GATCAACTCGTTGGGTTTATTGTATGAATTCAATGTATCCATGCTACCCT
TACAAGTTCGCCTTTGCGCTGATAAATTGGAAATTATCGATCTTTGTTTG
AAGGAGAAGAAGAATGGGTACAAGAAAAAAGACAAGCTCATCCAATTGAG
TAATCTTTTGCAAATCTGTGGCCATGACAACAAAGAACGGATTGGACAAG
TCAATATTAAAATTGCTGAATCAGCATTTGAACATAAAGATTACACATAC
GCTGGTATCGTTTGTGTACAATTGGTGGATGATAATTATTCTAATGCTTG
GTATATTTGCAGGAAACTTGGTGAATGTGCTAAATATACCAACTTCACAA
TCAGGCAAAAGTTGTTGAGTTTTGCGTTAACTTATTGTCCAGTACATCAC
ATTGAAGAAGTTTTACAAGAGAAAACTCAACTGGAAACCCAGGTTTTGTA
CGAGAGGTTGGGTGTATTTACGAAAGAAGGCAAGAAAGACAAAATTGTGA
CCTCATCTAAGAAAGAAACTGAGGAAGAAAACGACGAAGACAATGTTGAT
GGGAATAACATATCAATCCTCAACAAGACCAAAACTACAACAAAGAAATT
GATTTCAAGCGTCGCCAGCGTGGCTGATAACCGCTGGGTTGGATCCGCAA
TGAATTGGGTCAAACCGTCGTCGGAAGGGTCTGGTAACGAAGTTGATGTT
GTTGAGCGGGAAATTGAAAGCGTTCGGCATAACCCATTTTATAGTTCGCT
GGATTCGAAAAAGATTGACGAAGATGTTCAAAGATTTAATTATAACGAGT
TCAGCGACCATTTGAGGTGCGTCACAACCGAAGAAAAAGTATTCAATCAG
CTGGTGTTAAGAAGTCAAAAATTGAACGAGCAAAGAACCCTGGGTAAAGA
GCTCGAAAACACTGACCAAGCAATGCTATCGTTGAGTGATATAGCTTATA
CTGAAGAAAGTTGTTTGTGTCTGGCTTACATGATGGCTATTTCTCAGCCA
AAAGAAATCCATTCCCTATCGACCAAGCATCGGAAAAACACTTTCACTTT
CCTTTTCACTGCTTATTACTATGCATTACAAGAATAtgttaaaaacaaca
aaatcgAATTCGATAAACAAGCACAGATTTACAGCGCGCCTCCGATTGAT
GTGATTACATGGATGCTAAAAGTGTTAGGTAAGAAGCAAGgagaaaagga
agaaaaagaaaaaggagagACTTACTTTCTGTCTAACATGAACAAGTTGC
AAGACTTGATGCAAGCAAAGATGCTACAAGCTCTTGACAAAGgaGTGGAC
ATCGAAAGATTTTCAGTTGATAATGAATATAAACGTGAAACTATACTCGG
ATTAGCTATGAGTGTCGAAGACGAGTTGATTAACACAAGTTTGCTGCTAG
CAGAGAAATATGATATCCCCGCATGGGAAGTGTTGTTATCACACGTGGAA
TTTTTATTCACTGATAGTGGTCTAAAAGCCAAAGCTATCCGCGAATCACT
AAACAAATGGAAAGTTGATTCCCATTTGAAACCGAACGGTGATAAAGTCT
TTGAGCGGATGAAGAAATATGTTTACCCAGAAATCAATGGTAAAGACCAC
AATGCATTGCTGTTGTTCTACGTTTTCCTAATGAATTGCAGCTCGCCCAC
TAAAATATTGGAGGGTACGCTTACATTAGATGCTCATTCcaaacttttga
agaaaatcaaGGCTGCTGCATCATCCATCAATTACAAACTTCTCGTGCAT
GGAGATTCACCTTTGGAGGTGATTAGAGACTGTGTTGATGATAACAATGT
ACATTTGTTGGCTAAAATTGCATCCAAAATCCCCCAGGCGGATGGTAGTT
ACCTGTCATCAAACAAGATCTTCTTAGCAAACGCCATTCGGatgttttgg
aagaaaaaagaGAACAAGGATTGGTTGAATACATTCGAAAACTGTAAACA
ACACTTCACCAAACTCCTGATAGAAGACGTTGTCACTTTTGCTGACCATG
CAATTTTTGGCGAGGAAGCTTTAGACTCGCTGACCCAAGACACCAGACTG
GAGATTGGTAAAAGAGtaataaaatatttgagacaacaACGTGGTCAAGA
CGAGACCAAACAAAGAGGAGCTGACGATTATGATTCGCTTATGGAGCGCT
ACGATTCATCTATCAATGATTTGGAACTTTCCATCGAACATCTCAAAACG
CTGACTGATCCAATTTTCAAAGCAGTCTTTGGTGACGATAACGAACTGAG
CAAAACCTTTGGACGAGTATACGACTTATCACGTGGTCGAAAACAACCAC
TCGAAAAACTATTCCGTGATTTGTTCATATCGNTACAACCATTAGACAAA
ATTTCGAAACTGCGGAGTCTTTGTCGCAATGCATCTATTGACGTCCGCAC
GTGTTTCCAAGATGCTTTGCGCGGGATCCTGAGTGACATCCAAAGCGATA
GAGATTACACAAAACTACAGACTTTAACGGAGAACATCAAAGCGCATCAA
GAACATCAAACAGACCCTCTTGTTACCCATAGCGACGTCTTAGATGTGGT
GCGGCCATTTTGTTCTGATGTTACAGCTAGCACGGATGTGAAGAGTCACG
TGTTACATNTTTTGTTCTGAatggaaGAAAATGAGCAAATATTGTATGAT
TTGATTGTTCACGAAGAATGGAAACAAGAACCACAGTTGTTGGACCAAGT
TGAAAGTTATTTTTGGCAATATCGTGGTTCACTTCTAAAGAAGCTATGGA
AAGTTTCACAAAGTTCTGCAATTTATATGTGGGACAACTTGAAGACACAA
TTCAGATATCAAGCTACCTTTGGTTGCCCACCATTGAATTTTATCAATCT
GATGAACAATTGCTTGCCATGGCTTATGGCTTTGTCACCGGATGGAAATT
TTATTGCCATCCTTCAAGATTCTGTTATTGAAATAAGGACTGCTGGAAAT
TTTGAGCAAGTCATTACAAAATATAAGATTGAAAAAGATATGTTTCCAAG
ATGGCGTAAATTGATTTGGAATCATGACAACACCTTACTTTGTTATTCAA
ACAGTTTTGGAGATTTGACCATTTTGGATATTACCGGCactaaaaaacat
tttattccaTCATCAAATAATGTCAAGTTAAAAGTGCCTGGAACGCTGAG
TTTGGCATTGTGTCATGTTGAATTTGTAGCCAAAGGAAATagCTTCTTGT
TATATACCTGCACCTATCAAGGATTTTTTACAGTTTATGAAGTGAATGAA
TCCTCCTGCACAATAAAATGGGACTACTCTTTCATAACATTCCATCCATA
TGGATTAGCTGGTTTGGTTATTGATCATAAAAATGGGTTATTGGTTGCAG
CTGGGAATTATGGGAAGGAACCATTTCCTAATGTCATGGGAGATGCATGT
TATGGATCATATTCTGGTATCAGTCTCTGGAGATTTTTGAATGACACACC
TCATCTAACTCTGGTTGAAGACCAGGGAAAAGCTTTGAAGAAGGTATCCA
GAGGTGAATGGTTAAAGAGTGTTGTTTTAAGACGTGGCGATGAAAAAAAC
GAAATGTTGAAGCATGGTATTTACAAGTTGAAATTGTCAGAAGATGGTAC
ACAAATTGTCACACTGCATCTTGATGGTCGCATATCTTTTTGGAGTATCC
CGTCAATGAGGCTAATCAAAACTTGGAGTAAATCTGAACAACCTGATGCA
AGTGGCGGCTCAAGTGAAGGGTTCTCCTTTGACTCGCAGAAAAAAGAAGa
TCTCACCAAAACAAGGAATTCAATAGATGTCAGCTGGTGGTCTGAAAAGG
AGATTGCTTTGGCATCTGGGAGGGGTGATGTAACGATTGCTTCGACTGAC
AGCTTGAAGAATTTACTTGGAGAGTCGAGTGAGAAATTTGATCCATGGCC
GTCACTCAGCCAAGTGGTGGATGGAAGCATTCTTGTGCTCGAGTGTGAGA
AACGAGTGAACGATCCAAACAACAAAACGAAGACATCTTGGAAATGGACT
TCAGAAGAAGATGAAAGCCAAGATGAAGTGAACTCGATTCGTTATCGATT
CAAAGAACTCACTAAACAGATGTTATATTTCATCACTGAGGCTGAAAGGT
TTTTACCAGCTGTCAAGCCTCCAAGAATTTTAACCAACGTTTATCGTTTA
CTATGCTTGAAATCTACAACACCCGAAGAATTATACACGCGGAAAATCAA
TCTTGAACATTACGGAGAGGCCTTGGACCTAGCTAAACGTTTTGGTTTGA
ATACTGATTTAGTTTATCAGCGACAGTGGAAAAAGAAAAGAGTTTCGAAG
ATTACCATTCATGATTATCtgtcCAAGATTAAAGATCGATATTGGGTTTT
GGACGAGTGCCTTTTACGAGTTGCCGATGACTTTGACTCGACAGAAGAGT
TACTGAAATACGGTTTACTCGGTACAAGTTGGGAAATCTTGCAAAGGATT
GATGAAGAGGGTAAAGGTGatgcaaaggatgatgggaAGTTATTACCTTT
TAAATTTGACGCCGCCCCACATGACGAGGATGACGAAAACTCAAGTAGAG
AATTCCAAgggagTCTAACGAAGAAGCAATTGAAAATCTGCCAATATCGA
CGGCAATTATTACATTATCTTGATCGGCTTTCCACTTATGAGGTTGTTTT
GGGAGGCTCATTCAAAGCACGAGATAAATTCTCAAAAGAGTATTTTACCA
AATTTCGATCGTGCAATATGGTACACCAAGCGGTCGAGTGTGCCCGCGAC
GAGGACGCTTATACTCTGGAGCATTTGTTTTCGTACCATGGGAAGCAGTT
ACTACCTTATTGGCTGCCGATATTATCAAACTTCCCGGAAACAACCGATA
TCCGATATTTTGAGCCGGTCATCCCTGAGATTGGAGAGCCACCAGAAGAT
CCAGAGATTTTACCTTGGTTAGAGAAACACCATCGTGAAGAGGATTGGGT
CGAGCAATCGAATATTGTCCAACAAATCAAGTCTAATGAAGAAGGTGACG
CAAACGAAGATATAGGCTCATTCATTTTCGAATCCGATCCAGAGATacga
aaattttacaaatgtGAAACAAAAGCTCAACTGAGAGAATGGTTTTTACA
TCGTGTACACTTGATTGATGAATATTCCGGTCAGATTGATAAATGTTGCG
AGCTGTTAGATGTGGGAATCAAAAGAGGCTTGGAAGGGCTCACTAAGGTT
CACCAAGAAATGGAAGCATGGAGACTCTTAGTTTACGACGTTGGAATTGA
CAGTAAAATGACTGCAAAGAGTTTCGTGGAATTATCTGAATCATCGAAAA
TCAAATTGCTAATGTTCAAAACCTCAGATGTGACATTCGTTAACGATTTC
AAGCTATATCTAATGCCGTATTTAAGAAATATTGGAAAGAAGGATTTTAA
GAAACGCCAAGATTTACTTCATGAGTTTTTGGTGGAAATCGCTAAAACTG
ATTTGACATGCTGCTTGAAGTTATTGGAAAAGTGTTCGCCAGAGCTGCCA
GAACCACTGCTTCCTGATATGGCGGAGATAATGAAGATTGGGATTGATTG
CGTTTACGCGTGCAAGAGAACGGATCAATTGAATCATTGTTTCAGCATTG
TCGAATGTTTGCCTTCGAGAGAAGAGGGAGTCATTAGCCGTCCCGTGGAA
GAGCTTCACATACAACTGGATCAATTGGAACATTTGCTGACAGGAGCGGA
AATTTTACAGTATTACAACAACCCTCAGACCATCTCTTACATTTCTGAAA
TTAAAGATGACTCTACTATTTGTAAACAACTCATTCAGCAATTGGTGAAA
AACGCTGTTTGTAAAGGACGTTGTGTTCCAAAGGAATTGAACAAATTACT
CGGACATTTGATCAAGCTTTCCAAAGAAGTTTTCCGGTGCTGTGATATCA
AGATCGTTCACCAGATTTTCGTTGAAGAATTACTACGGTCCGGTTCACGT
GAGAACATAACAGTAGCTGAAGAGTTGATCACGCCTTCCAAACTTGCCGG
GAATTCACCTCAAAGTAAGAAACCAGAACAACATTTGACGTCTGCACTCT
ACCTCCTCAAATATGATGTTTCGGTTACCGTTGTGTTGGAAGCGAGTCGT
GAATATTTCAATGCAGCAATGTCGGGTAATGACTCTTCAATGGAACTGGC
TAGATTGTGTCTAACATTGGTCAAAGATTGTCCAGAGAGTGTTCAAGATG
AATTGGATTTGATCAACTCGTTGGGTTTATTGTATGAATTCAATGTATCC
ATGCTACCCTTACAAGTTCGCCTTTGCGCTGATAAATTGGAAATTATCGA
TCTTTGTTTGAAGGAGAAGAAGAATGGGTACAAGAAAAAAGACAAGCTCA
TCCAATTGAGTAATCTTTTGCAAATCTGTGGCCATGACAACAAAGAACGG
ATTGGACAAGTCAATATTAAAATTGCTGAATCAGCATTTGAACATAAAGA
TTACACATACGCTGGTATCGTTTGTGTACAATTGGTGGATGATAATTATT
CTAATGCTTGGTATATTTGCAGGAAACTTGGTGAATGTGCTAAATATACC
AACTTCACAATCAGGCAAAAGTTGTTGAGTTTTGCGTTAACTTATTGTCC
AGTACATCACATTGAAGAAGTTTTACAAGAGAAAACTCAACTGGAAACCC
AGGTTTTGTACGAGAGGTTGGGTGTATTTACGAAAGAAGGCAAGAAAGAC
AAAATTGTGACCTCATCTAAGAAAGAAACTGAGGAAGAAAACGACGAAGA
CAATGTTGATGGGAATAACATATCAATCCTCAACAAGACCAAAACTACAA
CAAAGAAATTGATTTCAAGCGTCGCCAGCGTGGCTGATAACCGCTGGGTT
GGATCCGCAATGAATTGGGTCAAACCGTCGTCGGAAGGGTCTGGTAACGA
AGTTGATGTTGTTGAGCGGGAAATTGAAAGCGTTCGGCATAACCCATTTT
ATAGTTCGCTGGATTCGAAAAAGATTGACGAAGATGTTCAAAGATTTAAT
TATAACGAGTTCAGCGACCATTTGAGGTGCGTCACAACCGAAGAAAAAGT
ATTCAATCAGCTGGTGTTAAGAAGTCAAAAATTGAACGAGCAAAGAACCC
TGGGTAAAGAGCTCGAAAACACTGACCAAGCAATGCTATCGTTGAGTGAT
ATAGCTTATACTGAAGAAAGTTGTTTGTGTCTGGCTTACATGATGGCTAT
TTCTCAGCCAAAAGAAATCCATTCCCTATCGACCAAGCATCGGAAAAACA
CTTTCACTTTCCTTTTCACTGCTTATTACTATGCATTACAAGAATAtgtt
aaaaacaacaaaatcgAATTCGATAAACAAGCACAGATTTACAGCGCGCC
TCCGATTGATGTGATTACATGGATGCTAAAAGTGTTAGGTAAGAAGCAAG
gagaaaaggaagaaaaagaaaaaggagagACTTACTTTCTGTCTAACATG
AACAAGTTGCAAGACTTGATGCAAGCAAAGATGCTACAAGCTCTTGACAA
AGgaGTGGACATCGAAAGATTTTCAGTTGATAATGAATATAAACGTGAAA
CTATACTCGGATTAGCTATGAGTGTCGAAGACGAGTTGATTAACACAAGT
TTGCTGCTAGCAGAGAAATATGATATCCCCGCATGGGAAGTGTTGTTATC
ACACGTGGAATTTTTATTCACTGATAGTGGTCTAAAAGCCAAAGCTATCC
GCGAATCACTAAACAAATGGAAAGTTGATTCCCATTTGAAACCGAACGGT
GATAAAGTCTTTGAGCGGATGAAGAAATATGTTTACCCAGAAATCAATGG
TAAAGACCACAATGCATTGCTGTTGTTCTACGTTTTCCTAATGAATTGCA
GCTCGCCCACTAAAATATTGGAGGGTACGCTTACATTAGATGCTCATTCc
aaacttttgaagaaaatcaaGGCTGCTGCATCATCCATCAATTACAAACT
TCTCGTGCATGGAGATTCACCTTTGGAGGTGATTAGAGACTGTGTTGATG
ATAACAATGTACATTTGTTGGCTAAAATTGCATCCAAAATCCCCCAGGCG
GATGGTAGTTACCTGTCATCAAACAAGATCTTCTTAGCAAACGCCATTCG
GatgttttggaagaaaaaagaGAACAAGGATTGGTTGAATACATTCGAAA
ACTGTAAACAACACTTCACCAAACTCCTGATAGAAGACGTTGTCACTTTT
GCTGACCATGCAATTTTTGGCGAGGAAGCTTTAGACTCGCTGACCCAAGA
CACCAGACTGGAGATTGGTAAAAGAGtaataaaatatttgagacaacaAC
GTGGTCAAGACGAGACCAAACAAAGAGGAGCTGACGATTATGATTCGCTT
ATGGAGCGCTACGATTCATCTATCAATGATTTGGAACTTTCCATCGAACA
TCTCAAAACGCTGACTGATCCAATTTTCAAAGCAGTCTTTGGTGACGATA
ACGAACTGAGCAAAACCTTTGGACGAGTATACGACTTATCACGTGGTCGA
AAACAACCACTCGAAAAACTATTCCGTGATTTGTTCATATCGNTACAACC
ATTAGACAAAATTTCGAAACTGCGGAGTCTTTGTCGCAATGCATCTATTG
ACGTCCGCACGTGTTTCCAAGATGCTTTGCGCGGGATCCTGAGTGACATC
CAAAGCGATAGAGATTACACAAAACTACAGACTTTAACGGAGAACATCAA
AGCGCATCAAGAACATCAAACAGACCCTCTTGTTACCCATAGCGACGTCT
TAGATGTGGTGCGGCCATTTTGTTCTGATGTTACAGCTAGCACGGATGTG
AAGAGTCACGTGTTACATNTTTTGTTCTGAatggaaGAAAATGAGCAAAT
ATTGTATGATTTGATTGTTCACGAAGAATGGAAACAAGAACCACAGTTGT
TGGACCAAGTTGAAAGTTATTTTTGGCAATATCGTGGTTCACTTCTAAAG
AAGCTATGGAAAGTTTCACAAAGTTCTGCAATTTATATGTGGGACAACTT
GAAGACACAATTCAGATATCAAGCTACCTTTGGTTGCCCACCATTGAATT
TTATCAATCTGATGAACAATTGCTTGCCATGGCTTATGGCTTTGTCACCG
GATGGAAATTTTATTGCCATCCTTCAAGATTCTGTTATTGAAATAAGGAC
TGCTGGAAATTTTGAGCAAGTCATTACAAAATATAAGATTGAAAAAGATA
TGTTTCCAAGATGGCGTAAATTGATTTGGAATCATGACAACACCTTACTT
TGTTATTCAAACAGTTTTGGAGATTTGACCATTTTGGATATTACCGGCac
taaaaaacattttattccaTCATCAAATAATGTCAAGTTAAAAGTGCCTG
GAACGCTGAGTTTGGCATTGTGTCATGTTGAATTTGTAGCCAAAGGAAAT
agCTTCTTGTTATATACCTGCACCTATCAAGGATTTTTTACAGTTTATGA
AGTGAATGAATCCTCCTGCACAATAAAATGGGACTACTCTTTCATAACAT
TCCATCCATATGGATTAGCTGGTTTGGTTATTGATCATAAAAATGGGTTA
TTGGTTGCAGCTGGGAATTATGGGAAGGAACCATTTCCTAATGTCATGGG
AGATGCATGTTATGGATCATATTCTGGTATCAGTCTCTGGAGATTTTTGA
ATGACACACCTCATCTAACTCTGGTTGAAGACCAGGGAAAAGCTTTGAAG
AAGGTATCCAGAGGTGAATGGTTAAAGAGTGTTGTTTTAAGACGTGGCGA
TGAAAAAAACGAAATGTTGAAGCATGGTATTTACAAGTTGAAATTGTCAG
AAGATGGTACACAAATTGTCACACTGCATCTTGATGGTCGCATATCTTTT
TGGAGTATCCCGTCAATGAGGCTAATCAAAACTTGGAGTAAATCTGAACA
ACCTGATGCAAGTGGCGGCTCAAGTGAAGGGTTCTCCTTTGACTCGCAGA
AAAAAGAAGaTCTCACCAAAACAAGGAATTCAATAGATGTCAGCTGGTGG
TCTGAAAAGGAGATTGCTTTGGCATCTGGGAGGGGTGATGTAACGATTGC
TTCGACTGACAGCTTGAAGAATTTACTTGGAGAGTCGAGTGAGAAATTTG
ATCCATGGCCGTCACTCAGCCAAGTGGTGGATGGAAGCATTCTTGTGCTC
GAGTGTGAGAAACGAGTGAACGATCCAAACAACAAAACGAAGACATCTTG
GAAATGGACTTCAGAAGAAGATGAAAGCCAAGATGAAGTGAACTCGATTC
GTTATCGATTCAAAGAACTCACTAAACAGATGTTATATTTCATCACTGAG
GCTGAAAGGTTTTTACCAGCTGTCAAGCCTCCAAGAATTTTAACCAACGT
TTATCGTTTACTATGCTTGAAATCTACAACACCCGAAGAATTATACACGC
GGAAAATCAATCTTGAACATTACGGAGAGGCCTTGGACCTAGCTAAACGT
TTTGGTTTGAATACTGATTTAGTTTATCAGCGACAGTGGAAAAAGAAAAG
AGTTTCGAAGATTACCATTCATGATTATCtgtcCAAGATTAAAGATCGAT
ATTGGGTTTTGGACGAGTGCCTTTTACGAGTTGCCGATGACTTTGACTCG
ACAGAAGAGTTACTGAAATACGGTTTACTCGGTACAAGTTGGGAAATCTT
GCAAAGGATTGATGAAGAGGGTAAAGGTGatgcaaaggatgatgggaAGT
TATTACCTTTTAAATTTGACGCCGCCCCACATGACGAGGATGACGAAAAC
TCAAGTAGAGAATTCCAAgggagTCTAACGAAGAAGCAATTGAAAATCTG
CCAATATCGACGGCAATTATTACATTATCTTGATCGGCTTTCCACTTATG
AGGTTGTTTTGGGAGGCTCATTCAAAGCACGAGATAAATTCTCAAAAGAG
TATTTTACCAAATTTCGATCGTGCAATATGGTACACCAAGCGGTCGAGTG
TGCCCGCGACGAGGACGCTTATACTCTGGAGCATTTGTTTTCGTACCATG
GGAAGCAGTTACTACCTTATTGGCTGCCGATATTATCAAACTTCCCGGAA
ACAACCGATATCCGATATTTTGAGCCGGTCATCCCTGAGATTGGAGAGCC
ACCAGAAGATCCAGAGATTTTACCTTGGTTAGAGAAACACCATCGTGAAG
AGGATTGGGTCGAGCAATCGAATATTGTCCAACAAATCAAGTCTAATGAA
GAAGGTGACGCAAACGAAGATATAGGCTCATTCATTTTCGAATCCGATCC
AGAGATacgaaaattttacaaatgtGAAACAAAAGCTCAACTGAGAGAAT
GGTTTTTACATCGTGTACACTTGATTGATGAATATTCCGGTCAGATTGAT
AAATGTTGCGAGCTGTTAGATGTGGGAATCAAAAGAGGCTTGGAAGGGCT
CACTAAGGTTCACCAAGAAATGGAAGCATGGAGACTCTTAGTTTACGACG
TTGGAATTGACAGTAAAATGACTGCAAAGAGTTTCGTGGAATTATCTGAA
TCATCGAAAATCAAATTGCTAATGTTCAAAACCTCAGATGTGACATTCGT
TAACGATTTCAAGCTATATCTAATGCCGTATTTAAGAAATATTGGAAAGA
AGGATTTTAAGAAACGCCAAGATTTACTTCATGAGTTTTTGGTGGAAATC
GCTAAAACTGATTTGACATGCTGCTTGAAGTTATTGGAAAAGTGTTCGCC
AGAGCTGCCAGAACCACTGCTTCCTGATATGGCGGAGATAATGAAGATTG
GGATTGATTGCGTTTACGCGTGCAAGAGAACGGATCAATTGAATCATTGT
TTCAGCATTGTCGAATGTTTGCCTTCGAGAGAAGAGGGAGTCATTAGCCG
TCCCGTGGAAGAGCTTCACATACAACTGGATCAATTGGAACATTTGCTGA
CAGGAGCGGAAATTTTACAGTATTACAACAACCCTCAGACCATCTCTTAC
ATTTCTGAAATTAAAGATGACTCTACTATTTGTAAACAACTCATTCAGCA
ATTGGTGAAAAACGCTGTTTGTAAAGGACGTTGTGTTCCAAAGGAATTGA
ACAAATTACTCGGACATTTGATCAAGCTTTCCAAAGAAGTTTTCCGGTGC
TGTGATATCAAGATCGTTCACCAGATTTTCGTTGAAGAATTACTACGGTC
CGGTTCACGTGAGAACATAACAGTAGCTGAAGAGTTGATCACGCCTTCCA
AACTTGCCGGGAATTCACCTCAAAGTAAGAAACCAGAACAACATTTGACG
TCTGCACTCTACCTCCTCAAATATGATGTTTCGGTTACCGTTGTGTTGGA
AGCGAGTCGTGAATATTTCAATGCAGCAATGTCGGGTAATGACTCTTCAA
TGGAACTGGCTAGATTGTGTCTAACATTGGTCAAAGATTGTCCAGAGAGT
GTTCAAGATGAATTGGATTTGATCAACTCGTTGGGTTTATTGTATGAATT
CAATGTATCCATGCTACCCTTACAAGTTCGCCTTTGCGCTGATAAATTGG
AAATTATCGATCTTTGTTTGAAGGAGAAGAAGAATGGGTACAAGAAAAAA
GACAAGCTCATCCAATTGAGTAATCTTTTGCAAATCTGTGGCCATGACAA
CAAAGAACGGATTGGACAAGTCAATATTAAAATTGCTGAATCAGCATTTG
AACATAAAGATTACACATACGCTGGTATCGTTTGTGTACAATTGGTGGAT
GATAATTATTCTAATGCTTGGTATATTTGCAGGAAACTTGGTGAATGTGC
TAAATATACCAACTTCACAATCAGGCAAAAGTTGTTGAGTTTTGCGTTAA
CTTATTGTCCAGTACATCACATTGAAGAAGTTTTACAAGAGAAAACTCAA
CTGGAAACCCAGGTTTTGTACGAGAGGTTGGGTGTATTTACGAAAGAAGG
CAAGAAAGACAAAATTGTGACCTCATCTAAGAAAGAAACTGAGGAAGAAA
ACGACGAAGACAATGTTGATGGGAATAACATATCAATCCTCAACAAGACC
AAAACTACAACAAAGAAATTGATTTCAAGCGTCGCCAGCGTGGCTGATAA
CCGCTGGGTTGGATCCGCAATGAATTGGGTCAAACCGTCGTCGGAAGGGT
CTGGTAACGAAGTTGATGTTGTTGAGCGGGAAATTGAAAGCGTTCGGCAT
AACCCATTTTATAGTTCGCTGGATTCGAAAAAGATTGACGAAGATGTTCA
AAGATTTAATTATAACGAGTTCAGCGACCATTTGAGGTGCGTCACAACCG
AAGAAAAAGTATTCAATCAGCTGGTGTTAAGAAGTCAAAAATTGAACGAG
CAAAGAACCCTGGGTAAAGAGCTCGAAAACACTGACCAAGCAATGCTATC
GTTGAGTGATATAGCTTATACTGAAGAAAGTTGTTTGTGTCTGGCTTACA
TGATGGCTATTTCTCAGCCAAAAGAAATCCATTCCCTATCGACCAAGCAT
CGGAAAAACACTTTCACTTTCCTTTTCACTGCTTATTACTATGCATTACA
AGAATAtgttaaaaacaacaaaatcgAATTCGATAAACAAGCACAGATTT
ACAGCGCGCCTCCGATTGATGTGATTACATGGATGCTAAAAGTGTTAGGT
AAGAAGCAAGgagaaaaggaagaaaaagaaaaaggagagACTTACTTTCT
GTCTAACATGAACAAGTTGCAAGACTTGATGCAAGCAAAGATGCTACAAG
CTCTTGACAAAGgaGTGGACATCGAAAGATTTTCAGTTGATAATGAATAT
AAACGTGAAACTATACTCGGATTAGCTATGAGTGTCGAAGACGAGTTGAT
TAACACAAGTTTGCTGCTAGCAGAGAAATATGATATCCCCGCATGGGAAG
TGTTGTTATCACACGTGGAATTTTTATTCACTGATAGTGGTCTAAAAGCC
AAAGCTATCCGCGAATCACTAAACAAATGGAAAGTTGATTCCCATTTGAA
ACCGAACGGTGATAAAGTCTTTGAGCGGATGAAGAAATATGTTTACCCAG
AAATCAATGGTAAAGACCACAATGCATTGCTGTTGTTCTACGTTTTCCTA
ATGAATTGCAGCTCGCCCACTAAAATATTGGAGGGTACGCTTACATTAGA
TGCTCATTCcaaacttttgaagaaaatcaaGGCTGCTGCATCATCCATCA
ATTACAAACTTCTCGTGCATGGAGATTCACCTTTGGAGGTGATTAGAGAC
TGTGTTGATGATAACAATGTACATTTGTTGGCTAAAATTGCATCCAAAAT
CCCCCAGGCGGATGGTAGTTACCTGTCATCAAACAAGATCTTCTTAGCAA
ACGCCATTCGGatgttttggaagaaaaaagaGAACAAGGATTGGTTGAAT
ACATTCGAAAACTGTAAACAACACTTCACCAAACTCCTGATAGAAGACGT
TGTCACTTTTGCTGACCATGCAATTTTTGGCGAGGAAGCTTTAGACTCGC
TGACCCAAGACACCAGACTGGAGATTGGTAAAAGAGtaataaaatatttg
agacaacaACGTGGTCAAGACGAGACCAAACAAAGAGGAGCTGACGATTA
TGATTCGCTTATGGAGCGCTACGATTCATCTATCAATGATTTGGAACTTT
CCATCGAACATCTCAAAACGCTGACTGATCCAATTTTCAAAGCAGTCTTT
GGTGACGATAACGAACTGAGCAAAACCTTTGGACGAGTATACGACTTATC
ACGTGGTCGAAAACAACCACTCGAAAAACTATTCCGTGATTTGTTCATAT
CGNTACAACCATTAGACAAAATTTCGAAACTGCGGAGTCTTTGTCGCAAT
GCATCTATTGACGTCCGCACGTGTTTCCAAGATGCTTTGCGCGGGATCCT
GAGTGACATCCAAAGCGATAGAGATTACACAAAACTACAGACTTTAACGG
AGAACATCAAAGCGCATCAAGAACATCAAACAGACCCTCTTGTTACCCAT
AGCGACGTCTTAGATGTGGTGCGGCCATTTTGTTCTGATGTTACAGCTAG
CACGGATGTGAAGAGTCACGTGTTACATNTTTTGTTCTGAatggaaGAAA
ATGAGCAAATATTGTATGATTTGATTGTTCACGAAGAATGGAAACAAGAA
CCACAGTTGTTGGACCAAGTTGAAAGTTATTTTTGGCAATATCGTGGTTC
ACTTCTAAAGAAGCTATGGAAAGTTTCACAAAGTTCTGCAATTTATATGT
GGGACAACTTGAAGACACAATTCAGATATCAAGCTACCTTTGGTTGCCCA
CCATTGAATTTTATCAATCTGATGAACAATTGCTTGCCATGGCTTATGGC
TTTGTCACCGGATGGAAATTTTATTGCCATCCTTCAAGATTCTGTTATTG
AAATAAGGACTGCTGGAAATTTTGAGCAAGTCATTACAAAATATAAGATT
GAAAAAGATATGTTTCCAAGATGGCGTAAATTGATTTGGAATCATGACAA
CACCTTACTTTGTTATTCAAACAGTTTTGGAGATTTGACCATTTTGGATA
TTACCGGCactaaaaaacattttattccaTCATCAAATAATGTCAAGTTA
AAAGTGCCTGGAACGCTGAGTTTGGCATTGTGTCATGTTGAATTTGTAGC
CAAAGGAAATagCTTCTTGTTATATACCTGCACCTATCAAGGATTTTTTA
CAGTTTATGAAGTGAATGAATCCTCCTGCACAATAAAATGGGACTACTCT
TTCATAACATTCCATCCATATGGATTAGCTGGTTTGGTTATTGATCATAA
AAATGGGTTATTGGTTGCAGCTGGGAATTATGGGAAGGAACCATTTCCTA
ATGTCATGGGAGATGCATGTTATGGATCATATTCTGGTATCAGTCTCTGG
AGATTTTTGAATGACACACCTCATCTAACTCTGGTTGAAGACCAGGGAAA
AGCTTTGAAGAAGGTATCCAGAGGTGAATGGTTAAAGAGTGTTGTTTTAA
GACGTGGCGATGAAAAAAACGAAATGTTGAAGCATGGTATTTACAAGTTG
AAATTGTCAGAAGATGGTACACAAATTGTCACACTGCATCTTGATGGTCG
CATATCTTTTTGGAGTATCCCGTCAATGAGGCTAATCAAAACTTGGAGTA
AATCTGAACAACCTGATGCAAGTGGCGGCTCAAGTGAAGGGTTCTCCTTT
GACTCGCAGAAAAAAGAAGaTCTCACCAAAACAAGGAATTCAATAGATGT
CAGCTGGTGGTCTGAAAAGGAGATTGCTTTGGCATCTGGGAGGGGTGATG
TAACGATTGCTTCGACTGACAGCTTGAAGAATTTACTTGGAGAGTCGAGT
GAGAAATTTGATCCATGGCCGTCACTCAGCCAAGTGGTGGATGGAAGCAT
TCTTGTGCTCGAGTGTGAGAAACGAGTGAACGATCCAAACAACAAAACGA
AGACATCTTGGAAATGGACTTCAGAAGAAGATGAAAGCCAAGATGAAGTG
AACTCGATTCGTTATCGATTCAAAGAACTCACTAAACAGATGTTATATTT
CATCACTGAGGCTGAAAGGTTTTTACCAGCTGTCAAGCCTCCAAGAATTT
TAACCAACGTTTATCGTTTACTATGCTTGAAATCTACAACACCCGAAGAA
TTATACACGCGGAAAATCAATCTTGAACATTACGGAGAGGCCTTGGACCT
AGCTAAACGTTTTGGTTTGAATACTGATTTAGTTTATCAGCGACAGTGGA
AAAAGAAAAGAGTTTCGAAGATTACCATTCATGATTATCtgtcCAAGATT
AAAGATCGATATTGGGTTTTGGACGAGTGCCTTTTACGAGTTGCCGATGA
CTTTGACTCGACAGAAGAGTTACTGAAATACGGTTTACTCGGTACAAGTT
GGGAAATCTTGCAAAGGATTGATGAAGAGGGTAAAGGTGatgcaaaggat
gatgggaAGTTATTACCTTTTAAATTTGACGCCGCCCCACATGACGAGGA
TGACGAAAACTCAAGTAGAGAATTCCAAgggagTCTAACGAAGAAGCAAT
TGAAAATCTGCCAATATCGACGGCAATTATTACATTATCTTGATCGGCTT
TCCACTTATGAGGTTGTTTTGGGAGGCTCATTCAAAGCACGAGATAAATT
CTCAAAAGAGTATTTTACCAAATTTCGATCGTGCAATATGGTACACCAAG
CGGTCGAGTGTGCCCGCGACGAGGACGCTTATACTCTGGAGCATTTGTTT
TCGTACCATGGGAAGCAGTTACTACCTTATTGGCTGCCGATATTATCAAA
CTTCCCGGAAACAACCGATATCCGATATTTTGAGCCGGTCATCCCTGAGA
TTGGAGAGCCACCAGAAGATCCAGAGATTTTACCTTGGTTAGAGAAACAC
CATCGTGAAGAGGATTGGGTCGAGCAATCGAATATTGTCCAACAAATCAA
GTCTAATGAAGAAGGTGACGCAAACGAAGATATAGGCTCATTCATTTTCG
AATCCGATCCAGAGATacgaaaattttacaaatgtGAAACAAAAGCTCAA
CTGAGAGAATGGTTTTTACATCGTGTACACTTGATTGATGAATATTCCGG
TCAGATTGATAAATGTTGCGAGCTGTTAGATGTGGGAATCAAAAGAGGCT
TGGAAGGGCTCACTAAGGTTCACCAAGAAATGGAAGCATGGAGACTCTTA
GTTTACGACGTTGGAATTGACAGTAAAATGACTGCAAAGAGTTTCGTGGA
ATTATCTGAATCATCGAAAATCAAATTGCTAATGTTCAAAACCTCAGATG
TGACATTCGTTAACGATTTCAAGCTATATCTAATGCCGTATTTAAGAAAT
ATTGGAAAGAAGGATTTTAAGAAACGCCAAGATTTACTTCATGAGTTTTT
GGTGGAAATCGCTAAAACTGATTTGACATGCTGCTTGAAGTTATTGGAAA
AGTGTTCGCCAGAGCTGCCAGAACCACTGCTTCCTGATATGGCGGAGATA
ATGAAGATTGGGATTGATTGCGTTTACGCGTGCAAGAGAACGGATCAATT
GAATCATTGTTTCAGCATTGTCGAATGTTTGCCTTCGAGAGAAGAGGGAG
TCATTAGCCGTCCCGTGGAAGAGCTTCACATACAACTGGATCAATTGGAA
CATTTGCTGACAGGAGCGGAAATTTTACAGTATTACAACAACCCTCAGAC
CATCTCTTACATTTCTGAAATTAAAGATGACTCTACTATTTGTAAACAAC
TCATTCAGCAATTGGTGAAAAACGCTGTTTGTAAAGGACGTTGTGTTCCA
AAGGAATTGAACAAATTACTCGGACATTTGATCAAGCTTTCCAAAGAAGT
TTTCCGGTGCTGTGATATCAAGATCGTTCACCAGATTTTCGTTGAAGAAT
TACTACGGTCCGGTTCACGTGAGAACATAACAGTAGCTGAAGAGTTGATC
ACGCCTTCCAAACTTGCCGGGAATTCACCTCAAAGTAAGAAACCAGAACA
ACATTTGACGTCTGCACTCTACCTCCTCAAATATGATGTTTCGGTTACCG
TTGTGTTGGAAGCGAGTCGTGAATATTTCAATGCAGCAATGTCGGGTAAT
GACTCTTCAATGGAACTGGCTAGATTGTGTCTAACATTGGTCAAAGATTG
TCCAGAGAGTGTTCAAGATGAATTGGATTTGATCAACTCGTTGGGTTTAT
TGTATGAATTCAATGTATCCATGCTACCCTTACAAGTTCGCCTTTGCGCT
GATAAATTGGAAATTATCGATCTTTGTTTGAAGGAGAAGAAGAATGGGTA
CAAGAAAAAAGACAAGCTCATCCAATTGAGTAATCTTTTGCAAATCTGTG
GCCATGACAACAAAGAACGGATTGGACAAGTCAATATTAAAATTGCTGAA
TCAGCATTTGAACATAAAGATTACACATACGCTGGTATCGTTTGTGTACA
ATTGGTGGATGATAATTATTCTAATGCTTGGTATATTTGCAGGAAACTTG
GTGAATGTGCTAAATATACCAACTTCACAATCAGGCAAAAGTTGTTGAGT
TTTGCGTTAACTTATTGTCCAGTACATCACATTGAAGAAGTTTTACAAGA
GAAAACTCAACTGGAAACCCAGGTTTTGTACGAGAGGTTGGGTGTATTTA
CGAAAGAAGGCAAGAAAGACAAAATTGTGACCTCATCTAAGAAAGAAACT
GAGGAAGAAAACGACGAAGACAATGTTGATGGGAATAACATATCAATCCT
CAACAAGACCAAAACTACAACAAAGAAATTGATTTCAAGCGTCGCCAGCG
TGGCTGATAACCGCTGGGTTGGATCCGCAATGAATTGGGTCAAACCGTCG
TCGGAAGGGTCTGGTAACGAAGTTGATGTTGTTGAGCGGGAAATTGAAAG
CGTTCGGCATAACCCATTTTATAGTTCGCTGGATTCGAAAAAGATTGACG
AAGATGTTCAAAGATTTAATTATAACGAGTTCAGCGACCATTTGAGGTGC
GTCACAACCGAAGAAAAAGTATTCAATCAGCTGGTGTTAAGAAGTCAAAA
ATTGAACGAGCAAAGAACCCTGGGTAAAGAGCTCGAAAACACTGACCAAG
CAATGCTATCGTTGAGTGATATAGCTTATACTGAAGAAAGTTGTTTGTGT
CTGGCTTACATGATGGCTATTTCTCAGCCAAAAGAAATCCATTCCCTATC
GACCAAGCATCGGAAAAACACTTTCACTTTCCTTTTCACTGCTTATTACT
ATGCATTACAAGAATAtgttaaaaacaacaaaatcgAATTCGATAAACAA
GCACAGATTTACAGCGCGCCTCCGATTGATGTGATTACATGGATGCTAAA
AGTGTTAGGTAAGAAGCAAGgagaaaaggaagaaaaagaaaaaggagagA
CTTACTTTCTGTCTAACATGAACAAGTTGCAAGACTTGATGCAAGCAAAG
ATGCTACAAGCTCTTGACAAAGgaGTGGACATCGAAAGATTTTCAGTTGA
TAATGAATATAAACGTGAAACTATACTCGGATTAGCTATGAGTGTCGAAG
ACGAGTTGATTAACACAAGTTTGCTGCTAGCAGAGAAATATGATATCCCC
GCATGGGAAGTGTTGTTATCACACGTGGAATTTTTATTCACTGATAGTGG
TCTAAAAGCCAAAGCTATCCGCGAATCACTAAACAAATGGAAAGTTGATT
CCCATTTGAAACCGAACGGTGATAAAGTCTTTGAGCGGATGAAGAAATAT
GTTTACCCAGAAATCAATGGTAAAGACCACAATGCATTGCTGTTGTTCTA
CGTTTTCCTAATGAATTGCAGCTCGCCCACTAAAATATTGGAGGGTACGC
TTACATTAGATGCTCATTCcaaacttttgaagaaaatcaaGGCTGCTGCA
TCATCCATCAATTACAAACTTCTCGTGCATGGAGATTCACCTTTGGAGGT
GATTAGAGACTGTGTTGATGATAACAATGTACATTTGTTGGCTAAAATTG
CATCCAAAATCCCCCAGGCGGATGGTAGTTACCTGTCATCAAACAAGATC
TTCTTAGCAAACGCCATTCGGatgttttggaagaaaaaagaGAACAAGGA
TTGGTTGAATACATTCGAAAACTGTAAACAACACTTCACCAAACTCCTGA
TAGAAGACGTTGTCACTTTTGCTGACCATGCAATTTTTGGCGAGGAAGCT
TTAGACTCGCTGACCCAAGACACCAGACTGGAGATTGGTAAAAGAGtaat
aaaatatttgagacaacaACGTGGTCAAGACGAGACCAAACAAAGAGGAG
CTGACGATTATGATTCGCTTATGGAGCGCTACGATTCATCTATCAATGAT
TTGGAACTTTCCATCGAACATCTCAAAACGCTGACTGATCCAATTTTCAA
AGCAGTCTTTGGTGACGATAACGAACTGAGCAAAACCTTTGGACGAGTAT
ACGACTTATCACGTGGTCGAAAACAACCACTCGAAAAACTATTCCGTGAT
TTGTTCATATCGNTACAACCATTAGACAAAATTTCGAAACTGCGGAGTCT
TTGTCGCAATGCATCTATTGACGTCCGCACGTGTTTCCAAGATGCTTTGC
GCGGGATCCTGAGTGACATCCAAAGCGATAGAGATTACACAAAACTACAG
ACTTTAACGGAGAACATCAAAGCGCATCAAGAACATCAAACAGACCCTCT
TGTTACCCATAGCGACGTCTTAGATGTGGTGCGGCCATTTTGTTCTGATG
TTACAGCTAGCACGGATGTGAAGAGTCACGTGTTACATNTTTTGTTCTGA
atggaaGAAAATGAGCAAATATTGTATGATTTGATTGTTCACGAAGAATG
GAAACAAGAACCACAGTTGTTGGACCAAGTTGAAAGTTATTTTTGGCAAT
ATCGTGGTTCACTTCTAAAGAAGCTATGGAAAGTTTCACAAAGTTCTGCA
ATTTATATGTGGGACAACTTGAAGACACAATTCAGATATCAAGCTACCTT
TGGTTGCCCACCATTGAATTTTATCAATCTGATGAACAATTGCTTGCCAT
GGCTTATGGCTTTGTCACCGGATGGAAATTTTATTGCCATCCTTCAAGAT
TCTGTTATTGAAATAAGGACTGCTGGAAATTTTGAGCAAGTCATTACAAA
ATATAAGATTGAAAAAGATATGTTTCCAAGATGGCGTAAATTGATTTGGA
ATCATGACAACACCTTACTTTGTTATTCAAACAGTTTTGGAGATTTGACC
ATTTTGGATATTACCGGCactaaaaaacattttattccaTCATCAAATAA
TGTCAAGTTAAAAGTGCCTGGAACGCTGAGTTTGGCATTGTGTCATGTTG
AATTTGTAGCCAAAGGAAATagCTTCTTGTTATATACCTGCACCTATCAA
GGATTTTTTACAGTTTATGAAGTGAATGAATCCTCCTGCACAATAAAATG
GGACTACTCTTTCATAACATTCCATCCATATGGATTAGCTGGTTTGGTTA
TTGATCATAAAAATGGGTTATTGGTTGCAGCTGGGAATTATGGGAAGGAA
CCATTTCCTAATGTCATGGGAGATGCATGTTATGGATCATATTCTGGTAT
CAGTCTCTGGAGATTTTTGAATGACACACCTCATCTAACTCTGGTTGAAG
ACCAGGGAAAAGCTTTGAAGAAGGTATCCAGAGGTGAATGGTTAAAGAGT
GTTGTTTTAAGACGTGGCGATGAAAAAAACGAAATGTTGAAGCATGGTAT
TTACAAGTTGAAATTGTCAGAAGATGGTACACAAATTGTCACACTGCATC
TTGATGGTCGCATATCTTTTTGGAGTATCCCGTCAATGAGGCTAATCAAA
ACTTGGAGTAAATCTGAACAACCTGATGCAAGTGGCGGCTCAAGTGAAGG
GTTCTCCTTTGACTCGCAGAAAAAAGAAGaTCTCACCAAAACAAGGAATT
CAATAGATGTCAGCTGGTGGTCTGAAAAGGAGATTGCTTTGGCATCTGGG
AGGGGTGATGTAACGATTGCTTCGACTGACAGCTTGAAGAATTTACTTGG
AGAGTCGAGTGAGAAATTTGATCCATGGCCGTCACTCAGCCAAGTGGTGG
ATGGAAGCATTCTTGTGCTCGAGTGTGAGAAACGAGTGAACGATCCAAAC
AACAAAACGAAGACATCTTGGAAATGGACTTCAGAAGAAGATGAAAGCCA
AGATGAAGTGAACTCGATTCGTTATCGATTCAAAGAACTCACTAAACAGA
TGTTATATTTCATCACTGAGGCTGAAAGGTTTTTACCAGCTGTCAAGCCT
CCAAGAATTTTAACCAACGTTTATCGTTTACTATGCTTGAAATCTACAAC
ACCCGAAGAATTATACACGCGGAAAATCAATCTTGAACATTACGGAGAGG
CCTTGGACCTAGCTAAACGTTTTGGTTTGAATACTGATTTAGTTTATCAG
CGACAGTGGAAAAAGAAAAGAGTTTCGAAGATTACCATTCATGATTATCt
gtcCAAGATTAAAGATCGATATTGGGTTTTGGACGAGTGCCTTTTACGAG
TTGCCGATGACTTTGACTCGACAGAAGAGTTACTGAAATACGGTTTACTC
GGTACAAGTTGGGAAATCTTGCAAAGGATTGATGAAGAGGGTAAAGGTGa
tgcaaaggatgatgggaAGTTATTACCTTTTAAATTTGACGCCGCCCCAC
ATGACGAGGATGACGAAAACTCAAGTAGAGAATTCCAAgggagTCTAACG
AAGAAGCAATTGAAAATCTGCCAATATCGACGGCAATTATTACATTATCT
TGATCGGCTTTCCACTTATGAGGTTGTTTTGGGAGGCTCATTCAAAGCAC
GAGATAAATTCTCAAAAGAGTATTTTACCAAATTTCGATCGTGCAATATG
GTACACCAAGCGGTCGAGTGTGCCCGCGACGAGGACGCTTATACTCTGGA
GCATTTGTTTTCGTACCATGGGAAGCAGTTACTACCTTATTGGCTGCCGA
TATTATCAAACTTCCCGGAAACAACCGATATCCGATATTTTGAGCCGGTC
ATCCCTGAGATTGGAGAGCCACCAGAAGATCCAGAGATTTTACCTTGGTT
AGAGAAACACCATCGTGAAGAGGATTGGGTCGAGCAATCGAATATTGTCC
AACAAATCAAGTCTAATGAAGAAGGTGACGCAAACGAAGATATAGGCTCA
TTCATTTTCGAATCCGATCCAGAGATacgaaaattttacaaatgtGAAAC
AAAAGCTCAACTGAGAGAATGGTTTTTACATCGTGTACACTTGATTGATG
AATATTCCGGTCAGATTGATAAATGTTGCGAGCTGTTAGATGTGGGAATC
AAAAGAGGCTTGGAAGGGCTCACTAAGGTTCACCAAGAAATGGAAGCATG
GAGACTCTTAGTTTACGACGTTGGAATTGACAGTAAAATGACTGCAAAGA
GTTTCGTGGAATTATCTGAATCATCGAAAATCAAATTGCTAATGTTCAAA
ACCTCAGATGTGACATTCGTTAACGATTTCAAGCTATATCTAATGCCGTA
TTTAAGAAATATTGGAAAGAAGGATTTTAAGAAACGCCAAGATTTACTTC
ATGAGTTTTTGGTGGAAATCGCTAAAACTGATTTGACATGCTGCTTGAAG
TTATTGGAAAAGTGTTCGCCAGAGCTGCCAGAACCACTGCTTCCTGATAT
GGCGGAGATAATGAAGATTGGGATTGATTGCGTTTACGCGTGCAAGAGAA
CGGATCAATTGAATCATTGTTTCAGCATTGTCGAATGTTTGCCTTCGAGA
GAAGAGGGAGTCATTAGCCGTCCCGTGGAAGAGCTTCACATACAACTGGA
TCAATTGGAACATTTGCTGACAGGAGCGGAAATTTTACAGTATTACAACA
ACCCTCAGACCATCTCTTACATTTCTGAAATTAAAGATGACTCTACTATT
TGTAAACAACTCATTCAGCAATTGGTGAAAAACGCTGTTTGTAAAGGACG
TTGTGTTCCAAAGGAATTGAACAAATTACTCGGACATTTGATCAAGCTTT
CCAAAGAAGTTTTCCGGTGCTGTGATATCAAGATCGTTCACCAGATTTTC
GTTGAAGAATTACTACGGTCCGGTTCACGTGAGAACATAACAGTAGCTGA
AGAGTTGATCACGCCTTCCAAACTTGCCGGGAATTCACCTCAAAGTAAGA
AACCAGAACAACATTTGACGTCTGCACTCTACCTCCTCAAATATGATGTT
TCGGTTACCGTTGTGTTGGAAGCGAGTCGTGAATATTTCAATGCAGCAAT
GTCGGGTAATGACTCTTCAATGGAACTGGCTAGATTGTGTCTAACATTGG
TCAAAGATTGTCCAGAGAGTGTTCAAGATGAATTGGATTTGATCAACTCG
TTGGGTTTATTGTATGAATTCAATGTATCCATGCTACCCTTACAAGTTCG
CCTTTGCGCTGATAAATTGGAAATTATCGATCTTTGTTTGAAGGAGAAGA
AGAATGGGTACAAGAAAAAAGACAAGCTCATCCAATTGAGTAATCTTTTG
CAAATCTGTGGCCATGACAACAAAGAACGGATTGGACAAGTCAATATTAA
AATTGCTGAATCAGCATTTGAACATAAAGATTACACATACGCTGGTATCG
TTTGTGTACAATTGGTGGATGATAATTATTCTAATGCTTGGTATATTTGC
AGGAAACTTGGTGAATGTGCTAAATATACCAACTTCACAATCAGGCAAAA
GTTGTTGAGTTTTGCGTTAACTTATTGTCCAGTACATCACATTGAAGAAG
TTTTACAAGAGAAAACTCAACTGGAAACCCAGGTTTTGTACGAGAGGTTG
GGTGTATTTACGAAAGAAGGCAAGAAAGACAAAATTGTGACCTCATCTAA
GAAAGAAACTGAGGAAGAAAACGACGAAGACAATGTTGATGGGAATAACA
TATCAATCCTCAACAAGACCAAAACTACAACAAAGAAATTGATTTCAAGC
GTCGCCAGCGTGGCTGATAACCGCTGGGTTGGATCCGCAATGAATTGGGT
CAAACCGTCGTCGGAAGGGTCTGGTAACGAAGTTGATGTTGTTGAGCGGG
AAATTGAAAGCGTTCGGCATAACCCATTTTATAGTTCGCTGGATTCGAAA
AAGATTGACGAAGATGTTCAAAGATTTAATTATAACGAGTTCAGCGACCA
TTTGAGGTGCGTCACAACCGAAGAAAAAGTATTCAATCAGCTGGTGTTAA
GAAGTCAAAAATTGAACGAGCAAAGAACCCTGGGTAAAGAGCTCGAAAAC
ACTGACCAAGCAATGCTATCGTTGAGTGATATAGCTTATACTGAAGAAAG
TTGTTTGTGTCTGGCTTACATGATGGCTATTTCTCAGCCAAAAGAAATCC
ATTCCCTATCGACCAAGCATCGGAAAAACACTTTCACTTTCCTTTTCACT
GCTTATTACTATGCATTACAAGAATAtgttaaaaacaacaaaatcgAATT
CGATAAACAAGCACAGATTTACAGCGCGCCTCCGATTGATGTGATTACAT
GGATGCTAAAAGTGTTAGGTAAGAAGCAAGgagaaaaggaagaaaaagaa
aaaggagagACTTACTTTCTGTCTAACATGAACAAGTTGCAAGACTTGAT
GCAAGCAAAGATGCTACAAGCTCTTGACAAAGgaGTGGACATCGAAAGAT
TTTCAGTTGATAATGAATATAAACGTGAAACTATACTCGGATTAGCTATG
AGTGTCGAAGACGAGTTGATTAACACAAGTTTGCTGCTAGCAGAGAAATA
TGATATCCCCGCATGGGAAGTGTTGTTATCACACGTGGAATTTTTATTCA
CTGATAGTGGTCTAAAAGCCAAAGCTATCCGCGAATCACTAAACAAATGG
AAAGTTGATTCCCATTTGAAACCGAACGGTGATAAAGTCTTTGAGCGGAT
GAAGAAATATGTTTACCCAGAAATCAATGGTAAAGACCACAATGCATTGC
TGTTGTTCTACGTTTTCCTAATGAATTGCAGCTCGCCCACTAAAATATTG
GAGGGTACGCTTACATTAGATGCTCATTCcaaacttttgaagaaaatcaa
GGCTGCTGCATCATCCATCAATTACAAACTTCTCGTGCATGGAGATTCAC
CTTTGGAGGTGATTAGAGACTGTGTTGATGATAACAATGTACATTTGTTG
GCTAAAATTGCATCCAAAATCCCCCAGGCGGATGGTAGTTACCTGTCATC
AAACAAGATCTTCTTAGCAAACGCCATTCGGatgttttggaagaaaaaag
aGAACAAGGATTGGTTGAATACATTCGAAAACTGTAAACAACACTTCACC
AAACTCCTGATAGAAGACGTTGTCACTTTTGCTGACCATGCAATTTTTGG
CGAGGAAGCTTTAGACTCGCTGACCCAAGACACCAGACTGGAGATTGGTA
AAAGAGtaataaaatatttgagacaacaACGTGGTCAAGACGAGACCAAA
CAAAGAGGAGCTGACGATTATGATTCGCTTATGGAGCGCTACGATTCATC
TATCAATGATTTGGAACTTTCCATCGAACATCTCAAAACGCTGACTGATC
CAATTTTCAAAGCAGTCTTTGGTGACGATAACGAACTGAGCAAAACCTTT
GGACGAGTATACGACTTATCACGTGGTCGAAAACAACCACTCGAAAAACT
ATTCCGTGATTTGTTCATATCGNTACAACCATTAGACAAAATTTCGAAAC
TGCGGAGTCTTTGTCGCAATGCATCTATTGACGTCCGCACGTGTTTCCAA
GATGCTTTGCGCGGGATCCTGAGTGACATCCAAAGCGATAGAGATTACAC
AAAACTACAGACTTTAACGGAGAACATCAAAGCGCATCAAGAACATCAAA
CAGACCCTCTTGTTACCCATAGCGACGTCTTAGATGTGGTGCGGCCATTT
TGTTCTGATGTTACAGCTAGCACGGATGTGAAGAGTCACGTGTTACATNT
TTTGTTCTGAatggaaGAAAATGAGCAAATATTGTATGATTTGATTGTTC
ACGAAGAATGGAAACAAGAACCACAGTTGTTGGACCAAGTTGAAAGTTAT
TTTTGGCAATATCGTGGTTCACTTCTAAAGAAGCTATGGAAAGTTTCACA
AAGTTCTGCAATTTATATGTGGGACAACTTGAAGACACAATTCAGATATC
AAGCTACCTTTGGTTGCCCACCATTGAATTTTATCAATCTGATGAACAAT
TGCTTGCCATGGCTTATGGCTTTGTCACCGGATGGAAATTTTATTGCCAT
CCTTCAAGATTCTGTTATTGAAATAAGGACTGCTGGAAATTTTGAGCAAG
TCATTACAAAATATAAGATTGAAAAAGATATGTTTCCAAGATGGCGTAAA
TTGATTTGGAATCATGACAACACCTTACTTTGTTATTCAAACAGTTTTGG
AGATTTGACCATTTTGGATATTACCGGCactaaaaaacattttattccaT
CATCAAATAATGTCAAGTTAAAAGTGCCTGGAACGCTGAGTTTGGCATTG
TGTCATGTTGAATTTGTAGCCAAAGGAAATagCTTCTTGTTATATACCTG
CACCTATCAAGGATTTTTTACAGTTTATGAAGTGAATGAATCCTCCTGCA
CAATAAAATGGGACTACTCTTTCATAACATTCCATCCATATGGATTAGCT
GGTTTGGTTATTGATCATAAAAATGGGTTATTGGTTGCAGCTGGGAATTA
TGGGAAGGAACCATTTCCTAATGTCATGGGAGATGCATGTTATGGATCAT
ATTCTGGTATCAGTCTCTGGAGATTTTTGAATGACACACCTCATCTAACT
CTGGTTGAAGACCAGGGAAAAGCTTTGAAGAAGGTATCCAGAGGTGAATG
GTTAAAGAGTGTTGTTTTAAGACGTGGCGATGAAAAAAACGAAATGTTGA
AGCATGGTATTTACAAGTTGAAATTGTCAGAAGATGGTACACAAATTGTC
ACACTGCATCTTGATGGTCGCATATCTTTTTGGAGTATCCCGTCAATGAG
GCTAATCAAAACTTGGAGTAAATCTGAACAACCTGATGCAAGTGGCGGCT
CAAGTGAAGGGTTCTCCTTTGACTCGCAGAAAAAAGAAGaTCTCACCAAA
ACAAGGAATTCAATAGATGTCAGCTGGTGGTCTGAAAAGGAGATTGCTTT
GGCATCTGGGAGGGGTGATGTAACGATTGCTTCGACTGACAGCTTGAAGA
ATTTACTTGGAGAGTCGAGTGAGAAATTTGATCCATGGCCGTCACTCAGC
CAAGTGGTGGATGGAAGCATTCTTGTGCTCGAGTGTGAGAAACGAGTGAA
CGATCCAAACAACAAAACGAAGACATCTTGGAAATGGACTTCAGAAGAAG
ATGAAAGCCAAGATGAAGTGAACTCGATTCGTTATCGATTCAAAGAACTC
ACTAAACAGATGTTATATTTCATCACTGAGGCTGAAAGGTTTTTACCAGC
TGTCAAGCCTCCAAGAATTTTAACCAACGTTTATCGTTTACTATGCTTGA
AATCTACAACACCCGAAGAATTATACACGCGGAAAATCAATCTTGAACAT
TACGGAGAGGCCTTGGACCTAGCTAAACGTTTTGGTTTGAATACTGATTT
AGTTTATCAGCGACAGTGGAAAAAGAAAAGAGTTTCGAAGATTACCATTC
ATGATTATCtgtcCAAGATTAAAGATCGATATTGGGTTTTGGACGAGTGC
CTTTTACGAGTTGCCGATGACTTTGACTCGACAGAAGAGTTACTGAAATA
CGGTTTACTCGGTACAAGTTGGGAAATCTTGCAAAGGATTGATGAAGAGG
GTAAAGGTGatgcaaaggatgatgggaAGTTATTACCTTTTAAATTTGAC
GCCGCCCCACATGACGAGGATGACGAAAACTCAAGTAGAGAATTCCAAgg
gagTCTAACGAAGAAGCAATTGAAAATCTGCCAATATCGACGGCAATTAT
TACATTATCTTGATCGGCTTTCCACTTATGAGGTTGTTTTGGGAGGCTCA
TTCAAAGCACGAGATAAATTCTCAAAAGAGTATTTTACCAAATTTCGATC
GTGCAATATGGTACACCAAGCGGTCGAGTGTGCCCGCGACGAGGACGCTT
ATACTCTGGAGCATTTGTTTTCGTACCATGGGAAGCAGTTACTACCTTAT
TGGCTGCCGATATTATCAAACTTCCCGGAAACAACCGATATCCGATATTT
TGAGCCGGTCATCCCTGAGATTGGAGAGCCACCAGAAGATCCAGAGATTT
TACCTTGGTTAGAGAAACACCATCGTGAAGAGGATTGGGTCGAGCAATCG
AATATTGTCCAACAAATCAAGTCTAATGAAGAAGGTGACGCAAACGAAGA
TATAGGCTCATTCATTTTCGAATCCGATCCAGAGATacgaaaattttaca
aatgtGAAACAAAAGCTCAACTGAGAGAATGGTTTTTACATCGTGTACAC
TTGATTGATGAATATTCCGGTCAGATTGATAAATGTTGCGAGCTGTTAGA
TGTGGGAATCAAAAGAGGCTTGGAAGGGCTCACTAAGGTTCACCAAGAAA
TGGAAGCATGGAGACTCTTAGTTTACGACGTTGGAATTGACAGTAAAATG
ACTGCAAAGAGTTTCGTGGAATTATCTGAATCATCGAAAATCAAATTGCT
AATGTTCAAAACCTCAGATGTGACATTCGTTAACGATTTCAAGCTATATC
TAATGCCGTATTTAAGAAATATTGGAAAGAAGGATTTTAAGAAACGCCAA
GATTTACTTCATGAGTTTTTGGTGGAAATCGCTAAAACTGATTTGACATG
CTGCTTGAAGTTATTGGAAAAGTGTTCGCCAGAGCTGCCAGAACCACTGC
TTCCTGATATGGCGGAGATAATGAAGATTGGGATTGATTGCGTTTACGCG
TGCAAGAGAACGGATCAATTGAATCATTGTTTCAGCATTGTCGAATGTTT
GCCTTCGAGAGAAGAGGGAGTCATTAGCCGTCCCGTGGAAGAGCTTCACA
TACAACTGGATCAATTGGAACATTTGCTGACAGGAGCGGAAATTTTACAG
TATTACAACAACCCTCAGACCATCTCTTACATTTCTGAAATTAAAGATGA
CTCTACTATTTGTAAACAACTCATTCAGCAATTGGTGAAAAACGCTGTTT
GTAAAGGACGTTGTGTTCCAAAGGAATTGAACAAATTACTCGGACATTTG
ATCAAGCTTTCCAAAGAAGTTTTCCGGTGCTGTGATATCAAGATCGTTCA
CCAGATTTTCGTTGAAGAATTACTACGGTCCGGTTCACGTGAGAACATAA
CAGTAGCTGAAGAGTTGATCACGCCTTCCAAACTTGCCGGGAATTCACCT
CAAAGTAAGAAACCAGAACAACATTTGACGTCTGCACTCTACCTCCTCAA
ATATGATGTTTCGGTTACCGTTGTGTTGGAAGCGAGTCGTGAATATTTCA
ATGCAGCAATGTCGGGTAATGACTCTTCAATGGAACTGGCTAGATTGTGT
CTAACATTGGTCAAAGATTGTCCAGAGAGTGTTCAAGATGAATTGGATTT
GATCAACTCGTTGGGTTTATTGTATGAATTCAATGTATCCATGCTACCCT
TACAAGTTCGCCTTTGCGCTGATAAATTGGAAATTATCGATCTTTGTTTG
AAGGAGAAGAAGAATGGGTACAAGAAAAAAGACAAGCTCATCCAATTGAG
TAATCTTTTGCAAATCTGTGGCCATGACAACAAAGAACGGATTGGACAAG
TCAATATTAAAATTGCTGAATCAGCATTTGAACATAAAGATTACACATAC
GCTGGTATCGTTTGTGTACAATTGGTGGATGATAATTATTCTAATGCTTG
GTATATTTGCAGGAAACTTGGTGAATGTGCTAAATATACCAACTTCACAA
TCAGGCAAAAGTTGTTGAGTTTTGCGTTAACTTATTGTCCAGTACATCAC
ATTGAAGAAGTTTTACAAGAGAAAACTCAACTGGAAACCCAGGTTTTGTA
CGAGAGGTTGGGTGTATTTACGAAAGAAGGCAAGAAAGACAAAATTGTGA
CCTCATCTAAGAAAGAAACTGAGGAAGAAAACGACGAAGACAATGTTGAT
GGGAATAACATATCAATCCTCAACAAGACCAAAACTACAACAAAGAAATT
GATTTCAAGCGTCGCCAGCGTGGCTGATAACCGCTGGGTTGGATCCGCAA
TGAATTGGGTCAAACCGTCGTCGGAAGGGTCTGGTAACGAAGTTGATGTT
GTTGAGCGGGAAATTGAAAGCGTTCGGCATAACCCATTTTATAGTTCGCT
GGATTCGAAAAAGATTGACGAAGATGTTCAAAGATTTAATTATAACGAGT
TCAGCGACCATTTGAGGTGCGTCACAACCGAAGAAAAAGTATTCAATCAG
CTGGTGTTAAGAAGTCAAAAATTGAACGAGCAAAGAACCCTGGGTAAAGA
GCTCGAAAACACTGACCAAGCAATGCTATCGTTGAGTGATATAGCTTATA
CTGAAGAAAGTTGTTTGTGTCTGGCTTACATGATGGCTATTTCTCAGCCA
AAAGAAATCCATTCCCTATCGACCAAGCATCGGAAAAACACTTTCACTTT
CCTTTTCACTGCTTATTACTATGCATTACAAGAATAtgttaaaaacaaca
aaatcgAATTCGATAAACAAGCACAGATTTACAGCGCGCCTCCGATTGAT
GTGATTACATGGATGCTAAAAGTGTTAGGTAAGAAGCAAGgagaaaagga
agaaaaagaaaaaggagagACTTACTTTCTGTCTAACATGAACAAGTTGC
AAGACTTGATGCAAGCAAAGATGCTACAAGCTCTTGACAAAGgaGTGGAC
ATCGAAAGATTTTCAGTTGATAATGAATATAAACGTGAAACTATACTCGG
ATTAGCTATGAGTGTCGAAGACGAGTTGATTAACACAAGTTTGCTGCTAG
CAGAGAAATATGATATCCCCGCATGGGAAGTGTTGTTATCACACGTGGAA
TTTTTATTCACTGATAGTGGTCTAAAAGCCAAAGCTATCCGCGAATCACT
AAACAAATGGAAAGTTGATTCCCATTTGAAACCGAACGGTGATAAAGTCT
TTGAGCGGATGAAGAAATATGTTTACCCAGAAATCAATGGTAAAGACCAC
AATGCATTGCTGTTGTTCTACGTTTTCCTAATGAATTGCAGCTCGCCCAC
TAAAATATTGGAGGGTACGCTTACATTAGATGCTCATTCcaaacttttga
agaaaatcaaGGCTGCTGCATCATCCATCAATTACAAACTTCTCGTGCAT
GGAGATTCACCTTTGGAGGTGATTAGAGACTGTGTTGATGATAACAATGT
ACATTTGTTGGCTAAAATTGCATCCAAAATCCCCCAGGCGGATGGTAGTT
ACCTGTCATCAAACAAGATCTTCTTAGCAAACGCCATTCGGatgttttgg
aagaaaaaagaGAACAAGGATTGGTTGAATACATTCGAAAACTGTAAACA
ACACTTCACCAAACTCCTGATAGAAGACGTTGTCACTTTTGCTGACCATG
CAATTTTTGGCGAGGAAGCTTTAGACTCGCTGACCCAAGACACCAGACTG
GAGATTGGTAAAAGAGtaataaaatatttgagacaacaACGTGGTCAAGA
CGAGACCAAACAAAGAGGAGCTGACGATTATGATTCGCTTATGGAGCGCT
ACGATTCATCTATCAATGATTTGGAACTTTCCATCGAACATCTCAAAACG
CTGACTGATCCAATTTTCAAAGCAGTCTTTGGTGACGATAACGAACTGAG
CAAAACCTTTGGACGAGTATACGACTTATCACGTGGTCGAAAACAACCAC
TCGAAAAACTATTCCGTGATTTGTTCATATCGNTACAACCATTAGACAAA
ATTTCGAAACTGCGGAGTCTTTGTCGCAATGCATCTATTGACGTCCGCAC
GTGTTTCCAAGATGCTTTGCGCGGGATCCTGAGTGACATCCAAAGCGATA
GAGATTACACAAAACTACAGACTTTAACGGAGAACATCAAAGCGCATCAA
GAACATCAAACAGACCCTCTTGTTACCCATAGCGACGTCTTAGATGTGGT
GCGGCCATTTTGTTCTGATGTTACAGCTAGCACGGATGTGAAGAGTCACG
TGTTACATNTTTTGTTCTGAatggaaGAAAATGAGCAAATATTGTATGAT
TTGATTGTTCACGAAGAATGGAAACAAGAACCACAGTTGTTGGACCAAGT
TGAAAGTTATTTTTGGCAATATCGTGGTTCACTTCTAAAGAAGCTATGGA
AAGTTTCACAAAGTTCTGCAATTTATATGTGGGACAACTTGAAGACACAA
TTCAGATATCAAGCTACCTTTGGTTGCCCACCATTGAATTTTATCAATCT
GATGAACAATTGCTTGCCATGGCTTATGGCTTTGTCACCGGATGGAAATT
TTATTGCCATCCTTCAAGATTCTGTTATTGAAATAAGGACTGCTGGAAAT
TTTGAGCAAGTCATTACAAAATATAAGATTGAAAAAGATATGTTTCCAAG
ATGGCGTAAATTGATTTGGAATCATGACAACACCTTACTTTGTTATTCAA
ACAGTTTTGGAGATTTGACCATTTTGGATATTACCGGCactaaaaaacat
tttattccaTCATCAAATAATGTCAAGTTAAAAGTGCCTGGAACGCTGAG
TTTGGCATTGTGTCATGTTGAATTTGTAGCCAAAGGAAATagCTTCTTGT
TATATACCTGCACCTATCAAGGATTTTTTACAGTTTATGAAGTGAATGAA
TCCTCCTGCACAATAAAATGGGACTACTCTTTCATAACATTCCATCCATA
TGGATTAGCTGGTTTGGTTATTGATCATAAAAATGGGTTATTGGTTGCAG
CTGGGAATTATGGGAAGGAACCATTTCCTAATGTCATGGGAGATGCATGT
TATGGATCATATTCTGGTATCAGTCTCTGGAGATTTTTGAATGACACACC
TCATCTAACTCTGGTTGAAGACCAGGGAAAAGCTTTGAAGAAGGTATCCA
GAGGTGAATGGTTAAAGAGTGTTGTTTTAAGACGTGGCGATGAAAAAAAC
GAAATGTTGAAGCATGGTATTTACAAGTTGAAATTGTCAGAAGATGGTAC
ACAAATTGTCACACTGCATCTTGATGGTCGCATATCTTTTTGGAGTATCC
CGTCAATGAGGCTAATCAAAACTTGGAGTAAATCTGAACAACCTGATGCA
AGTGGCGGCTCAAGTGAAGGGTTCTCCTTTGACTCGCAGAAAAAAGAAGa
TCTCACCAAAACAAGGAATTCAATAGATGTCAGCTGGTGGTCTGAAAAGG
AGATTGCTTTGGCATCTGGGAGGGGTGATGTAACGATTGCTTCGACTGAC
AGCTTGAAGAATTTACTTGGAGAGTCGAGTGAGAAATTTGATCCATGGCC
GTCACTCAGCCAAGTGGTGGATGGAAGCATTCTTGTGCTCGAGTGTGAGA
AACGAGTGAACGATCCAAACAACAAAACGAAGACATCTTGGAAATGGACT
TCAGAAGAAGATGAAAGCCAAGATGAAGTGAACTCGATTCGTTATCGATT
CAAAGAACTCACTAAACAGATGTTATATTTCATCACTGAGGCTGAAAGGT
TTTTACCAGCTGTCAAGCCTCCAAGAATTTTAACCAACGTTTATCGTTTA
CTATGCTTGAAATCTACAACACCCGAAGAATTATACACGCGGAAAATCAA
TCTTGAACATTACGGAGAGGCCTTGGACCTAGCTAAACGTTTTGGTTTGA
ATACTGATTTAGTTTATCAGCGACAGTGGAAAAAGAAAAGAGTTTCGAAG
ATTACCATTCATGATTATCtgtcCAAGATTAAAGATCGATATTGGGTTTT
GGACGAGTGCCTTTTACGAGTTGCCGATGACTTTGACTCGACAGAAGAGT
TACTGAAATACGGTTTACTCGGTACAAGTTGGGAAATCTTGCAAAGGATT
GATGAAGAGGGTAAAGGTGatgcaaaggatgatgggaAGTTATTACCTTT
TAAATTTGACGCCGCCCCACATGACGAGGATGACGAAAACTCAAGTAGAG
AATTCCAAgggagTCTAACGAAGAAGCAATTGAAAATCTGCCAATATCGA
CGGCAATTATTACATTATCTTGATCGGCTTTCCACTTATGAGGTTGTTTT
GGGAGGCTCATTCAAAGCACGAGATAAATTCTCAAAAGAGTATTTTACCA
AATTTCGATCGTGCAATATGGTACACCAAGCGGTCGAGTGTGCCCGCGAC
GAGGACGCTTATACTCTGGAGCATTTGTTTTCGTACCATGGGAAGCAGTT
ACTACCTTATTGGCTGCCGATATTATCAAACTTCCCGGAAACAACCGATA
TCCGATATTTTGAGCCGGTCATCCCTGAGATTGGAGAGCCACCAGAAGAT
CCAGAGATTTTACCTTGGTTAGAGAAACACCATCGTGAAGAGGATTGGGT
CGAGCAATCGAATATTGTCCAACAAATCAAGTCTAATGAAGAAGGTGACG
CAAACGAAGATATAGGCTCATTCATTTTCGAATCCGATCCAGAGATacga
aaattttacaaatgtGAAACAAAAGCTCAACTGAGAGAATGGTTTTTACA
TCGTGTACACTTGATTGATGAATATTCCGGTCAGATTGATAAATGTTGCG
AGCTGTTAGATGTGGGAATCAAAAGAGGCTTGGAAGGGCTCACTAAGGTT
CACCAAGAAATGGAAGCATGGAGACTCTTAGTTTACGACGTTGGAATTGA
CAGTAAAATGACTGCAAAGAGTTTCGTGGAATTATCTGAATCATCGAAAA
TCAAATTGCTAATGTTCAAAACCTCAGATGTGACATTCGTTAACGATTTC
AAGCTATATCTAATGCCGTATTTAAGAAATATTGGAAAGAAGGATTTTAA
GAAACGCCAAGATTTACTTCATGAGTTTTTGGTGGAAATCGCTAAAACTG
ATTTGACATGCTGCTTGAAGTTATTGGAAAAGTGTTCGCCAGAGCTGCCA
GAACCACTGCTTCCTGATATGGCGGAGATAATGAAGATTGGGATTGATTG
CGTTTACGCGTGCAAGAGAACGGATCAATTGAATCATTGTTTCAGCATTG
TCGAATGTTTGCCTTCGAGAGAAGAGGGAGTCATTAGCCGTCCCGTGGAA
GAGCTTCACATACAACTGGATCAATTGGAACATTTGCTGACAGGAGCGGA
AATTTTACAGTATTACAACAACCCTCAGACCATCTCTTACATTTCTGAAA
TTAAAGATGACTCTACTATTTGTAAACAACTCATTCAGCAATTGGTGAAA
AACGCTGTTTGTAAAGGACGTTGTGTTCCAAAGGAATTGAACAAATTACT
CGGACATTTGATCAAGCTTTCCAAAGAAGTTTTCCGGTGCTGTGATATCA
AGATCGTTCACCAGATTTTCGTTGAAGAATTACTACGGTCCGGTTCACGT
GAGAACATAACAGTAGCTGAAGAGTTGATCACGCCTTCCAAACTTGCCGG
GAATTCACCTCAAAGTAAGAAACCAGAACAACATTTGACGTCTGCACTCT
ACCTCCTCAAATATGATGTTTCGGTTACCGTTGTGTTGGAAGCGAGTCGT
GAATATTTCAATGCAGCAATGTCGGGTAATGACTCTTCAATGGAACTGGC
TAGATTGTGTCTAACATTGGTCAAAGATTGTCCAGAGAGTGTTCAAGATG
AATTGGATTTGATCAACTCGTTGGGTTTATTGTATGAATTCAATGTATCC
ATGCTACCCTTACAAGTTCGCCTTTGCGCTGATAAATTGGAAATTATCGA
TCTTTGTTTGAAGGAGAAGAAGAATGGGTACAAGAAAAAAGACAAGCTCA
TCCAATTGAGTAATCTTTTGCAAATCTGTGGCCATGACAACAAAGAACGG
ATTGGACAAGTCAATATTAAAATTGCTGAATCAGCATTTGAACATAAAGA
TTACACATACGCTGGTATCGTTTGTGTACAATTGGTGGATGATAATTATT
CTAATGCTTGGTATATTTGCAGGAAACTTGGTGAATGTGCTAAATATACC
AACTTCACAATCAGGCAAAAGTTGTTGAGTTTTGCGTTAACTTATTGTCC
AGTACATCACATTGAAGAAGTTTTACAAGAGAAAACTCAACTGGAAACCC
AGGTTTTGTACGAGAGGTTGGGTGTATTTACGAAAGAAGGCAAGAAAGAC
AAAATTGTGACCTCATCTAAGAAAGAAACTGAGGAAGAAAACGACGAAGA
CAATGTTGATGGGAATAACATATCAATCCTCAACAAGACCAAAACTACAA
CAAAGAAATTGATTTCAAGCGTCGCCAGCGTGGCTGATAACCGCTGGGTT
GGATCCGCAATGAATTGGGTCAAACCGTCGTCGGAAGGGTCTGGTAACGA
AGTTGATGTTGTTGAGCGGGAAATTGAAAGCGTTCGGCATAACCCATTTT
ATAGTTCGCTGGATTCGAAAAAGATTGACGAAGATGTTCAAAGATTTAAT
TATAACGAGTTCAGCGACCATTTGAGGTGCGTCACAACCGAAGAAAAAGT
ATTCAATCAGCTGGTGTTAAGAAGTCAAAAATTGAACGAGCAAAGAACCC
TGGGTAAAGAGCTCGAAAACACTGACCAAGCAATGCTATCGTTGAGTGAT
ATAGCTTATACTGAAGAAAGTTGTTTGTGTCTGGCTTACATGATGGCTAT
TTCTCAGCCAAAAGAAATCCATTCCCTATCGACCAAGCATCGGAAAAACA
CTTTCACTTTCCTTTTCACTGCTTATTACTATGCATTACAAGAATAtgtt
aaaaacaacaaaatcgAATTCGATAAACAAGCACAGATTTACAGCGCGCC
TCCGATTGATGTGATTACATGGATGCTAAAAGTGTTAGGTAAGAAGCAAG
gagaaaaggaagaaaaagaaaaaggagagACTTACTTTCTGTCTAACATG
AACAAGTTGCAAGACTTGATGCAAGCAAAGATGCTACAAGCTCTTGACAA
AGgaGTGGACATCGAAAGATTTTCAGTTGATAATGAATATAAACGTGAAA
CTATACTCGGATTAGCTATGAGTGTCGAAGACGAGTTGATTAACACAAGT
TTGCTGCTAGCAGAGAAATATGATATCCCCGCATGGGAAGTGTTGTTATC
ACACGTGGAATTTTTATTCACTGATAGTGGTCTAAAAGCCAAAGCTATCC
GCGAATCACTAAACAAATGGAAAGTTGATTCCCATTTGAAACCGAACGGT
GATAAAGTCTTTGAGCGGATGAAGAAATATGTTTACCCAGAAATCAATGG
TAAAGACCACAATGCATTGCTGTTGTTCTACGTTTTCCTAATGAATTGCA
GCTCGCCCACTAAAATATTGGAGGGTACGCTTACATTAGATGCTCATTCc
aaacttttgaagaaaatcaaGGCTGCTGCATCATCCATCAATTACAAACT
TCTCGTGCATGGAGATTCACCTTTGGAGGTGATTAGAGACTGTGTTGATG
ATAACAATGTACATTTGTTGGCTAAAATTGCATCCAAAATCCCCCAGGCG
GATGGTAGTTACCTGTCATCAAACAAGATCTTCTTAGCAAACGCCATTCG
GatgttttggaagaaaaaagaGAACAAGGATTGGTTGAATACATTCGAAA
ACTGTAAACAACACTTCACCAAACTCCTGATAGAAGACGTTGTCACTTTT
GCTGACCATGCAATTTTTGGCGAGGAAGCTTTAGACTCGCTGACCCAAGA
CACCAGACTGGAGATTGGTAAAAGAGtaataaaatatttgagacaacaAC
GTGGTCAAGACGAGACCAAACAAAGAGGAGCTGACGATTATGATTCGCTT
ATGGAGCGCTACGATTCATCTATCAATGATTTGGAACTTTCCATCGAACA
TCTCAAAACGCTGACTGATCCAATTTTCAAAGCAGTCTTTGGTGACGATA
ACGAACTGAGCAAAACCTTTGGACGAGTATACGACTTATCACGTGGTCGA
AAACAACCACTCGAAAAACTATTCCGTGATTTGTTCATATCGNTACAACC
ATTAGACAAAATTTCGAAACTGCGGAGTCTTTGTCGCAATGCATCTATTG
ACGTCCGCACGTGTTTCCAAGATGCTTTGCGCGGGATCCTGAGTGACATC
CAAAGCGATAGAGATTACACAAAACTACAGACTTTAACGGAGAACATCAA
AGCGCATCAAGAACATCAAACAGACCCTCTTGTTACCCATAGCGACGTCT
TAGATGTGGTGCGGCCATTTTGTTCTGATGTTACAGCTAGCACGGATGTG
AAGAGTCACGTGTTACATNTTTTGTTCTGAatggaaGAAAATGAGCAAAT
ATTGTATGATTTGATTGTTCACGAAGAATGGAAACAAGAACCACAGTTGT
TGGACCAAGTTGAAAGTTATTTTTGGCAATATCGTGGTTCACTTCTAAAG
AAGCTATGGAAAGTTTCACAAAGTTCTGCAATTTATATGTGGGACAACTT
GAAGACACAATTCAGATATCAAGCTACCTTTGGTTGCCCACCATTGAATT
TTATCAATCTGATGAACAATTGCTTGCCATGGCTTATGGCTTTGTCACCG
GATGGAAATTTTATTGCCATCCTTCAAGATTCTGTTATTGAAATAAGGAC
TGCTGGAAATTTTGAGCAAGTCATTACAAAATATAAGATTGAAAAAGATA
TGTTTCCAAGATGGCGTAAATTGATTTGGAATCATGACAACACCTTACTT
TGTTATTCAAACAGTTTTGGAGATTTGACCATTTTGGATATTACCGGCac
taaaaaacattttattccaTCATCAAATAATGTCAAGTTAAAAGTGCCTG
GAACGCTGAGTTTGGCATTGTGTCATGTTGAATTTGTAGCCAAAGGAAAT
agCTTCTTGTTATATACCTGCACCTATCAAGGATTTTTTACAGTTTATGA
AGTGAATGAATCCTCCTGCACAATAAAATGGGACTACTCTTTCATAACAT
TCCATCCATATGGATTAGCTGGTTTGGTTATTGATCATAAAAATGGGTTA
TTGGTTGCAGCTGGGAATTATGGGAAGGAACCATTTCCTAATGTCATGGG
AGATGCATGTTATGGATCATATTCTGGTATCAGTCTCTGGAGATTTTTGA
ATGACACACCTCATCTAACTCTGGTTGAAGACCAGGGAAAAGCTTTGAAG
AAGGTATCCAGAGGTGAATGGTTAAAGAGTGTTGTTTTAAGACGTGGCGA
TGAAAAAAACGAAATGTTGAAGCATGGTATTTACAAGTTGAAATTGTCAG
AAGATGGTACACAAATTGTCACACTGCATCTTGATGGTCGCATATCTTTT
TGGAGTATCCCGTCAATGAGGCTAATCAAAACTTGGAGTAAATCTGAACA
ACCTGATGCAAGTGGCGGCTCAAGTGAAGGGTTCTCCTTTGACTCGCAGA
AAAAAGAAGaTCTCACCAAAACAAGGAATTCAATAGATGTCAGCTGGTGG
TCTGAAAAGGAGATTGCTTTGGCATCTGGGAGGGGTGATGTAACGATTGC
TTCGACTGACAGCTTGAAGAATTTACTTGGAGAGTCGAGTGAGAAATTTG
ATCCATGGCCGTCACTCAGCCAAGTGGTGGATGGAAGCATTCTTGTGCTC
GAGTGTGAGAAACGAGTGAACGATCCAAACAACAAAACGAAGACATCTTG
GAAATGGACTTCAGAAGAAGATGAAAGCCAAGATGAAGTGAACTCGATTC
GTTATCGATTCAAAGAACTCACTAAACAGATGTTATATTTCATCACTGAG
GCTGAAAGGTTTTTACCAGCTGTCAAGCCTCCAAGAATTTTAACCAACGT
TTATCGTTTACTATGCTTGAAATCTACAACACCCGAAGAATTATACACGC
GGAAAATCAATCTTGAACATTACGGAGAGGCCTTGGACCTAGCTAAACGT
TTTGGTTTGAATACTGATTTAGTTTATCAGCGACAGTGGAAAAAGAAAAG
AGTTTCGAAGATTACCATTCATGATTATCtgtcCAAGATTAAAGATCGAT
ATTGGGTTTTGGACGAGTGCCTTTTACGAGTTGCCGATGACTTTGACTCG
ACAGAAGAGTTACTGAAATACGGTTTACTCGGTACAAGTTGGGAAATCTT
GCAAAGGATTGATGAAGAGGGTAAAGGTGatgcaaaggatgatgggaAGT
TATTACCTTTTAAATTTGACGCCGCCCCACATGACGAGGATGACGAAAAC
TCAAGTAGAGAATTCCAAgggagTCTAACGAAGAAGCAATTGAAAATCTG
CCAATATCGACGGCAATTATTACATTATCTTGATCGGCTTTCCACTTATG
AGGTTGTTTTGGGAGGCTCATTCAAAGCACGAGATAAATTCTCAAAAGAG
TATTTTACCAAATTTCGATCGTGCAATATGGTACACCAAGCGGTCGAGTG
TGCCCGCGACGAGGACGCTTATACTCTGGAGCATTTGTTTTCGTACCATG
GGAAGCAGTTACTACCTTATTGGCTGCCGATATTATCAAACTTCCCGGAA
ACAACCGATATCCGATATTTTGAGCCGGTCATCCCTGAGATTGGAGAGCC
ACCAGAAGATCCAGAGATTTTACCTTGGTTAGAGAAACACCATCGTGAAG
AGGATTGGGTCGAGCAATCGAATATTGTCCAACAAATCAAGTCTAATGAA
GAAGGTGACGCAAACGAAGATATAGGCTCATTCATTTTCGAATCCGATCC
AGAGATacgaaaattttacaaatgtGAAACAAAAGCTCAACTGAGAGAAT
GGTTTTTACATCGTGTACACTTGATTGATGAATATTCCGGTCAGATTGAT
AAATGTTGCGAGCTGTTAGATGTGGGAATCAAAAGAGGCTTGGAAGGGCT
CACTAAGGTTCACCAAGAAATGGAAGCATGGAGACTCTTAGTTTACGACG
TTGGAATTGACAGTAAAATGACTGCAAAGAGTTTCGTGGAATTATCTGAA
TCATCGAAAATCAAATTGCTAATGTTCAAAACCTCAGATGTGACATTCGT
TAACGATTTCAAGCTATATCTAATGCCGTATTTAAGAAATATTGGAAAGA
AGGATTTTAAGAAACGCCAAGATTTACTTCATGAGTTTTTGGTGGAAATC
GCTAAAACTGATTTGACATGCTGCTTGAAGTTATTGGAAAAGTGTTCGCC
AGAGCTGCCAGAACCACTGCTTCCTGATATGGCGGAGATAATGAAGATTG
GGATTGATTGCGTTTACGCGTGCAAGAGAACGGATCAATTGAATCATTGT
TTCAGCATTGTCGAATGTTTGCCTTCGAGAGAAGAGGGAGTCATTAGCCG
TCCCGTGGAAGAGCTTCACATACAACTGGATCAATTGGAACATTTGCTGA
CAGGAGCGGAAATTTTACAGTATTACAACAACCCTCAGACCATCTCTTAC
ATTTCTGAAATTAAAGATGACTCTACTATTTGTAAACAACTCATTCAGCA
ATTGGTGAAAAACGCTGTTTGTAAAGGACGTTGTGTTCCAAAGGAATTGA
ACAAATTACTCGGACATTTGATCAAGCTTTCCAAAGAAGTTTTCCGGTGC
TGTGATATCAAGATCGTTCACCAGATTTTCGTTGAAGAATTACTACGGTC
CGGTTCACGTGAGAACATAACAGTAGCTGAAGAGTTGATCACGCCTTCCA
AACTTGCCGGGAATTCACCTCAAAGTAAGAAACCAGAACAACATTTGACG
TCTGCACTCTACCTCCTCAAATATGATGTTTCGGTTACCGTTGTGTTGGA
AGCGAGTCGTGAATATTTCAATGCAGCAATGTCGGGTAATGACTCTTCAA
TGGAACTGGCTAGATTGTGTCTAACATTGGTCAAAGATTGTCCAGAGAGT
GTTCAAGATGAATTGGATTTGATCAACTCGTTGGGTTTATTGTATGAATT
CAATGTATCCATGCTACCCTTACAAGTTCGCCTTTGCGCTGATAAATTGG
AAATTATCGATCTTTGTTTGAAGGAGAAGAAGAATGGGTACAAGAAAAAA
GACAAGCTCATCCAATTGAGTAATCTTTTGCAAATCTGTGGCCATGACAA
CAAAGAACGGATTGGACAAGTCAATATTAAAATTGCTGAATCAGCATTTG
AACATAAAGATTACACATACGCTGGTATCGTTTGTGTACAATTGGTGGAT
GATAATTATTCTAATGCTTGGTATATTTGCAGGAAACTTGGTGAATGTGC
TAAATATACCAACTTCACAATCAGGCAAAAGTTGTTGAGTTTTGCGTTAA
CTTATTGTCCAGTACATCACATTGAAGAAGTTTTACAAGAGAAAACTCAA
CTGGAAACCCAGGTTTTGTACGAGAGGTTGGGTGTATTTACGAAAGAAGG
CAAGAAAGACAAAATTGTGACCTCATCTAAGAAAGAAACTGAGGAAGAAA
ACGACGAAGACAATGTTGATGGGAATAACATATCAATCCTCAACAAGACC
AAAACTACAACAAAGAAATTGATTTCAAGCGTCGCCAGCGTGGCTGATAA
CCGCTGGGTTGGATCCGCAATGAATTGGGTCAAACCGTCGTCGGAAGGGT
CTGGTAACGAAGTTGATGTTGTTGAGCGGGAAATTGAAAGCGTTCGGCAT
AACCCATTTTATAGTTCGCTGGATTCGAAAAAGATTGACGAAGATGTTCA
AAGATTTAATTATAACGAGTTCAGCGACCATTTGAGGTGCGTCACAACCG
AAGAAAAAGTATTCAATCAGCTGGTGTTAAGAAGTCAAAAATTGAACGAG
CAAAGAACCCTGGGTAAAGAGCTCGAAAACACTGACCAAGCAATGCTATC
GTTGAGTGATATAGCTTATACTGAAGAAAGTTGTTTGTGTCTGGCTTACA
TGATGGCTATTTCTCAGCCAAAAGAAATCCATTCCCTATCGACCAAGCAT
CGGAAAAACACTTTCACTTTCCTTTTCACTGCTTATTACTATGCATTACA
AGAATAtgttaaaaacaacaaaatcgAATTCGATAAACAAGCACAGATTT
ACAGCGCGCCTCCGATTGATGTGATTACATGGATGCTAAAAGTGTTAGGT
AAGAAGCAAGgagaaaaggaagaaaaagaaaaaggagagACTTACTTTCT
GTCTAACATGAACAAGTTGCAAGACTTGATGCAAGCAAAGATGCTACAAG
CTCTTGACAAAGgaGTGGACATCGAAAGATTTTCAGTTGATAATGAATAT
AAACGTGAAACTATACTCGGATTAGCTATGAGTGTCGAAGACGAGTTGAT
TAACACAAGTTTGCTGCTAGCAGAGAAATATGATATCCCCGCATGGGAAG
TGTTGTTATCACACGTGGAATTTTTATTCACTGATAGTGGTCTAAAAGCC
AAAGCTATCCGCGAATCACTAAACAAATGGAAAGTTGATTCCCATTTGAA
ACCGAACGGTGATAAAGTCTTTGAGCGGATGAAGAAATATGTTTACCCAG
AAATCAATGGTAAAGACCACAATGCATTGCTGTTGTTCTACGTTTTCCTA
ATGAATTGCAGCTCGCCCACTAAAATATTGGAGGGTACGCTTACATTAGA
TGCTCATTCcaaacttttgaagaaaatcaaGGCTGCTGCATCATCCATCA
ATTACAAACTTCTCGTGCATGGAGATTCACCTTTGGAGGTGATTAGAGAC
TGTGTTGATGATAACAATGTACATTTGTTGGCTAAAATTGCATCCAAAAT
CCCCCAGGCGGATGGTAGTTACCTGTCATCAAACAAGATCTTCTTAGCAA
ACGCCATTCGGatgttttggaagaaaaaagaGAACAAGGATTGGTTGAAT
ACATTCGAAAACTGTAAACAACACTTCACCAAACTCCTGATAGAAGACGT
TGTCACTTTTGCTGACCATGCAATTTTTGGCGAGGAAGCTTTAGACTCGC
TGACCCAAGACACCAGACTGGAGATTGGTAAAAGAGtaataaaatatttg
agacaacaACGTGGTCAAGACGAGACCAAACAAAGAGGAGCTGACGATTA
TGATTCGCTTATGGAGCGCTACGATTCATCTATCAATGATTTGGAACTTT
CCATCGAACATCTCAAAACGCTGACTGATCCAATTTTCAAAGCAGTCTTT
GGTGACGATAACGAACTGAGCAAAACCTTTGGACGAGTATACGACTTATC
ACGTGGTCGAAAACAACCACTCGAAAAACTATTCCGTGATTTGTTCATAT
CGNTACAACCATTAGACAAAATTTCGAAACTGCGGAGTCTTTGTCGCAAT
GCATCTATTGACGTCCGCACGTGTTTCCAAGATGCTTTGCGCGGGATCCT
GAGTGACATCCAAAGCGATAGAGATTACACAAAACTACAGACTTTAACGG
AGAACATCAAAGCGCATCAAGAACATCAAACAGACCCTCTTGTTACCCAT
AGCGACGTCTTAGATGTGGTGCGGCCATTTTGTTCTGATGTTACAGCTAG
CACGGATGTGAAGAGTCACGTGTTACATNTTTTGTTCTGAatggaaGAAA
ATGAGCAAATATTGTATGATTTGATTGTTCACGAAGAATGGAAACAAGAA
CCACAGTTGTTGGACCAAGTTGAAAGTTATTTTTGGCAATATCGTGGTTC
ACTTCTAAAGAAGCTATGGAAAGTTTCACAAAGTTCTGCAATTTATATGT
GGGACAACTTGAAGACACAATTCAGATATCAAGCTACCTTTGGTTGCCCA
CCATTGAATTTTATCAATCTGATGAACAATTGCTTGCCATGGCTTATGGC
TTTGTCACCGGATGGAAATTTTATTGCCATCCTTCAAGATTCTGTTATTG
AAATAAGGACTGCTGGAAATTTTGAGCAAGTCATTACAAAATATAAGATT
GAAAAAGATATGTTTCCAAGATGGCGTAAATTGATTTGGAATCATGACAA
CACCTTACTTTGTTATTCAAACAGTTTTGGAGATTTGACCATTTTGGATA
TTACCGGCactaaaaaacattttattccaTCATCAAATAATGTCAAGTTA
AAAGTGCCTGGAACGCTGAGTTTGGCATTGTGTCATGTTGAATTTGTAGC
CAAAGGAAATagCTTCTTGTTATATACCTGCACCTATCAAGGATTTTTTA
CAGTTTATGAAGTGAATGAATCCTCCTGCACAATAAAATGGGACTACTCT
TTCATAACATTCCATCCATATGGATTAGCTGGTTTGGTTATTGATCATAA
AAATGGGTTATTGGTTGCAGCTGGGAATTATGGGAAGGAACCATTTCCTA
ATGTCATGGGAGATGCATGTTATGGATCATATTCTGGTATCAGTCTCTGG
AGATTTTTGAATGACACACCTCATCTAACTCTGGTTGAAGACCAGGGAAA
AGCTTTGAAGAAGGTATCCAGAGGTGAATGGTTAAAGAGTGTTGTTTTAA
GACGTGGCGATGAAAAAAACGAAATGTTGAAGCATGGTATTTACAAGTTG
AAATTGTCAGAAGATGGTACACAAATTGTCACACTGCATCTTGATGGTCG
CATATCTTTTTGGAGTATCCCGTCAATGAGGCTAATCAAAACTTGGAGTA
AATCTGAACAACCTGATGCAAGTGGCGGCTCAAGTGAAGGGTTCTCCTTT
GACTCGCAGAAAAAAGAAGaTCTCACCAAAACAAGGAATTCAATAGATGT
CAGCTGGTGGTCTGAAAAGGAGATTGCTTTGGCATCTGGGAGGGGTGATG
TAACGATTGCTTCGACTGACAGCTTGAAGAATTTACTTGGAGAGTCGAGT
GAGAAATTTGATCCATGGCCGTCACTCAGCCAAGTGGTGGATGGAAGCAT
TCTTGTGCTCGAGTGTGAGAAACGAGTGAACGATCCAAACAACAAAACGA
AGACATCTTGGAAATGGACTTCAGAAGAAGATGAAAGCCAAGATGAAGTG
AACTCGATTCGTTATCGATTCAAAGAACTCACTAAACAGATGTTATATTT
CATCACTGAGGCTGAAAGGTTTTTACCAGCTGTCAAGCCTCCAAGAATTT
TAACCAACGTTTATCGTTTACTATGCTTGAAATCTACAACACCCGAAGAA
TTATACACGCGGAAAATCAATCTTGAACATTACGGAGAGGCCTTGGACCT
AGCTAAACGTTTTGGTTTGAATACTGATTTAGTTTATCAGCGACAGTGGA
AAAAGAAAAGAGTTTCGAAGATTACCATTCATGATTATCtgtcCAAGATT
AAAGATCGATATTGGGTTTTGGACGAGTGCCTTTTACGAGTTGCCGATGA
CTTTGACTCGACAGAAGAGTTACTGAAATACGGTTTACTCGGTACAAGTT
GGGAAATCTTGCAAAGGATTGATGAAGAGGGTAAAGGTGatgcaaaggat
gatgggaAGTTATTACCTTTTAAATTTGACGCCGCCCCACATGACGAGGA
TGACGAAAACTCAAGTAGAGAATTCCAAgggagTCTAACGAAGAAGCAAT
TGAAAATCTGCCAATATCGACGGCAATTATTACATTATCTTGATCGGCTT
TCCACTTATGAGGTTGTTTTGGGAGGCTCATTCAAAGCACGAGATAAATT
CTCAAAAGAGTATTTTACCAAATTTCGATCGTGCAATATGGTACACCAAG
CGGTCGAGTGTGCCCGCGACGAGGACGCTTATACTCTGGAGCATTTGTTT
TCGTACCATGGGAAGCAGTTACTACCTTATTGGCTGCCGATATTATCAAA
CTTCCCGGAAACAACCGATATCCGATATTTTGAGCCGGTCATCCCTGAGA
TTGGAGAGCCACCAGAAGATCCAGAGATTTTACCTTGGTTAGAGAAACAC
CATCGTGAAGAGGATTGGGTCGAGCAATCGAATATTGTCCAACAAATCAA
GTCTAATGAAGAAGGTGACGCAAACGAAGATATAGGCTCATTCATTTTCG
AATCCGATCCAGAGATacgaaaattttacaaatgtGAAACAAAAGCTCAA
CTGAGAGAATGGTTTTTACATCGTGTACACTTGATTGATGAATATTCCGG
TCAGATTGATAAATGTTGCGAGCTGTTAGATGTGGGAATCAAAAGAGGCT
TGGAAGGGCTCACTAAGGTTCACCAAGAAATGGAAGCATGGAGACTCTTA
GTTTACGACGTTGGAATTGACAGTAAAATGACTGCAAAGAGTTTCGTGGA
ATTATCTGAATCATCGAAAATCAAATTGCTAATGTTCAAAACCTCAGATG
TGACATTCGTTAACGATTTCAAGCTATATCTAATGCCGTATTTAAGAAAT
ATTGGAAAGAAGGATTTTAAGAAACGCCAAGATTTACTTCATGAGTTTTT
GGTGGAAATCGCTAAAACTGATTTGACATGCTGCTTGAAGTTATTGGAAA
AGTGTTCGCCAGAGCTGCCAGAACCACTGCTTCCTGATATGGCGGAGATA
ATGAAGATTGGGATTGATTGCGTTTACGCGTGCAAGAGAACGGATCAATT
GAATCATTGTTTCAGCATTGTCGAATGTTTGCCTTCGAGAGAAGAGGGAG
TCATTAGCCGTCCCGTGGAAGAGCTTCACATACAACTGGATCAATTGGAA
CATTTGCTGACAGGAGCGGAAATTTTACAGTATTACAACAACCCTCAGAC
CATCTCTTACATTTCTGAAATTAAAGATGACTCTACTATTTGTAAACAAC
TCATTCAGCAATTGGTGAAAAACGCTGTTTGTAAAGGACGTTGTGTTCCA
AAGGAATTGAACAAATTACTCGGACATTTGATCAAGCTTTCCAAAGAAGT
TTTCCGGTGCTGTGATATCAAGATCGTTCACCAGATTTTCGTTGAAGAAT
TACTACGGTCCGGTTCACGTGAGAACATAACAGTAGCTGAAGAGTTGATC
ACGCCTTCCAAACTTGCCGGGAATTCACCTCAAAGTAAGAAACCAGAACA
ACATTTGACGTCTGCACTCTACCTCCTCAAATATGATGTTTCGGTTACCG
TTGTGTTGGAAGCGAGTCGTGAATATTTCAATGCAGCAATGTCGGGTAAT
GACTCTTCAATGGAACTGGCTAGATTGTGTCTAACATTGGTCAAAGATTG
TCCAGAGAGTGTTCAAGATGAATTGGATTTGATCAACTCGTTGGGTTTAT
TGTATGAATTCAATGTATCCATGCTACCCTTACAAGTTCGCCTTTGCGCT
GATAAATTGGAAATTATCGATCTTTGTTTGAAGGAGAAGAAGAATGGGTA
CAAGAAAAAAGACAAGCTCATCCAATTGAGTAATCTTTTGCAAATCTGTG
GCCATGACAACAAAGAACGGATTGGACAAGTCAATATTAAAATTGCTGAA
TCAGCATTTGAACATAAAGATTACACATACGCTGGTATCGTTTGTGTACA
ATTGGTGGATGATAATTATTCTAATGCTTGGTATATTTGCAGGAAACTTG
GTGAATGTGCTAAATATACCAACTTCACAATCAGGCAAAAGTTGTTGAGT
TTTGCGTTAACTTATTGTCCAGTACATCACATTGAAGAAGTTTTACAAGA
GAAAACTCAACTGGAAACCCAGGTTTTGTACGAGAGGTTGGGTGTATTTA
CGAAAGAAGGCAAGAAAGACAAAATTGTGACCTCATCTAAGAAAGAAACT
GAGGAAGAAAACGACGAAGACAATGTTGATGGGAATAACATATCAATCCT
CAACAAGACCAAAACTACAACAAAGAAATTGATTTCAAGCGTCGCCAGCG
TGGCTGATAACCGCTGGGTTGGATCCGCAATGAATTGGGTCAAACCGTCG
TCGGAAGGGTCTGGTAACGAAGTTGATGTTGTTGAGCGGGAAATTGAAAG
CGTTCGGCATAACCCATTTTATAGTTCGCTGGATTCGAAAAAGATTGACG
AAGATGTTCAAAGATTTAATTATAACGAGTTCAGCGACCATTTGAGGTGC
GTCACAACCGAAGAAAAAGTATTCAATCAGCTGGTGTTAAGAAGTCAAAA
ATTGAACGAGCAAAGAACCCTGGGTAAAGAGCTCGAAAACACTGACCAAG
CAATGCTATCGTTGAGTGATATAGCTTATACTGAAGAAAGTTGTTTGTGT
CTGGCTTACATGATGGCTATTTCTCAGCCAAAAGAAATCCATTCCCTATC
GACCAAGCATCGGAAAAACACTTTCACTTTCCTTTTCACTGCTTATTACT
ATGCATTACAAGAATAtgttaaaaacaacaaaatcgAATTCGATAAACAA
GCACAGATTTACAGCGCGCCTCCGATTGATGTGATTACATGGATGCTAAA
AGTGTTAGGTAAGAAGCAAGgagaaaaggaagaaaaagaaaaaggagagA
CTTACTTTCTGTCTAACATGAACAAGTTGCAAGACTTGATGCAAGCAAAG
ATGCTACAAGCTCTTGACAAAGgaGTGGACATCGAAAGATTTTCAGTTGA
TAATGAATATAAACGTGAAACTATACTCGGATTAGCTATGAGTGTCGAAG
ACGAGTTGATTAACACAAGTTTGCTGCTAGCAGAGAAATATGATATCCCC
GCATGGGAAGTGTTGTTATCACACGTGGAATTTTTATTCACTGATAGTGG
TCTAAAAGCCAAAGCTATCCGCGAATCACTAAACAAATGGAAAGTTGATT
CCCATTTGAAACCGAACGGTGATAAAGTCTTTGAGCGGATGAAGAAATAT
GTTTACCCAGAAATCAATGGTAAAGACCACAATGCATTGCTGTTGTTCTA
CGTTTTCCTAATGAATTGCAGCTCGCCCACTAAAATATTGGAGGGTACGC
TTACATTAGATGCTCATTCcaaacttttgaagaaaatcaaGGCTGCTGCA
TCATCCATCAATTACAAACTTCTCGTGCATGGAGATTCACCTTTGGAGGT
GATTAGAGACTGTGTTGATGATAACAATGTACATTTGTTGGCTAAAATTG
CATCCAAAATCCCCCAGGCGGATGGTAGTTACCTGTCATCAAACAAGATC
TTCTTAGCAAACGCCATTCGGatgttttggaagaaaaaagaGAACAAGGA
TTGGTTGAATACATTCGAAAACTGTAAACAACACTTCACCAAACTCCTGA
TAGAAGACGTTGTCACTTTTGCTGACCATGCAATTTTTGGCGAGGAAGCT
TTAGACTCGCTGACCCAAGACACCAGACTGGAGATTGGTAAAAGAGtaat
aaaatatttgagacaacaACGTGGTCAAGACGAGACCAAACAAAGAGGAG
CTGACGATTATGATTCGCTTATGGAGCGCTACGATTCATCTATCAATGAT
TTGGAACTTTCCATCGAACATCTCAAAACGCTGACTGATCCAATTTTCAA
AGCAGTCTTTGGTGACGATAACGAACTGAGCAAAACCTTTGGACGAGTAT
ACGACTTATCACGTGGTCGAAAACAACCACTCGAAAAACTATTCCGTGAT
TTGTTCATATCGNTACAACCATTAGACAAAATTTCGAAACTGCGGAGTCT
TTGTCGCAATGCATCTATTGACGTCCGCACGTGTTTCCAAGATGCTTTGC
GCGGGATCCTGAGTGACATCCAAAGCGATAGAGATTACACAAAACTACAG
ACTTTAACGGAGAACATCAAAGCGCATCAAGAACATCAAACAGACCCTCT
TGTTACCCATAGCGACGTCTTAGATGTGGTGCGGCCATTTTGTTCTGATG
TTACAGCTAGCACGGATGTGAAGAGTCACGTGTTACATNTTTTGTTCTGA
atggaaGAAAATGAGCAAATATTGTATGATTTGATTGTTCACGAAGAATG
GAAACAAGAACCACAGTTGTTGGACCAAGTTGAAAGTTATTTTTGGCAAT
ATCGTGGTTCACTTCTAAAGAAGCTATGGAAAGTTTCACAAAGTTCTGCA
ATTTATATGTGGGACAACTTGAAGACACAATTCAGATATCAAGCTACCTT
TGGTTGCCCACCATTGAATTTTATCAATCTGATGAACAATTGCTTGCCAT
GGCTTATGGCTTTGTCACCGGATGGAAATTTTATTGCCATCCTTCAAGAT
TCTGTTATTGAAATAAGGACTGCTGGAAATTTTGAGCAAGTCATTACAAA
ATATAAGATTGAAAAAGATATGTTTCCAAGATGGCGTAAATTGATTTGGA
ATCATGACAACACCTTACTTTGTTATTCAAACAGTTTTGGAGATTTGACC
ATTTTGGATATTACCGGCactaaaaaacattttattccaTCATCAAATAA
TGTCAAGTTAAAAGTGCCTGGAACGCTGAGTTTGGCATTGTGTCATGTTG
AATTTGTAGCCAAAGGAAATagCTTCTTGTTATATACCTGCACCTATCAA
GGATTTTTTACAGTTTATGAAGTGAATGAATCCTCCTGCACAATAAAATG
GGACTACTCTTTCATAACATTCCATCCATATGGATTAGCTGGTTTGGTTA
TTGATCATAAAAATGGGTTATTGGTTGCAGCTGGGAATTATGGGAAGGAA
CCATTTCCTAATGTCATGGGAGATGCATGTTATGGATCATATTCTGGTAT
CAGTCTCTGGAGATTTTTGAATGACACACCTCATCTAACTCTGGTTGAAG
ACCAGGGAAAAGCTTTGAAGAAGGTATCCAGAGGTGAATGGTTAAAGAGT
GTTGTTTTAAGACGTGGCGATGAAAAAAACGAAATGTTGAAGCATGGTAT
TTACAAGTTGAAATTGTCAGAAGATGGTACACAAATTGTCACACTGCATC
TTGATGGTCGCATATCTTTTTGGAGTATCCCGTCAATGAGGCTAATCAAA
ACTTGGAGTAAATCTGAACAACCTGATGCAAGTGGCGGCTCAAGTGAAGG
GTTCTCCTTTGACTCGCAGAAAAAAGAAGaTCTCACCAAAACAAGGAATT
CAATAGATGTCAGCTGGTGGTCTGAAAAGGAGATTGCTTTGGCATCTGGG
AGGGGTGATGTAACGATTGCTTCGACTGACAGCTTGAAGAATTTACTTGG
AGAGTCGAGTGAGAAATTTGATCCATGGCCGTCACTCAGCCAAGTGGTGG
ATGGAAGCATTCTTGTGCTCGAGTGTGAGAAACGAGTGAACGATCCAAAC
AACAAAACGAAGACATCTTGGAAATGGACTTCAGAAGAAGATGAAAGCCA
AGATGAAGTGAACTCGATTCGTTATCGATTCAAAGAACTCACTAAACAGA
TGTTATATTTCATCACTGAGGCTGAAAGGTTTTTACCAGCTGTCAAGCCT
CCAAGAATTTTAACCAACGTTTATCGTTTACTATGCTTGAAATCTACAAC
ACCCGAAGAATTATACACGCGGAAAATCAATCTTGAACATTACGGAGAGG
CCTTGGACCTAGCTAAACGTTTTGGTTTGAATACTGATTTAGTTTATCAG
CGACAGTGGAAAAAGAAAAGAGTTTCGAAGATTACCATTCATGATTATCt
gtcCAAGATTAAAGATCGATATTGGGTTTTGGACGAGTGCCTTTTACGAG
TTGCCGATGACTTTGACTCGACAGAAGAGTTACTGAAATACGGTTTACTC
GGTACAAGTTGGGAAATCTTGCAAAGGATTGATGAAGAGGGTAAAGGTGa
tgcaaaggatgatgggaAGTTATTACCTTTTAAATTTGACGCCGCCCCAC
ATGACGAGGATGACGAAAACTCAAGTAGAGAATTCCAAgggagTCTAACG
AAGAAGCAATTGAAAATCTGCCAATATCGACGGCAATTATTACATTATCT
TGATCGGCTTTCCACTTATGAGGTTGTTTTGGGAGGCTCATTCAAAGCAC
GAGATAAATTCTCAAAAGAGTATTTTACCAAATTTCGATCGTGCAATATG
GTACACCAAGCGGTCGAGTGTGCCCGCGACGAGGACGCTTATACTCTGGA
GCATTTGTTTTCGTACCATGGGAAGCAGTTACTACCTTATTGGCTGCCGA
TATTATCAAACTTCCCGGAAACAACCGATATCCGATATTTTGAGCCGGTC
ATCCCTGAGATTGGAGAGCCACCAGAAGATCCAGAGATTTTACCTTGGTT
AGAGAAACACCATCGTGAAGAGGATTGGGTCGAGCAATCGAATATTGTCC
AACAAATCAAGTCTAATGAAGAAGGTGACGCAAACGAAGATATAGGCTCA
TTCATTTTCGAATCCGATCCAGAGATacgaaaattttacaaatgtGAAAC
AAAAGCTCAACTGAGAGAATGGTTTTTACATCGTGTACACTTGATTGATG
AATATTCCGGTCAGATTGATAAATGTTGCGAGCTGTTAGATGTGGGAATC
AAAAGAGGCTTGGAAGGGCTCACTAAGGTTCACCAAGAAATGGAAGCATG
GAGACTCTTAGTTTACGACGTTGGAATTGACAGTAAAATGACTGCAAAGA
GTTTCGTGGAATTATCTGAATCATCGAAAATCAAATTGCTAATGTTCAAA
ACCTCAGATGTGACATTCGTTAACGATTTCAAGCTATATCTAATGCCGTA
TTTAAGAAATATTGGAAAGAAGGATTTTAAGAAACGCCAAGATTTACTTC
ATGAGTTTTTGGTGGAAATCGCTAAAACTGATTTGACATGCTGCTTGAAG
TTATTGGAAAAGTGTTCGCCAGAGCTGCCAGAACCACTGCTTCCTGATAT
GGCGGAGATAATGAAGATTGGGATTGATTGCGTTTACGCGTGCAAGAGAA
CGGATCAATTGAATCATTGTTTCAGCATTGTCGAATGTTTGCCTTCGAGA
GAAGAGGGAGTCATTAGCCGTCCCGTGGAAGAGCTTCACATACAACTGGA
TCAATTGGAACATTTGCTGACAGGAGCGGAAATTTTACAGTATTACAACA
ACCCTCAGACCATCTCTTACATTTCTGAAATTAAAGATGACTCTACTATT
TGTAAACAACTCATTCAGCAATTGGTGAAAAACGCTGTTTGTAAAGGACG
TTGTGTTCCAAAGGAATTGAACAAATTACTCGGACATTTGATCAAGCTTT
CCAAAGAAGTTTTCCGGTGCTGTGATATCAAGATCGTTCACCAGATTTTC
GTTGAAGAATTACTACGGTCCGGTTCACGTGAGAACATAACAGTAGCTGA
AGAGTTGATCACGCCTTCCAAACTTGCCGGGAATTCACCTCAAAGTAAGA
AACCAGAACAACATTTGACGTCTGCACTCTACCTCCTCAAATATGATGTT
TCGGTTACCGTTGTGTTGGAAGCGAGTCGTGAATATTTCAATGCAGCAAT
GTCGGGTAATGACTCTTCAATGGAACTGGCTAGATTGTGTCTAACATTGG
TCAAAGATTGTCCAGAGAGTGTTCAAGATGAATTGGATTTGATCAACTCG
TTGGGTTTATTGTATGAATTCAATGTATCCATGCTACCCTTACAAGTTCG
CCTTTGCGCTGATAAATTGGAAATTATCGATCTTTGTTTGAAGGAGAAGA
AGAATGGGTACAAGAAAAAAGACAAGCTCATCCAATTGAGTAATCTTTTG
CAAATCTGTGGCCATGACAACAAAGAACGGATTGGACAAGTCAATATTAA
AATTGCTGAATCAGCATTTGAACATAAAGATTACACATACGCTGGTATCG
TTTGTGTACAATTGGTGGATGATAATTATTCTAATGCTTGGTATATTTGC
AGGAAACTTGGTGAATGTGCTAAATATACCAACTTCACAATCAGGCAAAA
GTTGTTGAGTTTTGCGTTAACTTATTGTCCAGTACATCACATTGAAGAAG
TTTTACAAGAGAAAACTCAACTGGAAACCCAGGTTTTGTACGAGAGGTTG
GGTGTATTTACGAAAGAAGGCAAGAAAGACAAAATTGTGACCTCATCTAA
GAAAGAAACTGAGGAAGAAAACGACGAAGACAATGTTGATGGGAATAACA
TATCAATCCTCAACAAGACCAAAACTACAACAAAGAAATTGATTTCAAGC
GTCGCCAGCGTGGCTGATAACCGCTGGGTTGGATCCGCAATGAATTGGGT
CAAACCGTCGTCGGAAGGGTCTGGTAACGAAGTTGATGTTGTTGAGCGGG
AAATTGAAAGCGTTCGGCATAACCCATTTTATAGTTCGCTGGATTCGAAA
AAGATTGACGAAGATGTTCAAAGATTTAATTATAACGAGTTCAGCGACCA
TTTGAGGTGCGTCACAACCGAAGAAAAAGTATTCAATCAGCTGGTGTTAA
GAAGTCAAAAATTGAACGAGCAAAGAACCCTGGGTAAAGAGCTCGAAAAC
ACTGACCAAGCAATGCTATCGTTGAGTGATATAGCTTATACTGAAGAAAG
TTGTTTGTGTCTGGCTTACATGATGGCTATTTCTCAGCCAAAAGAAATCC
ATTCCCTATCGACCAAGCATCGGAAAAACACTTTCACTTTCCTTTTCACT
GCTTATTACTATGCATTACAAGAATAtgttaaaaacaacaaaatcgAATT
CGATAAACAAGCACAGATTTACAGCGCGCCTCCGATTGATGTGATTACAT
GGATGCTAAAAGTGTTAGGTAAGAAGCAAGgagaaaaggaagaaaaagaa
aaaggagagACTTACTTTCTGTCTAACATGAACAAGTTGCAAGACTTGAT
GCAAGCAAAGATGCTACAAGCTCTTGACAAAGgaGTGGACATCGAAAGAT
TTTCAGTTGATAATGAATATAAACGTGAAACTATACTCGGATTAGCTATG
AGTGTCGAAGACGAGTTGATTAACACAAGTTTGCTGCTAGCAGAGAAATA
TGATATCCCCGCATGGGAAGTGTTGTTATCACACGTGGAATTTTTATTCA
CTGATAGTGGTCTAAAAGCCAAAGCTATCCGCGAATCACTAAACAAATGG
AAAGTTGATTCCCATTTGAAACCGAACGGTGATAAAGTCTTTGAGCGGAT
GAAGAAATATGTTTACCCAGAAATCAATGGTAAAGACCACAATGCATTGC
TGTTGTTCTACGTTTTCCTAATGAATTGCAGCTCGCCCACTAAAATATTG
GAGGGTACGCTTACATTAGATGCTCATTCcaaacttttgaagaaaatcaa
GGCTGCTGCATCATCCATCAATTACAAACTTCTCGTGCATGGAGATTCAC
CTTTGGAGGTGATTAGAGACTGTGTTGATGATAACAATGTACATTTGTTG
GCTAAAATTGCATCCAAAATCCCCCAGGCGGATGGTAGTTACCTGTCATC
AAACAAGATCTTCTTAGCAAACGCCATTCGGatgttttggaagaaaaaag
aGAACAAGGATTGGTTGAATACATTCGAAAACTGTAAACAACACTTCACC
AAACTCCTGATAGAAGACGTTGTCACTTTTGCTGACCATGCAATTTTTGG
CGAGGAAGCTTTAGACTCGCTGACCCAAGACACCAGACTGGAGATTGGTA
AAAGAGtaataaaatatttgagacaacaACGTGGTCAAGACGAGACCAAA
CAAAGAGGAGCTGACGATTATGATTCGCTTATGGAGCGCTACGATTCATC
TATCAATGATTTGGAACTTTCCATCGAACATCTCAAAACGCTGACTGATC
CAATTTTCAAAGCAGTCTTTGGTGACGATAACGAACTGAGCAAAACCTTT
GGACGAGTATACGACTTATCACGTGGTCGAAAACAACCACTCGAAAAACT
ATTCCGTGATTTGTTCATATCGNTACAACCATTAGACAAAATTTCGAAAC
TGCGGAGTCTTTGTCGCAATGCATCTATTGACGTCCGCACGTGTTTCCAA
GATGCTTTGCGCGGGATCCTGAGTGACATCCAAAGCGATAGAGATTACAC
AAAACTACAGACTTTAACGGAGAACATCAAAGCGCATCAAGAACATCAAA
CAGACCCTCTTGTTACCCATAGCGACGTCTTAGATGTGGTGCGGCCATTT
TGTTCTGATGTTACAGCTAGCACGGATGTGAAGAGTCACGTGTTACATNT
TTTGTTCTGAatggaaGAAAATGAGCAAATATTGTATGATTTGATTGTTC
ACGAAGAATGGAAACAAGAACCACAGTTGTTGGACCAAGTTGAAAGTTAT
TTTTGGCAATATCGTGGTTCACTTCTAAAGAAGCTATGGAAAGTTTCACA
AAGTTCTGCAATTTATATGTGGGACAACTTGAAGACACAATTCAGATATC
AAGCTACCTTTGGTTGCCCACCATTGAATTTTATCAATCTGATGAACAAT
TGCTTGCCATGGCTTATGGCTTTGTCACCGGATGGAAATTTTATTGCCAT
CCTTCAAGATTCTGTTATTGAAATAAGGACTGCTGGAAATTTTGAGCAAG
TCATTACAAAATATAAGATTGAAAAAGATATGTTTCCAAGATGGCGTAAA
TTGATTTGGAATCATGACAACACCTTACTTTGTTATTCAAACAGTTTTGG
AGATTTGACCATTTTGGATATTACCGGCactaaaaaacattttattccaT
CATCAAATAATGTCAAGTTAAAAGTGCCTGGAACGCTGAGTTTGGCATTG
TGTCATGTTGAATTTGTAGCCAAAGGAAATagCTTCTTGTTATATACCTG
CACCTATCAAGGATTTTTTACAGTTTATGAAGTGAATGAATCCTCCTGCA
CAATAAAATGGGACTACTCTTTCATAACATTCCATCCATATGGATTAGCT
GGTTTGGTTATTGATCATAAAAATGGGTTATTGGTTGCAGCTGGGAATTA
TGGGAAGGAACCATTTCCTAATGTCATGGGAGATGCATGTTATGGATCAT
ATTCTGGTATCAGTCTCTGGAGATTTTTGAATGACACACCTCATCTAACT
CTGGTTGAAGACCAGGGAAAAGCTTTGAAGAAGGTATCCAGAGGTGAATG
GTTAAAGAGTGTTGTTTTAAGACGTGGCGATGAAAAAAACGAAATGTTGA
AGCATGGTATTTACAAGTTGAAATTGTCAGAAGATGGTACACAAATTGTC
ACACTGCATCTTGATGGTCGCATATCTTTTTGGAGTATCCCGTCAATGAG
GCTAATCAAAACTTGGAGTAAATCTGAACAACCTGATGCAAGTGGCGGCT
CAAGTGAAGGGTTCTCCTTTGACTCGCAGAAAAAAGAAGaTCTCACCAAA
ACAAGGAATTCAATAGATGTCAGCTGGTGGTCTGAAAAGGAGATTGCTTT
GGCATCTGGGAGGGGTGATGTAACGATTGCTTCGACTGACAGCTTGAAGA
ATTTACTTGGAGAGTCGAGTGAGAAATTTGATCCATGGCCGTCACTCAGC
CAAGTGGTGGATGGAAGCATTCTTGTGCTCGAGTGTGAGAAACGAGTGAA
CGATCCAAACAACAAAACGAAGACATCTTGGAAATGGACTTCAGAAGAAG
ATGAAAGCCAAGATGAAGTGAACTCGATTCGTTATCGATTCAAAGAACTC
ACTAAACAGATGTTATATTTCATCACTGAGGCTGAAAGGTTTTTACCAGC
TGTCAAGCCTCCAAGAATTTTAACCAACGTTTATCGTTTACTATGCTTGA
AATCTACAACACCCGAAGAATTATACACGCGGAAAATCAATCTTGAACAT
TACGGAGAGGCCTTGGACCTAGCTAAACGTTTTGGTTTGAATACTGATTT
AGTTTATCAGCGACAGTGGAAAAAGAAAAGAGTTTCGAAGATTACCATTC
ATGATTATCtgtcCAAGATTAAAGATCGATATTGGGTTTTGGACGAGTGC
CTTTTACGAGTTGCCGATGACTTTGACTCGACAGAAGAGTTACTGAAATA
CGGTTTACTCGGTACAAGTTGGGAAATCTTGCAAAGGATTGATGAAGAGG
GTAAAGGTGatgcaaaggatgatgggaAGTTATTACCTTTTAAATTTGAC
GCCGCCCCACATGACGAGGATGACGAAAACTCAAGTAGAGAATTCCAAgg
gagTCTAACGAAGAAGCAATTGAAAATCTGCCAATATCGACGGCAATTAT
TACATTATCTTGATCGGCTTTCCACTTATGAGGTTGTTTTGGGAGGCTCA
TTCAAAGCACGAGATAAATTCTCAAAAGAGTATTTTACCAAATTTCGATC
GTGCAATATGGTACACCAAGCGGTCGAGTGTGCCCGCGACGAGGACGCTT
ATACTCTGGAGCATTTGTTTTCGTACCATGGGAAGCAGTTACTACCTTAT
TGGCTGCCGATATTATCAAACTTCCCGGAAACAACCGATATCCGATATTT
TGAGCCGGTCATCCCTGAGATTGGAGAGCCACCAGAAGATCCAGAGATTT
TACCTTGGTTAGAGAAACACCATCGTGAAGAGGATTGGGTCGAGCAATCG
AATATTGTCCAACAAATCAAGTCTAATGAAGAAGGTGACGCAAACGAAGA
TATAGGCTCATTCATTTTCGAATCCGATCCAGAGATacgaaaattttaca
aatgtGAAACAAAAGCTCAACTGAGAGAATGGTTTTTACATCGTGTACAC
TTGATTGATGAATATTCCGGTCAGATTGATAAATGTTGCGAGCTGTTAGA
TGTGGGAATCAAAAGAGGCTTGGAAGGGCTCACTAAGGTTCACCAAGAAA
TGGAAGCATGGAGACTCTTAGTTTACGACGTTGGAATTGACAGTAAAATG
ACTGCAAAGAGTTTCGTGGAATTATCTGAATCATCGAAAATCAAATTGCT
AATGTTCAAAACCTCAGATGTGACATTCGTTAACGATTTCAAGCTATATC
TAATGCCGTATTTAAGAAATATTGGAAAGAAGGATTTTAAGAAACGCCAA
GATTTACTTCATGAGTTTTTGGTGGAAATCGCTAAAACTGATTTGACATG
CTGCTTGAAGTTATTGGAAAAGTGTTCGCCAGAGCTGCCAGAACCACTGC
TTCCTGATATGGCGGAGATAATGAAGATTGGGATTGATTGCGTTTACGCG
TGCAAGAGAACGGATCAATTGAATCATTGTTTCAGCATTGTCGAATGTTT
GCCTTCGAGAGAAGAGGGAGTCATTAGCCGTCCCGTGGAAGAGCTTCACA
TACAACTGGATCAATTGGAACATTTGCTGACAGGAGCGGAAATTTTACAG
TATTACAACAACCCTCAGACCATCTCTTACATTTCTGAAATTAAAGATGA
CTCTACTATTTGTAAACAACTCATTCAGCAATTGGTGAAAAACGCTGTTT
GTAAAGGACGTTGTGTTCCAAAGGAATTGAACAAATTACTCGGACATTTG
ATCAAGCTTTCCAAAGAAGTTTTCCGGTGCTGTGATATCAAGATCGTTCA
CCAGATTTTCGTTGAAGAATTACTACGGTCCGGTTCACGTGAGAACATAA
CAGTAGCTGAAGAGTTGATCACGCCTTCCAAACTTGCCGGGAATTCACCT
CAAAGTAAGAAACCAGAACAACATTTGACGTCTGCACTCTACCTCCTCAA
ATATGATGTTTCGGTTACCGTTGTGTTGGAAGCGAGTCGTGAATATTTCA
ATGCAGCAATGTCGGGTAATGACTCTTCAATGGAACTGGCTAGATTGTGT
CTAACATTGGTCAAAGATTGTCCAGAGAGTGTTCAAGATGAATTGGATTT
GATCAACTCGTTGGGTTTATTGTATGAATTCAATGTATCCATGCTACCCT
TACAAGTTCGCCTTTGCGCTGATAAATTGGAAATTATCGATCTTTGTTTG
AAGGAGAAGAAGAATGGGTACAAGAAAAAAGACAAGCTCATCCAATTGAG
TAATCTTTTGCAAATCTGTGGCCATGACAACAAAGAACGGATTGGACAAG
TCAATATTAAAATTGCTGAATCAGCATTTGAACATAAAGATTACACATAC
GCTGGTATCGTTTGTGTACAATTGGTGGATGATAATTATTCTAATGCTTG
GTATATTTGCAGGAAACTTGGTGAATGTGCTAAATATACCAACTTCACAA
TCAGGCAAAAGTTGTTGAGTTTTGCGTTAACTTATTGTCCAGTACATCAC
ATTGAAGAAGTTTTACAAGAGAAAACTCAACTGGAAACCCAGGTTTTGTA
CGAGAGGTTGGGTGTATTTACGAAAGAAGGCAAGAAAGACAAAATTGTGA
CCTCATCTAAGAAAGAAACTGAGGAAGAAAACGACGAAGACAATGTTGAT
GGGAATAACATATCAATCCTCAACAAGACCAAAACTACAACAAAGAAATT
GATTTCAAGCGTCGCCAGCGTGGCTGATAACCGCTGGGTTGGATCCGCAA
TGAATTGGGTCAAACCGTCGTCGGAAGGGTCTGGTAACGAAGTTGATGTT
GTTGAGCGGGAAATTGAAAGCGTTCGGCATAACCCATTTTATAGTTCGCT
GGATTCGAAAAAGATTGACGAAGATGTTCAAAGATTTAATTATAACGAGT
TCAGCGACCATTTGAGGTGCGTCACAACCGAAGAAAAAGTATTCAATCAG
CTGGTGTTAAGAAGTCAAAAATTGAACGAGCAAAGAACCCTGGGTAAAGA
GCTCGAAAACACTGACCAAGCAATGCTATCGTTGAGTGATATAGCTTATA
CTGAAGAAAGTTGTTTGTGTCTGGCTTACATGATGGCTATTTCTCAGCCA
AAAGAAATCCATTCCCTATCGACCAAGCATCGGAAAAACACTTTCACTTT
CCTTTTCACTGCTTATTACTATGCATTACAAGAATAtgttaaaaacaaca
aaatcgAATTCGATAAACAAGCACAGATTTACAGCGCGCCTCCGATTGAT
GTGATTACATGGATGCTAAAAGTGTTAGGTAAGAAGCAAGgagaaaagga
agaaaaagaaaaaggagagACTTACTTTCTGTCTAACATGAACAAGTTGC
AAGACTTGATGCAAGCAAAGATGCTACAAGCTCTTGACAAAGgaGTGGAC
ATCGAAAGATTTTCAGTTGATAATGAATATAAACGTGAAACTATACTCGG
ATTAGCTATGAGTGTCGAAGACGAGTTGATTAACACAAGTTTGCTGCTAG
CAGAGAAATATGATATCCCCGCATGGGAAGTGTTGTTATCACACGTGGAA
TTTTTATTCACTGATAGTGGTCTAAAAGCCAAAGCTATCCGCGAATCACT
AAACAAATGGAAAGTTGATTCCCATTTGAAACCGAACGGTGATAAAGTCT
TTGAGCGGATGAAGAAATATGTTTACCCAGAAATCAATGGTAAAGACCAC
AATGCATTGCTGTTGTTCTACGTTTTCCTAATGAATTGCAGCTCGCCCAC
TAAAATATTGGAGGGTACGCTTACATTAGATGCTCATTCcaaacttttga
agaaaatcaaGGCTGCTGCATCATCCATCAATTACAAACTTCTCGTGCAT
GGAGATTCACCTTTGGAGGTGATTAGAGACTGTGTTGATGATAACAATGT
ACATTTGTTGGCTAAAATTGCATCCAAAATCCCCCAGGCGGATGGTAGTT
ACCTGTCATCAAACAAGATCTTCTTAGCAAACGCCATTCGGatgttttgg
aagaaaaaagaGAACAAGGATTGGTTGAATACATTCGAAAACTGTAAACA
ACACTTCACCAAACTCCTGATAGAAGACGTTGTCACTTTTGCTGACCATG
CAATTTTTGGCGAGGAAGCTTTAGACTCGCTGACCCAAGACACCAGACTG
GAGATTGGTAAAAGAGtaataaaatatttgagacaacaACGTGGTCAAGA
CGAGACCAAACAAAGAGGAGCTGACGATTATGATTCGCTTATGGAGCGCT
ACGATTCATCTATCAATGATTTGGAACTTTCCATCGAACATCTCAAAACG
CTGACTGATCCAATTTTCAAAGCAGTCTTTGGTGACGATAACGAACTGAG
CAAAACCTTTGGACGAGTATACGACTTATCACGTGGTCGAAAACAACCAC
TCGAAAAACTATTCCGTGATTTGTTCATATCGNTACAACCATTAGACAAA
ATTTCGAAACTGCGGAGTCTTTGTCGCAATGCATCTATTGACGTCCGCAC
GTGTTTCCAAGATGCTTTGCGCGGGATCCTGAGTGACATCCAAAGCGATA
GAGATTACACAAAACTACAGACTTTAACGGAGAACATCAAAGCGCATCAA
GAACATCAAACAGACCCTCTTGTTACCCATAGCGACGTCTTAGATGTGGT
GCGGCCATTTTGTTCTGATGTTACAGCTAGCACGGATGTGAAGAGTCACG
TGTTACATNTTTTGTTCTGA
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_045405XLOC_045405Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073193-proteinTCONS_00073193-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00073193-exon-scaffold_88-1491911889:58872..61372TCONS_00073193-exon-scaffold_88-1491911889:58872..61372Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1510915933:58872..61372TCONS_00073193-exon-scaffold_88-1510915933:58872..61372Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1575043694:58872..61372TCONS_00073193-exon-scaffold_88-1575043694:58872..61372Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1491911889:61461..61530TCONS_00073193-exon-scaffold_88-1491911889:61461..61530Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1510915933:61461..61530TCONS_00073193-exon-scaffold_88-1510915933:61461..61530Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1575043694:61461..61530TCONS_00073193-exon-scaffold_88-1575043694:61461..61530Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1491911889:63110..63152TCONS_00073193-exon-scaffold_88-1491911889:63110..63152Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1510915933:63110..63152TCONS_00073193-exon-scaffold_88-1510915933:63110..63152Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1575043694:63110..63152TCONS_00073193-exon-scaffold_88-1575043694:63110..63152Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1491911889:63311..63394TCONS_00073193-exon-scaffold_88-1491911889:63311..63394Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1510915933:63311..63394TCONS_00073193-exon-scaffold_88-1510915933:63311..63394Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1575043694:63311..63394TCONS_00073193-exon-scaffold_88-1575043694:63311..63394Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1491911889:63688..63735TCONS_00073193-exon-scaffold_88-1491911889:63688..63735Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1510915933:63688..63735TCONS_00073193-exon-scaffold_88-1510915933:63688..63735Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1575043694:63688..63735TCONS_00073193-exon-scaffold_88-1575043694:63688..63735Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1491911889:64514..64554TCONS_00073193-exon-scaffold_88-1491911889:64514..64554Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1510915933:64514..64554TCONS_00073193-exon-scaffold_88-1510915933:64514..64554Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1575043694:64514..64554TCONS_00073193-exon-scaffold_88-1575043694:64514..64554Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1491911889:64853..64928TCONS_00073193-exon-scaffold_88-1491911889:64853..64928Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1510915933:64853..64928TCONS_00073193-exon-scaffold_88-1510915933:64853..64928Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1575043694:64853..64928TCONS_00073193-exon-scaffold_88-1575043694:64853..64928Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1491911889:65231..65288TCONS_00073193-exon-scaffold_88-1491911889:65231..65288Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1510915933:65231..65288TCONS_00073193-exon-scaffold_88-1510915933:65231..65288Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1575043694:65231..65288TCONS_00073193-exon-scaffold_88-1575043694:65231..65288Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1491911889:65400..65479TCONS_00073193-exon-scaffold_88-1491911889:65400..65479Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1510915933:65400..65479TCONS_00073193-exon-scaffold_88-1510915933:65400..65479Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1575043694:65400..65479TCONS_00073193-exon-scaffold_88-1575043694:65400..65479Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1491911889:65683..65736TCONS_00073193-exon-scaffold_88-1491911889:65683..65736Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1510915933:65683..65736TCONS_00073193-exon-scaffold_88-1510915933:65683..65736Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1575043694:65683..65736TCONS_00073193-exon-scaffold_88-1575043694:65683..65736Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1491911889:66073..66218TCONS_00073193-exon-scaffold_88-1491911889:66073..66218Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1510915933:66073..66218TCONS_00073193-exon-scaffold_88-1510915933:66073..66218Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1575043694:66073..66218TCONS_00073193-exon-scaffold_88-1575043694:66073..66218Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1491911889:66556..66656TCONS_00073193-exon-scaffold_88-1491911889:66556..66656Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1510915933:66556..66656TCONS_00073193-exon-scaffold_88-1510915933:66556..66656Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1575043694:66556..66656TCONS_00073193-exon-scaffold_88-1575043694:66556..66656Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1491911889:67319..67387TCONS_00073193-exon-scaffold_88-1491911889:67319..67387Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1510915933:67319..67387TCONS_00073193-exon-scaffold_88-1510915933:67319..67387Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1575043694:67319..67387TCONS_00073193-exon-scaffold_88-1575043694:67319..67387Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1491911889:67932..68060TCONS_00073193-exon-scaffold_88-1491911889:67932..68060Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1510915933:67932..68060TCONS_00073193-exon-scaffold_88-1510915933:67932..68060Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1575043694:67932..68060TCONS_00073193-exon-scaffold_88-1575043694:67932..68060Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1491911889:68326..68383TCONS_00073193-exon-scaffold_88-1491911889:68326..68383Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1510915933:68326..68383TCONS_00073193-exon-scaffold_88-1510915933:68326..68383Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1575043694:68326..68383TCONS_00073193-exon-scaffold_88-1575043694:68326..68383Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1491911889:68640..68689TCONS_00073193-exon-scaffold_88-1491911889:68640..68689Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1510915933:68640..68689TCONS_00073193-exon-scaffold_88-1510915933:68640..68689Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1575043694:68640..68689TCONS_00073193-exon-scaffold_88-1575043694:68640..68689Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1491911889:69304..69356TCONS_00073193-exon-scaffold_88-1491911889:69304..69356Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1510915933:69304..69356TCONS_00073193-exon-scaffold_88-1510915933:69304..69356Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1575043694:69304..69356TCONS_00073193-exon-scaffold_88-1575043694:69304..69356Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1491911889:69834..69924TCONS_00073193-exon-scaffold_88-1491911889:69834..69924Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1510915933:69834..69924TCONS_00073193-exon-scaffold_88-1510915933:69834..69924Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1575043694:69834..69924TCONS_00073193-exon-scaffold_88-1575043694:69834..69924Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1491911889:70646..70771TCONS_00073193-exon-scaffold_88-1491911889:70646..70771Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1510915933:70646..70771TCONS_00073193-exon-scaffold_88-1510915933:70646..70771Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1575043694:70646..70771TCONS_00073193-exon-scaffold_88-1575043694:70646..70771Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1491911889:73455..73510TCONS_00073193-exon-scaffold_88-1491911889:73455..73510Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1510915933:73455..73510TCONS_00073193-exon-scaffold_88-1510915933:73455..73510Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1575043694:73455..73510TCONS_00073193-exon-scaffold_88-1575043694:73455..73510Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1491911889:76541..76736TCONS_00073193-exon-scaffold_88-1491911889:76541..76736Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1510915933:76541..76736TCONS_00073193-exon-scaffold_88-1510915933:76541..76736Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1575043694:76541..76736TCONS_00073193-exon-scaffold_88-1575043694:76541..76736Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1491911889:77468..77709TCONS_00073193-exon-scaffold_88-1491911889:77468..77709Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1510915933:77468..77709TCONS_00073193-exon-scaffold_88-1510915933:77468..77709Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1575043694:77468..77709TCONS_00073193-exon-scaffold_88-1575043694:77468..77709Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1491911889:78945..79023TCONS_00073193-exon-scaffold_88-1491911889:78945..79023Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1510915933:78945..79023TCONS_00073193-exon-scaffold_88-1510915933:78945..79023Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1575043694:78945..79023TCONS_00073193-exon-scaffold_88-1575043694:78945..79023Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1491911889:80131..80372TCONS_00073193-exon-scaffold_88-1491911889:80131..80372Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1510915933:80131..80372TCONS_00073193-exon-scaffold_88-1510915933:80131..80372Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1575043694:80131..80372TCONS_00073193-exon-scaffold_88-1575043694:80131..80372Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1491911889:81351..81460TCONS_00073193-exon-scaffold_88-1491911889:81351..81460Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1510915933:81351..81460TCONS_00073193-exon-scaffold_88-1510915933:81351..81460Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1575043694:81351..81460TCONS_00073193-exon-scaffold_88-1575043694:81351..81460Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1491911889:82280..82482TCONS_00073193-exon-scaffold_88-1491911889:82280..82482Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1510915933:82280..82482TCONS_00073193-exon-scaffold_88-1510915933:82280..82482Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1575043694:82280..82482TCONS_00073193-exon-scaffold_88-1575043694:82280..82482Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1491911889:83287..83583TCONS_00073193-exon-scaffold_88-1491911889:83287..83583Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1510915933:83287..83583TCONS_00073193-exon-scaffold_88-1510915933:83287..83583Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1575043694:83287..83583TCONS_00073193-exon-scaffold_88-1575043694:83287..83583Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1491911889:85877..86010TCONS_00073193-exon-scaffold_88-1491911889:85877..86010Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1510915933:85877..86010TCONS_00073193-exon-scaffold_88-1510915933:85877..86010Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1575043694:85877..86010TCONS_00073193-exon-scaffold_88-1575043694:85877..86010Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1491911889:86536..86600TCONS_00073193-exon-scaffold_88-1491911889:86536..86600Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1510915933:86536..86600TCONS_00073193-exon-scaffold_88-1510915933:86536..86600Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1575043694:86536..86600TCONS_00073193-exon-scaffold_88-1575043694:86536..86600Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1491911889:87201..87421TCONS_00073193-exon-scaffold_88-1491911889:87201..87421Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1510915933:87201..87421TCONS_00073193-exon-scaffold_88-1510915933:87201..87421Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1575043694:87201..87421TCONS_00073193-exon-scaffold_88-1575043694:87201..87421Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1491911889:92297..92535TCONS_00073193-exon-scaffold_88-1491911889:92297..92535Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1510915933:92297..92535TCONS_00073193-exon-scaffold_88-1510915933:92297..92535Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1575043694:92297..92535TCONS_00073193-exon-scaffold_88-1575043694:92297..92535Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1491911889:92684..92796TCONS_00073193-exon-scaffold_88-1491911889:92684..92796Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1510915933:92684..92796TCONS_00073193-exon-scaffold_88-1510915933:92684..92796Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1575043694:92684..92796TCONS_00073193-exon-scaffold_88-1575043694:92684..92796Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1491911889:94612..94691TCONS_00073193-exon-scaffold_88-1491911889:94612..94691Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1510915933:94612..94691TCONS_00073193-exon-scaffold_88-1510915933:94612..94691Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1575043694:94612..94691TCONS_00073193-exon-scaffold_88-1575043694:94612..94691Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1491911889:95647..95822TCONS_00073193-exon-scaffold_88-1491911889:95647..95822Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1510915933:95647..95822TCONS_00073193-exon-scaffold_88-1510915933:95647..95822Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1575043694:95647..95822TCONS_00073193-exon-scaffold_88-1575043694:95647..95822Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1491911889:96532..96573TCONS_00073193-exon-scaffold_88-1491911889:96532..96573Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1510915933:96532..96573TCONS_00073193-exon-scaffold_88-1510915933:96532..96573Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1575043694:96532..96573TCONS_00073193-exon-scaffold_88-1575043694:96532..96573Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1491911889:97262..97349TCONS_00073193-exon-scaffold_88-1491911889:97262..97349Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1510915933:97262..97349TCONS_00073193-exon-scaffold_88-1510915933:97262..97349Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1575043694:97262..97349TCONS_00073193-exon-scaffold_88-1575043694:97262..97349Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1491911889:97651..97761TCONS_00073193-exon-scaffold_88-1491911889:97651..97761Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1510915933:97651..97761TCONS_00073193-exon-scaffold_88-1510915933:97651..97761Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1575043694:97651..97761TCONS_00073193-exon-scaffold_88-1575043694:97651..97761Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1491911889:107791..108027TCONS_00073193-exon-scaffold_88-1491911889:107791..108027Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1510915933:107791..108027TCONS_00073193-exon-scaffold_88-1510915933:107791..108027Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1575043694:107791..108027TCONS_00073193-exon-scaffold_88-1575043694:107791..108027Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1491911889:109267..109396TCONS_00073193-exon-scaffold_88-1491911889:109267..109396Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1510915933:109267..109396TCONS_00073193-exon-scaffold_88-1510915933:109267..109396Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1575043694:109267..109396TCONS_00073193-exon-scaffold_88-1575043694:109267..109396Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1491911889:109984..110060TCONS_00073193-exon-scaffold_88-1491911889:109984..110060Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1510915933:109984..110060TCONS_00073193-exon-scaffold_88-1510915933:109984..110060Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1575043694:109984..110060TCONS_00073193-exon-scaffold_88-1575043694:109984..110060Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1491911889:110573..110753TCONS_00073193-exon-scaffold_88-1491911889:110573..110753Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1510915933:110573..110753TCONS_00073193-exon-scaffold_88-1510915933:110573..110753Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1575043694:110573..110753TCONS_00073193-exon-scaffold_88-1575043694:110573..110753Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1491911889:111259..111372TCONS_00073193-exon-scaffold_88-1491911889:111259..111372Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1510915933:111259..111372TCONS_00073193-exon-scaffold_88-1510915933:111259..111372Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1575043694:111259..111372TCONS_00073193-exon-scaffold_88-1575043694:111259..111372Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1491911889:112463..112529TCONS_00073193-exon-scaffold_88-1491911889:112463..112529Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1510915933:112463..112529TCONS_00073193-exon-scaffold_88-1510915933:112463..112529Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1575043694:112463..112529TCONS_00073193-exon-scaffold_88-1575043694:112463..112529Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1491911889:113317..113427TCONS_00073193-exon-scaffold_88-1491911889:113317..113427Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1510915933:113317..113427TCONS_00073193-exon-scaffold_88-1510915933:113317..113427Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1575043694:113317..113427TCONS_00073193-exon-scaffold_88-1575043694:113317..113427Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1491911889:114256..114448TCONS_00073193-exon-scaffold_88-1491911889:114256..114448Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1510915933:114256..114448TCONS_00073193-exon-scaffold_88-1510915933:114256..114448Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1575043694:114256..114448TCONS_00073193-exon-scaffold_88-1575043694:114256..114448Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1491911889:114743..114916TCONS_00073193-exon-scaffold_88-1491911889:114743..114916Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1510915933:114743..114916TCONS_00073193-exon-scaffold_88-1510915933:114743..114916Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1575043694:114743..114916TCONS_00073193-exon-scaffold_88-1575043694:114743..114916Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1491911889:119400..119480TCONS_00073193-exon-scaffold_88-1491911889:119400..119480Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1510915933:119400..119480TCONS_00073193-exon-scaffold_88-1510915933:119400..119480Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1575043694:119400..119480TCONS_00073193-exon-scaffold_88-1575043694:119400..119480Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1491911889:120254..120465TCONS_00073193-exon-scaffold_88-1491911889:120254..120465Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1510915933:120254..120465TCONS_00073193-exon-scaffold_88-1510915933:120254..120465Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1575043694:120254..120465TCONS_00073193-exon-scaffold_88-1575043694:120254..120465Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1491911889:120949..121060TCONS_00073193-exon-scaffold_88-1491911889:120949..121060Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1510915933:120949..121060TCONS_00073193-exon-scaffold_88-1510915933:120949..121060Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1575043694:120949..121060TCONS_00073193-exon-scaffold_88-1575043694:120949..121060Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1491911889:121965..122055TCONS_00073193-exon-scaffold_88-1491911889:121965..122055Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1510915933:121965..122055TCONS_00073193-exon-scaffold_88-1510915933:121965..122055Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1575043694:121965..122055TCONS_00073193-exon-scaffold_88-1575043694:121965..122055Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1491911889:122112..122229TCONS_00073193-exon-scaffold_88-1491911889:122112..122229Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1510915933:122112..122229TCONS_00073193-exon-scaffold_88-1510915933:122112..122229Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1575043694:122112..122229TCONS_00073193-exon-scaffold_88-1575043694:122112..122229Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1491911889:123741..124045TCONS_00073193-exon-scaffold_88-1491911889:123741..124045Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1510915933:123741..124045TCONS_00073193-exon-scaffold_88-1510915933:123741..124045Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1575043694:123741..124045TCONS_00073193-exon-scaffold_88-1575043694:123741..124045Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1491911889:124525..124615TCONS_00073193-exon-scaffold_88-1491911889:124525..124615Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1510915933:124525..124615TCONS_00073193-exon-scaffold_88-1510915933:124525..124615Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1575043694:124525..124615TCONS_00073193-exon-scaffold_88-1575043694:124525..124615Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1491911889:125189..125225TCONS_00073193-exon-scaffold_88-1491911889:125189..125225Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1510915933:125189..125225TCONS_00073193-exon-scaffold_88-1510915933:125189..125225Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1575043694:125189..125225TCONS_00073193-exon-scaffold_88-1575043694:125189..125225Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1491911889:129687..129810TCONS_00073193-exon-scaffold_88-1491911889:129687..129810Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1510915933:129687..129810TCONS_00073193-exon-scaffold_88-1510915933:129687..129810Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1575043694:129687..129810TCONS_00073193-exon-scaffold_88-1575043694:129687..129810Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1491911889:131488..131613TCONS_00073193-exon-scaffold_88-1491911889:131488..131613Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1510915933:131488..131613TCONS_00073193-exon-scaffold_88-1510915933:131488..131613Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1575043694:131488..131613TCONS_00073193-exon-scaffold_88-1575043694:131488..131613Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1491911889:146317..146871TCONS_00073193-exon-scaffold_88-1491911889:146317..146871Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1510915933:146317..146871TCONS_00073193-exon-scaffold_88-1510915933:146317..146871Clytia hemisphaericaexon
TCONS_00073193-exon-scaffold_88-1575043694:146317..146871TCONS_00073193-exon-scaffold_88-1575043694:146317..146871Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
scaffold_88supercontigscaffold_88:58872..146871 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
25.7667 26.9475 8.62629 5.30574 0.79244 0.250827 0.0222309 0.00295958 0.0155617 0.000350171 0.0594894 0.00112 1.75232e-05 0.000515685 0.00887572 0.000693662 0.0676223 0.341105 0.0133784 0.00417695 1.6651 2.43034 1.08343 2.5083 0.0282294 0.0297005 0.0145338 0.268881 0.190798 0.232855
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR029145NBAS_N
IPR015943WD40/YVTN_repeat-like_dom
IPR017986WD40_repeat_dom
Vocabulary: Molecular Function
TermDefinition
GO:0005515protein binding
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
molecular_function GO:0005515 protein binding
Blast
BLAST of TCONS_00073193 vs. Swiss-Prot (Human)
Match: NBAS (Neuroblastoma-amplified sequence OS=Homo sapiens GN=NBAS PE=1 SV=2)

HSP 1 Score: 977.622 bits (2526), Expect = 0.000e+0
Identity = 681/2153 (31.63%), Postives = 1110/2153 (51.56%), Query Frame = 3
Query: 2436 ENEQILYDLIVHEEWKQEPQLL---DQVESYFWQYRGSLLKKLWKVSQSSAIYMWDNLKTQFRYQATFGCPPLNFINLMNNCLPWLMALSPDGNFIAILQDSVIEIRTA-GNFEQVITKYKIEKDMFPRWRKLIWNHDNTLLCYSNSFGDLTILDITGTKKHFI-PSSNNVKLKVPGTLSLA---LCHVEFVAKGN-SFLLYTCTYQGFFTVYEVN--------ESSCTIKWDYSFITFHPYGLAGLVIDHKNGLLVAAGNYGKEPFPNVMGDACYGSYSGISLWRFLNDTPHLTLVEDQGKALKKVSRGEWLKSVVLRRGDEKNEMLKHGIYKLKLSEDGTQIVTLHLDGRISFWSIPSMRLIKTWSKSEQP--DAXXXXXXXXXXXXQKKEDLTKTRNSIDVSWWSEKEIALASGRGDVTIASTDSLKNLLGESSEKFDPWPSLSQVVDGSILVLECEKRVNDPNNKTKTSWKWTSEEDESQDEVNSI--RYRFKELTKQMLYFITEAERFLPAVKPPRILTNVYRLLCLKSTTPEELYTRKINLEHYGEALDLAKRFGLNTDLVYQRQWKKKRVSKITIHDYLSKIKDRYWVLDECLLRVADDFDSTEELLKYGLLGTSWEILQRIDEEXXXXXXXXXXLLPFKFDA--------APHDEDDENSSREFQ-------------GSLTKKQLKICQYRRQLLHYLDRLSTYEVVLGGSFKARDKFSKEYFTKFRSCNMVHQAVECARDEDAYTLEHLFSYHGKQLLPYWLPILSNFPETTDIRYFXXXXXXXXXXXXXXXXXXWLEKHHREEDWVEQSNIVQQIKSNEEGDANEDIGSFIFESDPEIRKFYKCE-TKAQLREWFLHRVHLIDEYSGQIDKCCELLDVGIKRGLEGLTKVHQEMEAWRLLVYDVGIDSKMTAKSFVELSESSKIKLLMFKTSDVTFVNDFKLYLMPYLRNIGKKDFKKRQDLLHEFLVEIAKTDLTCCLKLLEKCSPELPEPLLPDMAEIMKIGIDCVYACKRTDQLNHCFSIVECLPSREEGVISRPVEELHIQLDQLEHLLTGAEILQYYNNPQTISYISEIKDDSTICKQLIQQLVKNAVCKGRCVP----KELNKLLGHLIKLSKEVFRCCDIKIVHQIFVEELLRSGSRENITVAEELITPSKLAGNSPQSKKPEQHLTSALYLLKYDVSVTVVLEASREYFNAAMSGNDSSMELARLCLTLVKDCPESVQDELDLINSLGLLYEFNVSMLPLQVRLCADKLEIIDLCLXXXXXXXXXXXXLIQLSNLLQICGHDNKERIGQVNIKIAESAFEHKDYTYAGIVCVQLVDDNYSNAWYICRKLGECAKYTNFTIRQKLLSFALTYCPVHHIEEVLQEKTQLETQVLYERLGVFTKEGKKDKIXXXXXXXXXXXXXXXXXDG---------XXXXXXXXXXXXXXXXXXXVASVADNRWVGSAMNWVKP---SSEGSGNEVDVVERE-IESVRHNPFYSSLDSKKIDEDVQRFNYNEFSDHLRCVTTEEKVFNQLVLRSQKLNEQRTLGKELENTDQAMLSLSDIAYTEESCLCLAYMMAISQPKEIHSLSTKHRKNTFTFLFTAYYYALQEYVKNNKIEFDKQAQIYSAPPIDVITWMLK-VLXXXXXXXXXXXXXXTYFLSNMN-KLQDLMQAKMLQALDKGVDIERFSVDNEYKRETILGLAMSVEDELINTSLLLAEKYDIPAWEVLLSHVEFLFTDSGLKAKAIRESLNKWKVDSHLKPNGDKVFERMKKYVYPEINGKDHNALLLFYVFLMNCSSPTKILEGTLTLDAHXXXXXXXXXXXXXXNYKLLVHGD-SPLEVIRDCVDDNNVHLLAKIASKIPQADGSYLSSNKIFLANAIRMFWK---------KKENKDWLNTFENCKQHFTKLLIEDVVTFADHAIFGEEALDSLTQDTRLEIGKRVIKYLR------QQRGQDETKQRGADDYDSLMERYDSSINDLELSIEHLKTLTDPIFKAVFGDDNELSKTFGRVYDLSRGRKQPLEKLFRDLFISXQPLDKISKLRSLCRNA-SIDVRTCFQDALRGILS-------DIQSDRDYTK-LQTLTENIKAHQEHQTDPLVTHSDVLDVVRPFCSDVTASTDVKSHVLHXL 8633
            E E ILYDL+V+ EW  E ++    +Q     +    ++  +L  + Q    Y+W        Y       P   + L+N  + W + L+ +G  +A +QD  +EIR+A  +F  +I K ++ KD  P+WR++ W++D TLL Y+ S G + + D+ G++   I P+S+ +     G LS A   L  +E+ A    S  L    Y+G    Y V+        ES C     +SF + +P+G+   +    + LL+  G    E     +G +   S  G+S WR L+ +P+   V + G  +  V +   L  ++  +   +    + GI+K+ LS DG  +  +H  G++S W+IPS++    W ++EQP  D         +   +K +D       IDV+WW++  + LA   G +T++S  +LKNLLG+S E F+P P ++   DG  L LECE ++    ++ +T      E +E  D    I  + R+    KQ LY +TE ERF P  K PR +T  YRL+ L+STTPEELY RKI  E Y EAL LA  +GL+TDLVYQRQW+K  V+  +I +YLSKIK R WVL ECL RV ++ D+ +ELL+YGL GT  E L  I +            LP + D         +P DE+   + +E +               LT +Q ++C+ RR+LL YLDRL+TYE +LG    +  ++  E+F KFR+ N+V  A   A++ +   LE LF+YHG  LLP+ L ILSNFPETT    +  ++PE     +   I+PW E  HR +DW E+      ++ N      +D   F++ + PE+ +F   + T  ++ +W+  R   I+ Y+ Q+D    L+ +G++R + GL  +   +     LVY+   D  +T K   ++ +  K++LLM   S+  +V     +++P+L    K+      +LL E+LV +AK DL   LK+ +   P+L + ++PD  ++M I ++C+Y C+R DQL  C+ ++ECLP R  G  +    +LH  +DQLE +L+ +E+L+ +   + IS++   +  S   ++L+ +L ++    GR  P         LL  ++ + + V+ C D    ++IF E LL S   ENI +A +++  S  + N P       H     Y + Y+ S+ +VL ASREYFN++ +  DS M+LAR CL L+ D P ++Q+ELDLI ++G L EF V +LPLQVRLC D++ +I  C+ +    YK+  KL+ L+ LL++ G + +ER GQV I + E A    DY  A + C +L+   Y  +W +C +LG+   Y +   RQ+L++FALT+CP   IE +L   + L+T++LY+R+         + I  S       + DE  V G            + +     TT    + + +V+D +W   ++ +++P      G   ++     E +E    +PFY S+ S     + +   Y+ +      V  E   F +++LR+ KL E +  G E+  T + +L L+  A   +  L LAY++A+ Q  + +    K   +  +    AYYY+LQ Y +      DK   +Y A P ++I  + + V   +     E     T  L   N +L D  QA++LQ L KGVD++RF+ D++YKRETILGLA ++E+ + + ++ LA++Y +  WEV ++H+EFLFTDSGL    I        +   LK + +   + M KY+YP I G DH  L  ++  L NC     +    +  + H +LLKK K  AS +NYK L   + SPLE +   +   N+  ++K+  KIP+ DG  LS + ++     ++FW             + +WL+ ++ C ++F +L   D++T  D   F  +A+  L+ + R E+ ++ IK ++      ++R  ++  Q   D   +    Y  ++N LE S+ HL+TL+     ++   + E  + +  +YDLSR  K+ L      + +  QPL  I +L  +      I  +   Q A+  I+S       D+   RD  K L+ +   + A  + + + LV+  D+L+ +RPFC+D       + HVL  L
Sbjct:   18 EEETILYDLLVNTEWPPETEVQPRGNQKHGASFIITKAIRDRLLFLRQ----YIW--------YSPAPFLLPDGLVRLVNKQINWHLVLASNGKLLAAVQDQCVEIRSAKDDFTSIIGKCQVPKDPKPQWRRVAWSYDCTLLAYAESTGTVRVFDLMGSELFVISPASSFI-----GDLSYAIAGLIFLEYKASAQWSAELLVINYRGELRSYLVSVGTNQSYQESHC-----FSFSSHYPHGINTAIYHPGHRLLLVGGCETAE-----VGMS-KASSCGLSAWRVLSGSPYYKQVTNGGDGVTAVPKTLGLLRMLSVKFYSRQGQEQDGIFKMSLSPDGMLLAAIHFSGKLSIWAIPSLKQQGEWGQNEQPGYDDLNPDWRLSTEKRKKIKDKESFYPLIDVNWWADSAVTLARCSGALTVSSVKTLKNLLGKSCEWFEPSPQVTATHDGGFLSLECEIKLAPKRSRLETRAGEEDEGEEDSDSDYEISAKARYFGYIKQGLYLVTEMERFAPPRKRPRTITKNYRLVSLRSTTPEELYQRKIESEEYEEALSLAHTYGLDTDLVYQRQWRKSAVNVASIQNYLSKIKKRSWVLHECLERVPENVDAAKELLQYGLKGTDLEALLAIGKGADDGRFT----LPGEIDIDSISYEELSPPDEEPAKNKKEKELKKRQELLKLVNFSKLTLEQKELCRCRRKLLTYLDRLATYEEILGVPHASEQRYDAEFFKKFRNQNIVLSARTYAQESNVQALEILFTYHGSDLLPHRLAILSNFPETTSPHEYSVLLPEACFNGDSLMIIPWHEHKHRAKDWCEELACRMVVEPN-----LQDESEFLYAAQPELLRFRMTQLTVEKVMDWYQTRAEEIEHYARQVDCALSLIRLGMERNIPGLLVLCDNLVTLETLVYEARCDVTLTLKELQQMKDIEKLRLLMNSCSEDKYVTSAYQWMVPFLHRCEKQSPGVANELLKEYLVTLAKGDLKFPLKIFQHSKPDLQQKIIPDQDQLMAIALECIYTCERNDQLCLCYDLLECLPERGYGDKTEATTKLHDMVDQLEQILSVSELLEKHGLEKPISFVKNTQSSSEEARKLMVRLTRHT---GRKQPPVSESHWRTLLQDMLTMQQNVYTCLDSDACYEIFTESLLCSSRLENIHLAGQMMHCSACSENPPAGIA---HKGKPHYRVSYEKSIDLVLAASREYFNSSTNLTDSCMDLARCCLQLITDRPPAIQEELDLIQAVGCLEEFGVKILPLQVRLCPDRISLIKECISQSPTCYKQSTKLLGLAELLRVAGENPEERRGQVLILLVEQALRFHDYKAASMHCQELMATGYPKSWDVCSQLGQSEGYQDLATRQELMAFALTHCPPSSIELLLAASSSLQTEILYQRVNFQIHHEGGENISASPLTSKAVQEDEVGVPGSNSADLLRWTTATTMKVLSNTTTTTKAVLQAVSDGQWWKKSLTYLRPLQGQKCGGAYQIGTTANEDLEKQGCHPFYESVISNPFVAESEG-TYDTYQH----VPVES--FAEVLLRTGKLAEAKNKG-EVFPTTEVLLQLASEALPNDMTLALAYLLALPQVLDANRCFEKQSPSALSLQLAAYYYSLQIYARLAPCFRDKCHPLYRADPKELIKMVTRHVTRHEHEAWPEDLISLTKQLHCYNERLLDFTQAQILQGLRKGVDVQRFTADDQYKRETILGLAETLEESVYSIAISLAQRYSVSRWEVFMTHLEFLFTDSGLSTLEIENRAQDLHLFETLKTDPEAFHQHMVKYIYPTIGGFDHERLQYYFTLLENCGC-ADLGNCAIKPETHIRLLKKFKVVASGLNYKKLTDENMSPLEALEPVLSSQNILSISKLVPKIPEKDGQMLSPSSLYTIWLQKLFWTGDPHLIKQVPGSSPEWLHAYDVCMKYFDRLHPGDLITVVDAVTFSPKAVTKLSVEARKEMTRKAIKTVKHFIEKPRKRNSEDEAQEAKDSKVT----YADTLNHLEKSLAHLETLSHSFILSLKNSEQETLQKYSHLYDLSRSEKEKLHDEAVAICLDGQPLAMIQQLLEVAVGPLDISPKDIVQSAIMKIISALSGGSADLGGPRDPLKVLEGVVAAVHASVD-KGEELVSPEDLLEWLRPFCADDAWPVRPRIHVLQIL 2113          
The following BLAST results are available for this feature:
BLAST of TCONS_00073193 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
NBAS0.000e+031.63Neuroblastoma-amplified sequence OS=Homo sapiens G... [more]
back to top